F425641

General Info

Members Datasets Scaffolds Average Seq Length
371 210 365 128

Family's Representative Sequence

Representative Sequence 3300005339|Ga0070660_100215320|Ga0070660_1002153202
Length 139
Sequence LVSVKVIIMVKLRLSNEKPSEAQCKATLTSIADALYVIGGKWKLRIIVAMREGNKRFNELQRTIEGISAKVLSTELKDLELNGFITRKVYTGTPVVVEYELTDYCETLNDVLSALSAWGAMHRETVKKSMRKKKTVGSM

Samples

Sample ID Description Type Environment
1 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
2 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
3 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
4 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
5 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
14 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
15 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
16 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
17 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
18 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
19 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
21 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
30 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
98 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
99 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
100 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
103 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
105 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
153 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
154 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
155 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
156 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
157 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
158 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
159 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
160 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
161 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
162 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
163 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
164 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
165 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
166 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
167 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
168 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
169 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
170 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
171 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
172 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
173 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
174 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
175 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
176 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
177 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
178 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
179 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
180 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
181 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
182 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
183 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
184 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
185 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
186 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
187 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
188 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
189 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
190 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
191 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
193 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
194 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
195 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
196 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
197 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
198 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
199 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
200 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
201 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
202 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
203 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
204 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
205 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
206 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
207 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
208 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
209 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
210 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.38
Metatranscriptomes 0
Isolates 1.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.67
Nodule 0
Rhizoplane 0.54
Rhizosphere 79.25
Stem 0
Stem Tuber 0
Unclassified 7.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10050655 3300002459 Bacteria 857
2 JGI25154J39366_1000022 3300002738 Bacteria 219590
3 JGI25157J39369_1006061 3300002741 Bacteria 1887
4 JGI25153J46596_10007355 3300003215 Bacteria 5431
5 rootH1_10076839 3300003316 Bacteria 5360
6 rootH1_10113196 3300003316 Bacteria 7101
7 rootH1_10194954 3300003316 Unclassified 1182
8 rootL2_10065766 3300003322 Bacteria 27487
9 rootL2_10111253 3300003322 Bacteria 4825
10 rootL2_10202584 3300003322 Bacteria 1926
11 rootH1_10008391 3300003323 Bacteria 85184
12 rootH1_10032731 3300003323 Bacteria 20174
13 rootH1_10033979 3300003323 Bacteria 7493
14 rootH1_10043493 3300003323 Bacteria 5111
15 rootH1_10091844 3300003323 Bacteria 4697
16 rootH1_10111030 3300003323 Unclassified 1777
17 rootH1_10112089 3300003323 Bacteria 3260
18 rootH1_10252503 3300003323 Bacteria 1963
19 JGI25160J50197_1000718 3300003354 Bacteria 18170
20 JGI25160J50197_1013011 3300003354 Bacteria 2856
21 Ga0055526_1031193 3300003771 Bacteria 1535
22 Ga0055526_1065893 3300003771 Bacteria 752
23 Ga0055528_1000228 3300003790 Bacteria 46963
24 Ga0055530_10000979 3300003791 Bacteria 23018
25 Ga0055543_1045292 3300004625 Bacteria 732
26 Ga0065165_1000017 3300005262 Bacteria 278286
27 Ga0065165_1021991 3300005262 Unclassified 2200
28 Ga0065714_10074727 3300005288 Bacteria 2997
29 Ga0065714_10145892 3300005288 Bacteria 1138
30 Ga0065714_10424650 3300005288 Unclassified 572
31 Ga0065704_10248534 3300005289 Unclassified 996
32 Ga0065712_10136961 3300005290 Bacteria 1488
33 Ga0070658_10172441 3300005327 Bacteria 1817
34 Ga0070676_10127806 3300005328 Bacteria 1603
35 Ga0070683_100107434 3300005329 Bacteria 2631
36 Ga0070670_100088189 3300005331 Unclassified 2667
37 Ga0070670_100095190 3300005331 Bacteria 2561
38 Ga0070670_100101365 3300005331 Bacteria 2479
39 Ga0070670_101262379 3300005331 Bacteria 676
40 Ga0070677_10049307 3300005333 Bacteria 1695
41 Ga0068869_100153865 3300005334 Bacteria 1786
42 Ga0068869_100452409 3300005334 Bacteria 1064
43 Ga0070666_10042042 3300005335 Bacteria 3056
44 Ga0070680_100018288 3300005336 Bacteria 5534
45 Ga0070680_100086013 3300005336 Bacteria 2598
46 Ga0070680_100283663 3300005336 Bacteria 1403
47 Ga0070680_101081559 3300005336 Bacteria 693
48 Ga0070682_100102402 3300005337 Unclassified 1892
49 Ga0068868_100004897 3300005338 Bacteria 9402
50 Ga0068868_100033295 3300005338 Bacteria 3971
51 Ga0070660_100148096 3300005339 Bacteria 1886
