F425643

General Info

Members Datasets Scaffolds Average Seq Length
371 200 742 246

Family's Representative Sequence

Representative Sequence 3300005340|Ga0070689_100783651|Ga0070689_1007836511
Length 254
Sequence MHNLTLTNLGQTRSAHQHNHLLLTADTFVRAPLPGMKACTAVVHVGPALGAAFTEYTAEFDAGGELGSTASQRFIYVVEGAVTVELDGKRSELGARGYAYFPEGLSHRVAATTPTTRVAVFEKPYKAVKTVEQPRAIVSSEDEVSSHALNDDSDLQVKCLLPDEFSFDFAVNTMVFHPGTALSMVEMHVMEHGLIMLEGGGIYRLGDSWYPVTAGDFIWMGPWCTQWFGAIGKVPAKYLIYKDWNRHPLAGAHR

Samples

Sample ID Description Type Environment
1 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
72 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
73 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
74 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
75 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
76 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
77 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
78 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
117 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
121 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
122 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
126 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
127 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
128 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
129 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
130 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
131 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
132 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
133 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
134 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
135 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
136 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
137 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
138 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
139 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
140 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
141 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
142 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
143 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
144 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
145 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
146 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
147 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
148 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
149 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
150 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
151 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
152 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
153 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
154 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
155 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
156 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
157 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
158 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
159 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
160 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
161 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
162 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
163 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
164 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
165 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
166 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
167 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
168 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
169 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
170 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
171 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
172 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
173 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
174 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
175 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
176 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
177 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
178 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
179 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
180 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
181 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
182 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
183 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
184 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
185 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
186 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
187 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
188 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
189 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
190 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
191 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
192 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
193 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
194 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
195 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
196 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
197 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
198 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
199 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
200 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.11
Metatranscriptomes 1.89
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.81
Nodule 0
Rhizoplane 4.85
Rhizosphere 91.64
Stem 0
Stem Tuber 0
Unclassified 21.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070689_100783651 3300005340 Unclassified 837
2 LJNas_1001950 3300000546 Bacteria 2665
3 rootL2_10181003 3300003322 Bacteria 1643
4 Ga0070658_10006473 3300005327 Bacteria 9490
5 Ga0070670_100062157 3300005331 Unclassified 3206
6 Ga0068869_100002628 3300005334 Bacteria 10848
7 Ga0070666_10093604 3300005335 Unclassified 2066
8 Ga0068868_100091408 3300005338 Bacteria 2452
9 Ga0068868_100100177 3300005338 Bacteria 2344
10 Ga0070660_100029413 3300005339 Bacteria 4117
11 Ga0070689_100078217 3300005340 Bacteria 2593
12 Ga0070661_100082514 3300005344 Bacteria 2374
13 Ga0070671_100072340 3300005355 Bacteria 2879
14 Ga0070671_100114741 3300005355 Unclassified 2264
15 Ga0070673_100046637 3300005364 Bacteria 3367
16 Ga0070673_100105119 3300005364 Unclassified 2332
17 Ga0070688_100138345 3300005365 Bacteria 1651
18 Ga0070659_100004403 3300005366 Bacteria 10062
19 Ga0070667_100009845 3300005367 Bacteria 7924
20 Ga0070667_100071679 3300005367 Bacteria 2951
21 Ga0070709_10005588 3300005434 Bacteria 6809
22 Ga0070709_10196594 3300005434 Unclassified 1426
23 Ga0070714_100036875 3300005435 Unclassified 4104
24 Ga0070714_100335281 3300005435 Unclassified 1417
25 Ga0070714_100385191 3300005435 Bacteria 1322
26 Ga0070713_100261293 3300005436 Unclassified 1582
27 Ga0070710_10007898 3300005437 Bacteria 5168
28 Ga0070710_10434849 3300005437 Unclassified 886
29 Ga0070711_100000387 3300005439 Bacteria 22724
30 Ga0070711_100003084 3300005439 Bacteria 9629
31 Ga0070708_100002259 3300005445 Bacteria 14893
32 Ga0070708_100002984 3300005445 Bacteria 13148
33 Ga0070708_100022811 3300005445 Bacteria 5314
34 Ga0070708_100249094 3300005445 Bacteria 1669
35 Ga0070663_100017611 3300005455 Unclassified 4666
36 Ga0070663_100042942 3300005455 Bacteria 3179
37 Ga0070678_100165841 3300005456 Bacteria 1794
38 Ga0070681_10246074 3300005458 Unclassified 1701
39 Ga0070706_100000188 3300005467 Bacteria 78186
40 Ga0070706_100009269 3300005467 Bacteria 9170
41 Ga0070706_100019159 3300005467 Bacteria 6315
42 Ga0070706_100033354 3300005467 Unclassified 4752
43 Ga0070706_100166071 3300005467 Unclassified 2061
44 Ga0070707_100011458 3300005468 Bacteria 8270
45 Ga0070707_100091254 3300005468 Bacteria 2949
46 Ga0070707_100239086 3300005468 Unclassified 1768
47 Ga0070707_100889048 3300005468 Bacteria 855
48 Ga0070698_100001030 3300005471 Bacteria 30633
49 Ga0070698_100087425 3300005471 Bacteria 3103
50 Ga0070698_100380458 3300005471 Bacteria 1344
51 Ga0070699_100045306 3300005518 Bacteria 3806
52 Ga0070699_100172203 3300005518 Unclassified 1919
53 Ga0070697_100000146 3300005536 Bacteria 57392
54 Ga0070697_100000473 3300005536 Bacteria 30639
55 Ga0070697_100001570 3300005536 Bacteria 17415
56 Ga0068853_100011165 3300005539 Bacteria 7288
57 Ga0070696_100212223 3300005546 Bacteria 1449
58 Ga0070665_100003748 3300005548 Bacteria 16096
59 Ga0070665_100006263 3300005548 Bacteria 12164
60 Ga0070665_100044497 3300005548 Unclassified 4458
61 Ga0068855_100357190 3300005563 Bacteria 1608
62 Ga0068854_100000158 3300005578 Bacteria 46506
63 Ga0068856_100444076 3300005614 Bacteria 1318
64 Ga0068859_100011260 3300005617 Bacteria 9001
65 Ga0068859_100021013 3300005617 Bacteria 6552
66 Ga0068859_100106305 3300005617 Unclassified 2866
67 Ga0068864_100048841 3300005618 Unclassified 3639
68 Ga0068864_100056299 3300005618 Unclassified 3397
69 Ga0068863_100003694 3300005841 Bacteria 15126
70 Ga0068863_100015188 3300005841 Bacteria 7398
71 Ga0068863_100027915 3300005841 Bacteria 5387
72 Ga0068863_100140240 3300005841 Unclassified 2310