52 Ga0070660_100215320 3300005339 Bacteria 1560
53 Ga0070691_10026339 3300005341 Unclassified 2710
54 Ga0070661_100404071 3300005344 Bacteria 1080
55 Ga0070661_100723661 3300005344 Bacteria 812
56 Ga0070692_10364817 3300005345 Bacteria 901
57 Ga0070668_100024499 3300005347 Bacteria 4573
58 Ga0070668_100052350 3300005347 Bacteria 3146
59 Ga0070669_100119545 3300005353 Bacteria 2008
60 Ga0070675_100274672 3300005354 Viruses 1480
61 Ga0070671_100075217 3300005355 Bacteria 2821
62 Ga0070671_100530039 3300005355 Bacteria 1015
63 Ga0070671_100606832 3300005355 Bacteria 946
64 Ga0070674_100239612 3300005356 Bacteria 1419
65 Ga0070674_100377046 3300005356 Bacteria 1153
66 Ga0070673_100140899 3300005364 Bacteria 2034
67 Ga0070673_100253094 3300005364 Bacteria 1536
68 Ga0070673_100299807 3300005364 Bacteria 1414
69 Ga0070673_100514997 3300005364 Bacteria 1083
70 Ga0070659_100090327 3300005366 Bacteria 2455
71 Ga0070659_100795339 3300005366 Unclassified 822
72 Ga0070667_100153395 3300005367 Bacteria 2025
73 Ga0070678_100017941 3300005456 Bacteria 4573
74 Ga0070662_100063329 3300005457 Unclassified 2705
75 Ga0070681_10059653 3300005458 Bacteria 3795
76 Ga0070681_10137986 3300005458 Bacteria 2368
77 Ga0068867_100465274 3300005459 Bacteria 1080
78 Ga0070685_10063991 3300005466 Bacteria 2161
79 Ga0070685_10154133 3300005466 Bacteria 1459
80 Ga0070679_100027289 3300005530 Bacteria 5618
81 Ga0070684_100019154 3300005535 Bacteria 5658
82 Ga0070684_100596088 3300005535 Bacteria 1027
83 Ga0068853_100017960 3300005539 Bacteria 5846
84 Ga0068853_100413122 3300005539 Unclassified 1265
85 Ga0068853_100843871 3300005539 Bacteria 878
86 Ga0068853_101060726 3300005539 Bacteria 781
87 Ga0068853_101102179 3300005539 Bacteria 765
88 Ga0070672_100111405 3300005543 Bacteria 2231
89 Ga0070672_100741642 3300005543 Bacteria 861
90 Ga0070693_100899315 3300005547 Bacteria 663
91 Ga0070665_100037604 3300005548 Bacteria 4866
92 Ga0070665_100057414 3300005548 Unclassified 3901
93 Ga0070665_101418912 3300005548 Bacteria 703
94 Ga0068855_100048587 3300005563 Bacteria 5007
95 Ga0068855_100339458 3300005563 Bacteria 1657
96 Ga0070664_100008601 3300005564 Bacteria 8259
97 Ga0070664_100781534 3300005564 Bacteria 892
98 Ga0070664_102104696 3300005564 Bacteria 535
99 Ga0068857_100180460 3300005577 Bacteria 1921
100 Ga0068854_100082622 3300005578 Unclassified 2375
101 Ga0068854_100522305 3300005578 Bacteria 1003
102 Ga0068854_101305933 3300005578 Unclassified 653
103 Ga0070702_100154583 3300005615 Bacteria 1476
104 Ga0068852_100128006 3300005616 Bacteria 2334
105 Ga0068864_101303256 3300005618 Bacteria 727
106 Ga0068866_10020896 3300005718 Unclassified 3007
107 Ga0068866_10310312 3300005718 Bacteria 988
108 Ga0068861_100021758 3300005719 Bacteria 4612
109 Ga0068861_100101391 3300005719 Unclassified 2290
110 Ga0068851_10101026 3300005834 Bacteria 1531
111 Ga0068851_10244571 3300005834 Unclassified 1016
112 Ga0068870_10015515 3300005840 Unclassified 3616
113 Ga0068870_10443220 3300005840 Bacteria 854
114 Ga0068863_101493105 3300005841 Bacteria 684
115 Ga0068858_101525191 3300005842 Bacteria 659
116 Ga0068860_100141854 3300005843 Bacteria 2310
117 Ga0068860_100539175 3300005843 Bacteria 1168
118 Ga0068862_100070701 3300005844 Bacteria 3013
119 Ga0068862_100088050 3300005844 Bacteria 2701
120 Ga0075366_10151041 3300006195 Bacteria 1406
121 Ga0075366_10363456 3300006195 Bacteria 889
122 Ga0097621_100059319 3300006237 Bacteria 3132
123 Ga0097621_100129569 3300006237 Bacteria 2146
124 Ga0097621_100175417 3300006237 Bacteria 1850
125 Ga0068871_100072167 3300006358 Bacteria 2842
126 Ga0068871_100612597 3300006358 Bacteria 991
127 Ga0068865_100167471 3300006881 Bacteria 1681