73 Ga0068858_100007248 3300005842 Bacteria 10742
74 Ga0068860_100075395 3300005843 Unclassified 3208
75 Ga0068860_100087922 3300005843 Bacteria 2958
76 Ga0081540_1010589 3300005983 Bacteria 6230
77 Ga0070717_10002087 3300006028 Bacteria 14001
78 Ga0070717_10003427 3300006028 Bacteria 11341
79 Ga0070717_10138963 3300006028 Unclassified 2094
80 Ga0070715_10002195 3300006163 Bacteria 5922
81 Ga0070715_10052880 3300006163 Bacteria 1753
82 Ga0070715_10069576 3300006163 Bacteria 1568
83 Ga0070715_10088161 3300006163 Bacteria 1422
84 Ga0070716_100000121 3300006173 Bacteria 30983
85 Ga0070716_100000509 3300006173 Bacteria 16189
86 Ga0070716_100010037 3300006173 Unclassified 4736
87 Ga0070716_100346471 3300006173 Bacteria 1050
88 Ga0070716_100380096 3300006173 Bacteria 1009
89 Ga0070716_100701759 3300006173 Unclassified 773
90 Ga0070712_100001428 3300006175 Bacteria 14562
91 Ga0070712_100035424 3300006175 Bacteria 3388
92 Ga0070712_100103175 3300006175 Bacteria 2114
93 Ga0070712_100368278 3300006175 Bacteria 1180
94 Ga0097621_100026435 3300006237 Unclassified 4553
95 Ga0097621_100061205 3300006237 Unclassified 3087
96 Ga0068871_100035211 3300006358 Bacteria 3976
97 Ga0068871_100236624 3300006358 Unclassified 1586
98 Ga0075434_100045431 3300006871 Bacteria 4358
99 Ga0075434_100057024 3300006871 Bacteria 3882
100 Ga0068865_100007544 3300006881 Bacteria 6695
101 Ga0097620_100011260 3300006931 Bacteria 9001
102 Ga0097620_100021013 3300006931 Bacteria 6552
103 Ga0097620_100106303 3300006931 Unclassified 2866
104 Ga0075435_100077834 3300007076 Unclassified 2719
105 Ga0075435_100349161 3300007076 Unclassified 1268
106 Ga0099794_10002316 3300007265 Bacteria 6992
107 Ga0099794_10023658 3300007265 Bacteria 2813
108 Ga0099794_10097553 3300007265 Bacteria 1464
109 Ga0105240_10001912 3300009093 Bacteria 34569
110 Ga0105240_10012010 3300009093 Bacteria 12004
111 Ga0105245_10076275 3300009098 Bacteria 3054
112 Ga0105245_10159961 3300009098 Bacteria 2136
113 Ga0105241_10225988 3300009174 Bacteria 1576
114 Ga0105248_10037914 3300009177 Bacteria 5392
115 Ga0105248_10240137 3300009177 Bacteria 2039
116 Ga0105248_10302028 3300009177 Bacteria 1803
117 Ga0105248_10434448 3300009177 Unclassified 1479
118 Ga0105237_10004655 3300009545 Bacteria 15804
119 Ga0105237_10135787 3300009545 Bacteria 2454
120 Ga0105237_10330272 3300009545 Bacteria 1529
121 Ga0105249_10023163 3300009553 Bacteria 5569
122 Ga0105239_10066931 3300010375 Unclassified 3946
123 Ga0105239_10208864 3300010375 Unclassified 2188
124 Ga0105239_10586121 3300010375 Unclassified 1271
125 Ga0157370_10019180 3300013104 Bacteria 6873
126 Ga0157370_10068859 3300013104 Bacteria 3344
127 Ga0157370_10076964 3300013104 Bacteria 3143
128 Ga0157369_10043379 3300013105 Bacteria 4903
129 Ga0157369_10138974 3300013105 Bacteria 2571
130 Ga0157369_10731485 3300013105 Bacteria 1018
131 Ga0157374_10002043 3300013296 Bacteria 16962
132 Ga0157374_10030960 3300013296 Unclassified 4859
133 Ga0157374_10056743 3300013296 Bacteria 3657
134 Ga0157378_10037991 3300013297 Bacteria 4267
135 Ga0163162_10001103 3300013306 Bacteria 25047
136 Ga0163162_10002235 3300013306 Bacteria 18186
137 Ga0163162_10003571 3300013306 Bacteria 14873
138 Ga0157372_10076216 3300013307 Bacteria 3786
139 Ga0157375_10023625 3300013308 Bacteria 5675
140 Ga0163163_10258487 3300014325 Bacteria 1792
141 Ga0163163_10634306 3300014325 Unclassified 1132
142 Ga0157377_10140915 3300014745 Unclassified 1482
143 Ga0157379_10010460 3300014968 Bacteria 8088
144 Ga0157379_10064740 3300014968 Bacteria 3267
145 Ga0157379_10147778 3300014968 Bacteria 2119
146 Ga0157379_10225772 3300014968 Unclassified 1697
147 Ga0157376_10000468 3300014969 Bacteria 25990
148 Ga0157376_10004615 3300014969 Bacteria 9595
149 Ga0157376_10065217 3300014969 Unclassified 3074
150 Ga0157376_10483257 3300014969 Bacteria 1214
151 Ga0213873_10005556 3300021358 Bacteria 2428
152 Ga0213872_10007574 3300021361 Bacteria 5330
153 Ga0213875_10123326 3300021388 Unclassified 1211
154 Ga0224569_100006 3300022732 Bacteria 13133
155 Ga0224571_100345 3300022734 Bacteria 2458
156 Ga0224572_1005115 3300024225 Bacteria 2323
157 Ga0228598_1000014 3300024227 Bacteria 23932
158 Ga0228598_1001444 3300024227 Bacteria 5235
159 Ga0207692_10018686 3300025898 Bacteria 3117
160 Ga0207692_10154741 3300025898 Bacteria 1316
161 Ga0207680_10019161 3300025903 Bacteria 3655
162 Ga0207680_10075253 3300025903 Bacteria 2105
163 Ga0207680_10405561 3300025903 Unclassified 964
164 Ga0207647_10011495 3300025904 Bacteria 6207
165 Ga0207647_10018986 3300025904 Bacteria 4632
166 Ga0207685_10002134 3300025905 Bacteria 4442
167 Ga0207685_10009118 3300025905 Unclassified 2867
168 Ga0207685_10025065 3300025905 Bacteria 2054
169 Ga0207685_10031075 3300025905 Bacteria 1908
170 Ga0207699_10083225 3300025906 Bacteria 1990
171 Ga0207705_10189989 3300025909 Bacteria 1552
172 Ga0207684_10000498 3300025910 Bacteria 49771
173 Ga0207684_10001145 3300025910 Bacteria 29602
174 Ga0207684_10074427 3300025910 Bacteria 2886
175 Ga0207684_10090665 3300025910 Bacteria 2604
176 Ga0207707_10393993 3300025912 Bacteria 1190
177 Ga0207695_10002843 3300025913 Bacteria 25155
178 Ga0207695_10012721 3300025913 Bacteria 10076
179 Ga0207695_10443116 3300025913 Bacteria 1182
180 Ga0207671_10175664 3300025914 Bacteria 1665
181 Ga0207693_10000243 3300025915 Bacteria 50405
182 Ga0207693_10010615 3300025915 Bacteria 7472
183 Ga0207693_10060967 3300025915 Unclassified 2955
184 Ga0207663_10000901 3300025916 Bacteria 13557
185 Ga0207663_10002150 3300025916 Bacteria 9404
186 Ga0207657_10027171 3300025919 Bacteria 5245
187 Ga0207657_10226819 3300025919 Bacteria 1495
188 Ga0207649_10039597 3300025920 Bacteria 2859
189 Ga0207646_10000557 3300025922 Bacteria 49083
190 Ga0207646_10001837 3300025922 Bacteria 25647
191 Ga0207646_10006706 3300025922 Bacteria 11864
192 Ga0207646_10476766 3300025922 Bacteria 1125
193 Ga0207650_10018497 3300025925 Unclassified 4890
194 Ga0207650_10032122 3300025925 Bacteria 3797
195 Ga0207687_10081198 3300025927 Bacteria 2342
196 Ga0207687_10223946 3300025927 Bacteria 1482
197 Ga0207700_10018526 3300025928 Plasmid 4682
198 Ga0207700_10109555 3300025928 Bacteria 2219
199 Ga0207700_10115813 3300025928 Bacteria 2165
200 Ga0207700_10236153 3300025928 Unclassified 1557
201 Ga0207664_10099337 3300025929 Bacteria 2401
202 Ga0207664_10350607 3300025929 Bacteria 1306
203 Ga0207644_10216738 3300025931 Bacteria 1515
204 Ga0207644_10273921 3300025931 Unclassified 1353
205 Ga0207670_10048590 3300025936 Bacteria 2833
206 Ga0207704_10001355 3300025938 Bacteria 10940
207 Ga0207665_10000014 3300025939 Bacteria 137803
208 Ga0207665_10001778 3300025939 Bacteria 14507
209 Ga0207665_10280400 3300025939 Bacteria 1240
210 Ga0207665_10284888 3300025939 Bacteria 1231
211 Ga0207667_10041047 3300025949 Bacteria 4922
212 Ga0207651_10004043 3300025960 Bacteria 7303
213 Ga0207651_10097486 3300025960 Bacteria 2171
214 Ga0207712_10065638 3300025961 Bacteria 2591
215 Ga0207640_10000174 3300025981 Bacteria 46538
216 Ga0207658_10008409 3300025986 Bacteria 7024
217 Ga0207677_10119853 3300026023 Bacteria 1977
218 Ga0207703_10252982 3300026035 Bacteria 1589
219 Ga0207703_10545044 3300026035 Bacteria 1093
220 Ga0207639_10000115 3300026041 Bacteria 62079
221 Ga0207678_10002890 3300026067 Bacteria 15595
222 Ga0207678_10031692 3300026067 Unclassified 4609
223 Ga0207702_10284246 3300026078 Bacteria 1565
224 Ga0207641_10007893 3300026088 Bacteria 8826
225 Ga0207641_10026852 3300026088 Bacteria 4754
226 Ga0207641_10062336 3300026088 Bacteria 3182
227 Ga0207641_10066978 3300026088 Bacteria 3075
228 Ga0207641_10093177 3300026088 Bacteria 2640
229 Ga0207648_10225419 3300026089 Bacteria 1667
230 Ga0207676_10076907 3300026095 Bacteria 2698
231 Ga0207675_100096747 3300026118 Bacteria 2779
232 Ga0209588_1011395 3300027671 Bacteria 2684
233 Ga0265354_1000482 3300028016 Bacteria 6926
234 Ga0265356_1000244 3300028017 Bacteria 10250
235 Ga0268266_10000440 3300028379 Bacteria 62176
236 Ga0268266_10001765 3300028379 Bacteria 24587
237 Ga0268266_10054589 3300028379 Bacteria 3433
238 Ga0268266_10306646 3300028379 Bacteria 1483
239 Ga0268264_10061645 3300028381 Bacteria 3147
240 Ga0268264_10088796 3300028381 Unclassified 2661
241 Ga0265334_10077516 3300028573 Bacteria 1229
242 Ga0265338_10055105 3300028800 Bacteria 3540
243 Ga0265338_10134290 3300028800 Bacteria 1948
244 Ga0265762_1000045 3300030760 Bacteria 14984
245 Ga0265762_1000131 3300030760 Bacteria 11312
246 Ga0265765_1000148 3300030879 Bacteria 4364
247 Ga0265765_1007716 3300030879 Bacteria 1163
248 Ga0265760_10000351 3300031090 Bacteria 12934
249 Ga0265760_10001431 3300031090 Bacteria 7025
250 Ga0265760_10002012 3300031090 Bacteria 5979
251 Ga0265330_10030487 3300031235 Bacteria 2421
252 Ga0265325_10058913 3300031241 Bacteria 1954
253 Ga0265325_10133503 3300031241 Unclassified 1186
254 Ga0265340_10030118 3300031247 Bacteria 2722
255 Ga0265340_10038183 3300031247 Bacteria 2377
256 Ga0265339_10006157 3300031249 Bacteria 7903
257 Ga0265339_10012828 3300031249 Bacteria 5095
258 Ga0265339_10046153 3300031249 Bacteria 2396
259 Ga0265339_10076411 3300031249 Bacteria 1776
260 Ga0265331_10030467 3300031250 Unclassified 2686
261 Ga0265316_10044525 3300031344 Bacteria 3529