128 Ga0105240_10013266 3300009093 Bacteria 11333
129 Ga0105240_10451905 3300009093 Bacteria 1438
130 Ga0105245_10189455 3300009098 Unclassified 1969
131 Ga0105241_10186275 3300009174 Bacteria 1725
132 Ga0105241_10327429 3300009174 Bacteria 1323
133 Ga0105242_10191313 3300009176 Bacteria 1812
134 Ga0105237_10000354 3300009545 Bacteria 64712
135 Ga0105237_10075024 3300009545 Unclassified 3374
136 Ga0105237_10376589 3300009545 Bacteria 1424
137 Ga0105249_10270762 3300009553 Bacteria 1692
138 Ga0105249_10292709 3300009553 Bacteria 1630
139 Ga0105239_10031799 3300010375 Bacteria 5799
140 Ga0105239_10055131 3300010375 Bacteria 4360
141 Ga0105239_10305269 3300010375 Bacteria 1793
142 Ga0105246_10029947 3300011119 Unclassified 3590
143 Ga0157373_10002593 3300013100 Bacteria 13729
144 Ga0157373_10011161 3300013100 Bacteria 6611
145 Ga0157373_10137228 3300013100 Bacteria 1720
146 Ga0157373_10153717 3300013100 Bacteria 1619
147 Ga0157373_11451989 3300013100 Bacteria 523
148 Ga0157371_10033419 3300013102 Bacteria 3696
149 Ga0157371_10050834 3300013102 Bacteria 2946
150 Ga0157371_10087450 3300013102 Bacteria 2207
151 Ga0157371_10152478 3300013102 Bacteria 1648
152 Ga0157371_10257253 3300013102 Bacteria 1258
153 Ga0157371_10419100 3300013102 Bacteria 981
154 Ga0157370_10038836 3300013104 Unclassified 4605
155 Ga0157370_10082046 3300013104 Bacteria 3033
156 Ga0157370_10083553 3300013104 Unclassified 3002
157 Ga0157370_10416047 3300013104 Bacteria 1237
158 Ga0157370_10811927 3300013104 Bacteria 851
159 Ga0157370_11069242 3300013104 Bacteria 729
160 Ga0157369_10331048 3300013105 Unclassified 1582
161 Ga0157374_10172097 3300013296 Bacteria 2113
162 Ga0157374_10230009 3300013296 Bacteria 1821
163 Ga0157374_11302354 3300013296 Bacteria 749
164 Ga0157378_10029674 3300013297 Bacteria 4830
165 Ga0157378_10031687 3300013297 Bacteria 4670
166 Ga0163162_10000010 3300013306 Bacteria 302032
167 Ga0163162_10225673 3300013306 Viruses 2003
168 Ga0163162_10723827 3300013306 Bacteria 1116
169 Ga0157372_10037905 3300013307 Bacteria 5319
170 Ga0157372_10104074 3300013307 Unclassified 3244
171 Ga0157372_10213967 3300013307 Bacteria 2233
172 Ga0157372_10247968 3300013307 Bacteria 2067
173 Ga0157372_10285929 3300013307 Bacteria 1918
174 Ga0157372_10304665 3300013307 Bacteria 1853
175 Ga0157372_10356815 3300013307 Bacteria 1703
176 Ga0157372_10397592 3300013307 Bacteria 1606
177 Ga0157372_11060732 3300013307 Bacteria 938
178 Ga0157375_10026152 3300013308 Bacteria 5435
179 Ga0157375_10115510 3300013308 Bacteria 2787
180 Ga0157375_10187257 3300013308 Bacteria 2224
181 Ga0157375_10867004 3300013308 Bacteria 1049
182 Ga0163163_10011851 3300014325 Bacteria 7926
183 Ga0163163_10140886 3300014325 Bacteria 2454
184 Ga0163163_10526915 3300014325 Bacteria 1244
185 Ga0157380_10043505 3300014326 Unclassified 3517
186 Ga0157377_10082157 3300014745 Bacteria 1886
187 Ga0157377_10090240 3300014745 Bacteria 1808
188 Ga0157379_10060153 3300014968 Bacteria 3396
189 Ga0157376_10118522 3300014969 Bacteria 2342
190 Ga0157376_10237716 3300014969 Bacteria 1696
191 Ga0157376_10344402 3300014969 Bacteria 1424
192 Ga0163161_10004765 3300017792 Bacteria 9439
193 Ga0207425_1048178 3300025245 Bacteria 787
194 Ga0209646_1000003 3300025246 Bacteria 1160860
195 Ga0209026_1001904 3300025250 Bacteria 8468
196 Ga0209673_1000083 3300025273 Bacteria 216509
197 Ga0209564_1007920 3300025295 Bacteria 5359
198 Ga0209564_1037555 3300025295 Bacteria 1362
199 Ga0209758_1002463 3300025297 Bacteria 18854
200 Ga0209758_1009004 3300025297 Bacteria 6310
201 Ga0209758_1036522 3300025297 Bacteria 1916
202 Ga0209050_1001110 3300025298 Bacteria 32580
203 Ga0209050_1001341 3300025298 Bacteria 27300
204 Ga0209050_1002630 3300025298 Bacteria 14755