262 Ga0265316_10076920 3300031344 Bacteria 2563
263 Ga0265316_10133621 3300031344 Bacteria 1868
264 Ga0265313_10009029 3300031595 Bacteria 6535
265 Ga0265313_10015877 3300031595 Unclassified 4357
266 Ga0265313_10033000 3300031595 Bacteria 2636
267 Ga0265314_10001387 3300031711 Bacteria 27158
268 Ga0265314_10052576 3300031711 Bacteria 2830
269 Ga0265314_10204779 3300031711 Bacteria 1163
270 Ga0265342_10001654 3300031712 Bacteria 20488
271 Ga0265342_10007107 3300031712 Bacteria 8244
272 Ga0265342_10008761 3300031712 Bacteria 7216
273 Ga0265342_10029418 3300031712 Unclassified 3410
274 Ga0265342_10108633 3300031712 Bacteria 1572
275 Ga0265342_10115998 3300031712 Unclassified 1511
276 Ga0265342_10242453 3300031712 Bacteria 964
277 Ga0307510_10041580 3300033180 Bacteria 5022
278 Ga0307510_10284221 3300033180 Bacteria 1123
279 Ga0373953_0236190 3300035117 Bacteria 793
280 Ga0373931_0032802 3300035691 Unclassified 2689
281 Ga0373931_0116550 3300035691 Unclassified 1522
282 Ga0373933_0037178 3300035724 Unclassified 2855
283 Ga0373933_0234875 3300035724 Bacteria 1178
284 Ga0373937_0171491 3300036401 Bacteria 2036
285 Ga0373937_0835282 3300036401 Unclassified 869
286 Ga0373925_0085496 3300037068 Unclassified 2405
287 Ga0436365_0729448 3300039437 Unclassified 1720
288 Ga0436361_0485637 3300039447 Bacteria 12799
289 Ga0436363_1069841 3300039450 Bacteria 2997
290 Ga0436362_1296226 3300039453 Bacteria 6871
291 Ga0466967_0157341 3300045976 Bacteria 2130
292 Ga0495592_0051502 3300046454 Bacteria 3058
293 Ga0495603_0008590 3300046455 Bacteria 6173
294 Ga0495651_0045558 3300046462 Unclassified 3398
295 Ga0495651_0216511 3300046462 Unclassified 1329
296 Ga0495650_0001650 3300046471 Bacteria 20636
297 Ga0495580_0025425 3300046472 Bacteria 4327
298 Ga0495580_0031249 3300046472 Bacteria 3849
299 Ga0495580_0039955 3300046472 Unclassified 3355
300 Ga0495582_0000279 3300046473 Bacteria 28597
301 Ga0495582_0001434 3300046473 Bacteria 13440
302 Ga0495582_0373660 3300046473 Bacteria 821
303 Ga0495639_0028011 3300046475 Bacteria 2495
304 Ga0495664_0422099 3300046477 Bacteria 800
305 Ga0495584_0089213 3300046491 Bacteria 1555
306 Ga0495585_0065794 3300046492 Bacteria 1986
307 Ga0495594_0000513 3300046499 Bacteria 19765
308 Ga0495594_0001127 3300046499 Bacteria 13943
309 Ga0495594_0021717 3300046499 Unclassified 3428
310 Ga0495606_0127017 3300046507 Bacteria 1520
311 Ga0495630_0152984 3300046517 Bacteria 1755
312 Ga0495644_0000393 3300046523 Bacteria 19612
313 Ga0495648_0099921 3300046524 Bacteria 1604
314 Ga0495666_0014536 3300046526 Bacteria 3920
315 Ga0495640_0056208 3300046533 Unclassified 2689
316 Ga0495587_0003818 3300046536 Bacteria 9996
317 Ga0495587_0007198 3300046536 Bacteria 7219
318 Ga0495609_0182132 3300046538 Bacteria 884
319 Ga0495668_0054210 3300046616 Bacteria 2217
320 Ga0495625_0128852 3300046660 Bacteria 1715
321 Ga0495625_0298715 3300046660 Unclassified 1031
322 Ga0495599_0109508 3300046678 Unclassified 1721
323 Ga0495623_0199556 3300046679 Bacteria 1151
324 Ga0495646_0376016 3300046680 Bacteria 741
325 Ga0495647_0008980 3300046681 Unclassified 3371
326 Ga0495669_0007436 3300046684 Bacteria 4594
327 Ga0495613_0010817 3300046689 Bacteria 6769
328 Ga0495613_0123311 3300046689 Bacteria 1859
329 Ga0495649_0005375 3300046694 Bacteria 8160
330 Ga0495581_0043738 3300047315 Bacteria 2590
331 Ga0495604_0003721 3300047317 Bacteria 12154
332 Ga0495604_0280012 3300047317 Unclassified 1127
333 Ga0495674_0096887 3300047319 Unclassified 2513
334 Ga0495674_0294588 3300047319 Unclassified 1326
335 Ga0495680_0020496 3300047322 Bacteria 5562
336 Ga0495683_0175880 3300047323 Unclassified 981
337 Ga0495687_050538 3300047443 Bacteria 1771
338 Ga0495684_0002721 3300047471 Bacteria 13986
339 Ga0495684_0142593 3300047471 Unclassified 1796
340 Ga0495686_0173222 3300047472 Bacteria 1254
341 Ga0495602_0013475 3300048088 Bacteria 8356
342 Ga0496100_0100091 3300048903 Unclassified 1996
343 Ga0496101_0068934 3300048904 Unclassified 2587
344 Ga0496102_0000662 3300048905 Bacteria 34346
345 Ga0496103_0026120 3300048906 Bacteria 3534
346 Ga0496104_0017067 3300048907 Bacteria 6606
347 Ga0496104_0200451 3300048907 Unclassified 1908
348 Ga0496105_0092604 3300048908 Bacteria 2496
349 Ga0496105_0255743 3300048908 Bacteria 1418
350 Ga0496106_0013290 3300048909 Bacteria 6077
351 Ga0496107_0038755 3300048910 Unclassified 3418
352 Ga0496112_0000961 3300048915 Bacteria 20945
353 Ga0496112_0193145 3300048915 Unclassified 1997
354 Ga0496112_0194910 3300048915 Unclassified 1987
355 Ga0496114_0119880 3300048917 Bacteria 2262
356 Ga0496114_0203350 3300048917 Bacteria 1735
357 Ga0496115_0007866 3300048918 Bacteria 7862
358 Ga0496115_0034324 3300048918 Bacteria 4009
359 Ga0496115_0120592 3300048918 Bacteria 2158
360 Ga0496119_0172049 3300048922 Bacteria 1143
361 Ga0496126_0002968 3300048929 Bacteria 22031
362 Ga0496126_0237050 3300048929 Bacteria 1526
363 Ga0496126_0580178 3300048929 Bacteria 886
364 Ga0495682_0008547 3300049460 Bacteria 4030
365 nmdc:mga0n895_104137_c1 3300050512 Bacteria 2850
366 nmdc:mga0rr50_331803_c1 3300050513 Unclassified 1277
367 nmdc:mga0rr50_57811_c1 3300050513 Bacteria 2903
368 nmdc:mga08x19_78531_c1 3300050514 Bacteria 2163
369 Ga0500595_000044 3300053119 Bacteria 91895
370 Ga0500595_014529 3300053119 Unclassified 2984
371 Ga0500661_003901 3300055283 Bacteria 2796
372 Ga0070689_100783651
373 LJNas_1001950
374 rootL2_10181003
375 Ga0070658_10006473
376 Ga0070670_100062157
377 Ga0068869_100002628
378 Ga0070666_10093604
379 Ga0068868_100091408
380 Ga0068868_100100177
381 Ga0070660_100029413
382 Ga0070689_100078217
383 Ga0070661_100082514
384 Ga0070671_100072340
385 Ga0070671_100114741
386 Ga0070673_100046637
387 Ga0070673_100105119
388 Ga0070688_100138345
389 Ga0070659_100004403
390 Ga0070667_100009845
391 Ga0070667_100071679
392 Ga0070709_10005588
393 Ga0070709_10196594
394 Ga0070714_100036875
395 Ga0070714_100335281
396 Ga0070714_100385191
397 Ga0070713_100261293
398 Ga0070710_10007898
399 Ga0070710_10434849
400 Ga0070711_100000387
401 Ga0070711_100003084
402 Ga0070708_100002259
403 Ga0070708_100002984
404 Ga0070708_100022811
405 Ga0070708_100249094
406 Ga0070663_100017611
407 Ga0070663_100042942
408 Ga0070678_100165841
409 Ga0070681_10246074
410 Ga0070706_100000188
411 Ga0070706_100009269
412 Ga0070706_100019159
413 Ga0070706_100033354
414 Ga0070706_100166071
415 Ga0070707_100011458
416 Ga0070707_100091254
417 Ga0070707_100239086
418 Ga0070707_100889048
419 Ga0070698_100001030
420 Ga0070698_100087425
421 Ga0070698_100380458
422 Ga0070699_100045306
423 Ga0070699_100172203
424 Ga0070697_100000146
425 Ga0070697_100000473
426 Ga0070697_100001570
427 Ga0068853_100011165
428 Ga0070696_100212223
429 Ga0070665_100003748
430 Ga0070665_100006263
431 Ga0070665_100044497
432 Ga0068855_100357190
433 Ga0068854_100000158
434 Ga0068856_100444076
435 Ga0068859_100011260
436 Ga0068859_100021013
437 Ga0068859_100106305
438 Ga0068864_100048841
439 Ga0068864_100056299
440 Ga0068863_100003694
441 Ga0068863_100015188
442 Ga0068863_100027915
443 Ga0068863_100140240
444 Ga0068858_100007248
445 Ga0068860_100075395
446 Ga0068860_100087922
447 Ga0081540_1010589
448 Ga0070717_10002087
449 Ga0070717_10003427
450 Ga0070717_10138963
451 Ga0070715_10002195
452 Ga0070715_10052880
453 Ga0070715_10069576
454 Ga0070715_10088161
455 Ga0070716_100000121
456 Ga0070716_100000509
457 Ga0070716_100010037
458 Ga0070716_100346471
459 Ga0070716_100380096
460 Ga0070716_100701759
461 Ga0070712_100001428
462 Ga0070712_100035424
463 Ga0070712_100103175
464 Ga0070712_100368278
465 Ga0097621_100026435
466 Ga0097621_100061205
467 Ga0068871_100035211
468 Ga0068871_100236624
469 Ga0075434_100045431
470 Ga0075434_100057024
471 Ga0068865_100007544
472 Ga0097620_100011260
473 Ga0097620_100021013
474 Ga0097620_100106303
475 Ga0075435_100077834
476 Ga0075435_100349161
477 Ga0099794_10002316
478 Ga0099794_10023658
479 Ga0099794_10097553
480 Ga0105240_10001912
481 Ga0105240_10012010
482 Ga0105245_10076275
483 Ga0105245_10159961
484 Ga0105241_10225988
485 Ga0105248_10037914
486 Ga0105248_10240137
487 Ga0105248_10302028
488 Ga0105248_10434448
489 Ga0105237_10004655
490 Ga0105237_10135787
491 Ga0105237_10330272
492 Ga0105249_10023163
493 Ga0105239_10066931
494 Ga0105239_10208864
495 Ga0105239_10586121
496 Ga0157370_10019180
497 Ga0157370_10068859
498 Ga0157370_10076964
499 Ga0157369_10043379
500 Ga0157369_10138974
501 Ga0157369_10731485
502 Ga0157374_10002043
503 Ga0157374_10030960
504 Ga0157374_10056743
505 Ga0157378_10037991
506 Ga0163162_10001103
507 Ga0163162_10002235
508 Ga0163162_10003571
509 Ga0157372_10076216
510 Ga0157375_10023625
511 Ga0163163_10258487
512 Ga0163163_10634306
513 Ga0157377_10140915
514 Ga0157379_10010460
515 Ga0157379_10064740
516 Ga0157379_10147778
517 Ga0157379_10225772
518 Ga0157376_10000468
519 Ga0157376_10004615
520 Ga0157376_10065217
521 Ga0157376_10483257
522 Ga0213873_10005556
523 Ga0213872_10007574
524 Ga0213875_10123326
525 Ga0224569_100006
526 Ga0224571_100345
527 Ga0224572_1005115
528 Ga0228598_1000014
529 Ga0228598_1001444
530 Ga0207692_10018686
531 Ga0207692_10154741
532 Ga0207680_10019161
533 Ga0207680_10075253
534 Ga0207680_10405561
535 Ga0207647_10011495
536 Ga0207647_10018986
537 Ga0207685_10002134
538 Ga0207685_10009118
539 Ga0207685_10025065
540 Ga0207685_10031075
541 Ga0207699_10083225
542 Ga0207705_10189989
543 Ga0207684_10000498
544 Ga0207684_10001145
545 Ga0207684_10074427
546 Ga0207684_10090665
547 Ga0207707_10393993
548 Ga0207695_10002843
549 Ga0207695_10012721
550 Ga0207695_10443116
551 Ga0207671_10175664
552 Ga0207693_10000243
553 Ga0207693_10010615
554 Ga0207693_10060967
555 Ga0207663_10000901
556 Ga0207663_10002150
557 Ga0207657_10027171
558 Ga0207657_10226819
559 Ga0207649_10039597
560 Ga0207646_10000557
561 Ga0207646_10001837
562 Ga0207646_10006706
563 Ga0207646_10476766
564 Ga0207650_10018497
565 Ga0207650_10032122
566 Ga0207687_10081198
567 Ga0207687_10223946
568 Ga0207700_10018526
569 Ga0207700_10109555
570 Ga0207700_10115813
571 Ga0207700_10236153
572 Ga0207664_10099337
573 Ga0207664_10350607
574 Ga0207644_10216738
575 Ga0207644_10273921
576 Ga0207670_10048590
577 Ga0207704_10001355
578 Ga0207665_10000014
579 Ga0207665_10001778
580 Ga0207665_10280400
581 Ga0207665_10284888
582 Ga0207667_10041047
583 Ga0207651_10004043
584 Ga0207651_10097486
585 Ga0207712_10065638
586 Ga0207640_10000174
587 Ga0207658_10008409
588 Ga0207677_10119853
589 Ga0207703_10252982
590 Ga0207703_10545044
591 Ga0207639_10000115
592 Ga0207678_10002890
593 Ga0207678_10031692
594 Ga0207702_10284246
595 Ga0207641_10007893
596 Ga0207641_10026852
597 Ga0207641_10062336
598 Ga0207641_10066978
599 Ga0207641_10093177
600 Ga0207648_10225419
601 Ga0207676_10076907
602 Ga0207675_100096747
603 Ga0209588_1011395
604 Ga0265354_1000482
605 Ga0265356_1000244
606 Ga0268266_10000440
607 Ga0268266_10001765
608 Ga0268266_10054589
609 Ga0268266_10306646
610 Ga0268264_10061645
611 Ga0268264_10088796
612 Ga0265334_10077516
613 Ga0265338_10055105
614 Ga0265338_10134290
615 Ga0265762_1000045
616 Ga0265762_1000131
617 Ga0265765_1000148
618 Ga0265765_1007716
619 Ga0265760_10000351
620 Ga0265760_10001431
621 Ga0265760_10002012
622 Ga0265330_10030487
623 Ga0265325_10058913
624 Ga0265325_10133503
625 Ga0265340_10030118
626 Ga0265340_10038183
627 Ga0265339_10006157
628 Ga0265339_10012828
629 Ga0265339_10046153
630 Ga0265339_10076411
631 Ga0265331_10030467
632 Ga0265316_10044525
633 Ga0265316_10076920
634 Ga0265316_10133621
635 Ga0265313_10009029
636 Ga0265313_10015877
637 Ga0265313_10033000
638 Ga0265314_10001387
639 Ga0265314_10052576
640 Ga0265314_10204779
641 Ga0265342_10001654
642 Ga0265342_10007107
643 Ga0265342_10008761
644 Ga0265342_10029418
645 Ga0265342_10108633
646 Ga0265342_10115998
647 Ga0265342_10242453
648 Ga0307510_10041580
649 Ga0307510_10284221
650 Ga0373953_0236190
651 Ga0373931_0032802
652 Ga0373931_0116550
653 Ga0373933_0037178
654 Ga0373933_0234875
655 Ga0373937_0171491
656 Ga0373937_0835282
657 Ga0373925_0085496
658 Ga0436365_0729448
659 Ga0436361_0485637
660 Ga0436363_1069841
661 Ga0436362_1296226
662 Ga0466967_0157341
663 Ga0495592_0051502
664 Ga0495603_0008590
665 Ga0495651_0045558
666 Ga0495651_0216511
667 Ga0495650_0001650
668 Ga0495580_0025425
669 Ga0495580_0031249
670 Ga0495580_0039955
671 Ga0495582_0000279
672 Ga0495582_0001434
673 Ga0495582_0373660
674 Ga0495639_0028011
675 Ga0495664_0422099
676 Ga0495584_0089213
677 Ga0495585_0065794
678 Ga0495594_0000513
679 Ga0495594_0001127
680 Ga0495594_0021717
681 Ga0495606_0127017
682 Ga0495630_0152984
683 Ga0495644_0000393
684 Ga0495648_0099921
685 Ga0495666_0014536
686 Ga0495640_0056208
687 Ga0495587_0003818
688 Ga0495587_0007198
689 Ga0495609_0182132
690 Ga0495668_0054210
691 Ga0495625_0128852
692 Ga0495625_0298715
693 Ga0495599_0109508
694 Ga0495623_0199556
695 Ga0495646_0376016
696 Ga0495647_0008980
697 Ga0495669_0007436
698 Ga0495613_0010817
699 Ga0495613_0123311
700 Ga0495649_0005375
701 Ga0495581_0043738
702 Ga0495604_0003721
703 Ga0495604_0280012
704 Ga0495674_0096887
705 Ga0495674_0294588
706 Ga0495680_0020496
707 Ga0495683_0175880
708 Ga0495687_050538
709 Ga0495684_0002721
710 Ga0495684_0142593
711 Ga0495686_0173222
712 Ga0495602_0013475
713 Ga0496100_0100091
714 Ga0496101_0068934
715 Ga0496102_0000662
716 Ga0496103_0026120
717 Ga0496104_0017067
718 Ga0496104_0200451
719 Ga0496105_0092604
720 Ga0496105_0255743
721 Ga0496106_0013290
722 Ga0496107_0038755
723 Ga0496112_0000961
724 Ga0496112_0193145
725 Ga0496112_0194910
726 Ga0496114_0119880
727 Ga0496114_0203350
728 Ga0496115_0007866
729 Ga0496115_0034324
730 Ga0496115_0120592
731 Ga0496119_0172049
732 Ga0496126_0002968
733 Ga0496126_0237050
734 Ga0496126_0580178
735 Ga0495682_0008547
736 nmdc:mga0n895_104137_c1
737 nmdc:mga0rr50_331803_c1
738 nmdc:mga0rr50_57811_c1
739 nmdc:mga08x19_78531_c1
740 Ga0500595_000044
741 Ga0500595_014529
742 Ga0500661_003901

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

172

241

0.95

PF07883

Cupin_2

Cupin domain

58

121

0.88

PF05899

Cupin_3

EutQ-like cupin domain

48

125

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
1sfn-assembly1.cif.gz_A crystal structure of protein dr1152 from deinococcus radiodurans r1, pfam duf861 0.9604 1 243
1sfn-assembly1.cif.gz_A crystal structure of protein dr1152 from deinococcus radiodurans r1, pfam duf861 0.9528 1 243
4e2q-assembly1.cif.gz_G crystal structure of (s)-ureidoglycine aminohydrolase from arabidopsis thaliana 0.9307 3 243
1sef-assembly1.cif.gz_A crystal structure of cupin domain protein ef2996 from enterococcus faecalis 0.9306 3 244
3fjs-assembly2.cif.gz_D crystal structure of a putative biosynthetic protein with rmlc-like cupin fold (reut_b4087) from ralstonia eutropha jmp134 at 1.90 a resolution 0.9196 151 235
ID Description Score Start End Superfamily
1sfnA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9604 1 243 2.60.120.10
1sfnA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9528 1 243 2.60.120.10
1sefA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9449 140 244 2.60.120.10
4e2qH00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9346 3 243 2.60.120.10
3fjsA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9261 153 236 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A2V8J3I4-F1-model_v4 (S)-ureidoglycine aminohydrolase 0.9799 86 241 GO:0071522
AF-A0A7Y5VID9-F1-model_v4 (S)-ureidoglycine aminohydrolase (EC 3.5.3.26) 0.9771 34 244 GO:0071522
AF-A0A2V9U359-F1-model_v4 (S)-ureidoglycine aminohydrolase 0.9745 2 243 GO:0071522
AF-A0A2V9F545-F1-model_v4 (S)-ureidoglycine aminohydrolase 0.9745 137 243 GO:0071522
AF-A0A2A6RPU2-F1-model_v4 (S)-ureidoglycine aminohydrolase 0.9734 4 242 GO:0071522

Map