205 Ga0209050_1012510 3300025298 Bacteria 3882
206 Ga0207426_1000414 3300025302 Bacteria 70302
207 Ga0207426_1000550 3300025302 Bacteria 52064
208 Ga0207426_1030876 3300025302 Bacteria 1753
209 Ga0209051_1018901 3300025303 Unclassified 3030
210 Ga0209257_1008836 3300025304 Bacteria 5569
211 Ga0207682_10060724 3300025893 Bacteria 1581
212 Ga0207642_10044392 3300025899 Bacteria 1967
213 Ga0207688_10006190 3300025901 Bacteria 6511
214 Ga0207680_10005880 3300025903 Bacteria 5891
215 Ga0207647_10132997 3300025904 Bacteria 1461
216 Ga0207647_10266842 3300025904 Unclassified 979
217 Ga0207647_10648899 3300025904 Bacteria 579
218 Ga0207645_10000279 3300025907 Bacteria 42459
219 Ga0207643_10093018 3300025908 Bacteria 1760
220 Ga0207643_10595700 3300025908 Bacteria 711
221 Ga0207707_10213101 3300025912 Unclassified 1682
222 Ga0207695_10006810 3300025913 Bacteria 14730
223 Ga0207695_10063112 3300025913 Bacteria 3820
224 Ga0207695_10570239 3300025913 Bacteria 1013
225 Ga0207671_10002358 3300025914 Bacteria 20316
226 Ga0207671_10115594 3300025914 Unclassified 2045
227 Ga0207671_10354140 3300025914 Bacteria 1164
228 Ga0207660_10011653 3300025917 Bacteria 5733
229 Ga0207660_11132813 3300025917 Bacteria 637
230 Ga0207657_10026991 3300025919 Bacteria 5265
231 Ga0207657_10344762 3300025919 Bacteria 1175
232 Ga0207649_10140114 3300025920 Bacteria 1654
233 Ga0207649_10403065 3300025920 Bacteria 1024
234 Ga0207652_10272175 3300025921 Unclassified 1528
235 Ga0207652_10837866 3300025921 Bacteria 815
236 Ga0207652_11284083 3300025921 Bacteria 634
237 Ga0207681_10333068 3300025923 Bacteria 1210
238 Ga0207650_10001513 3300025925 Bacteria 16609
239 Ga0207650_10090541 3300025925 Unclassified 2336
240 Ga0207650_10374450 3300025925 Bacteria 1175
241 Ga0207650_10455567 3300025925 Bacteria 1065
242 Ga0207659_10236995 3300025926 Bacteria 1474
243 Ga0207659_10369076 3300025926 Bacteria 1194
244 Ga0207687_11421996 3300025927 Unclassified 596
245 Ga0207644_10056243 3300025931 Bacteria 2838
246 Ga0207644_10074908 3300025931 Bacteria 2486
247 Ga0207644_10459876 3300025931 Unclassified 1046
248 Ga0207690_10206475 3300025932 Bacteria 1495
249 Ga0207686_10227174 3300025934 Bacteria 1351
250 Ga0207704_10527167 3300025938 Bacteria 956
251 Ga0207691_10031327 3300025940 Bacteria 4964
252 Ga0207691_10092214 3300025940 Unclassified 2712
253 Ga0207691_10587904 3300025940 Bacteria 943
254 Ga0207689_10000865 3300025942 Bacteria 29222
255 Ga0207689_10010013 3300025942 Bacteria 8172
256 Ga0207661_10265845 3300025944 Bacteria 1529
257 Ga0207661_10372846 3300025944 Bacteria 1291
258 Ga0207679_10053586 3300025945 Bacteria 2965
259 Ga0207679_10133852 3300025945 Bacteria 1993
260 Ga0207667_10008466 3300025949 Bacteria 12215
261 Ga0207667_11412489 3300025949 Bacteria 669
262 Ga0207651_10010799 3300025960 Bacteria 5079
263 Ga0207651_10367309 3300025960 Bacteria 1216
264 Ga0207712_10183388 3300025961 Bacteria 1646
265 Ga0207668_10075000 3300025972 Unclassified 2430
266 Ga0207640_10700796 3300025981 Bacteria 868
267 Ga0207658_10234663 3300025986 Bacteria 1550
268 Ga0207677_10003787 3300026023 Bacteria 8036
269 Ga0207703_10358951 3300026035 Bacteria 1343
270 Ga0207639_10011234 3300026041 Bacteria 6211
271 Ga0207639_11030867 3300026041 Unclassified 771
272 Ga0207639_11160229 3300026041 Bacteria 725
273 Ga0207702_10732046 3300026078 Bacteria 976
274 Ga0207702_12247054 3300026078 Unclassified 534
275 Ga0207648_10000282 3300026089 Bacteria 55304
276 Ga0207648_10519767 3300026089 Bacteria 1091
277 Ga0207676_10953561 3300026095 Bacteria 844
278 Ga0207676_11928150 3300026095 Bacteria 589
279 Ga0207674_10063500 3300026116 Bacteria 3728
280 Ga0207674_11784663 3300026116 Unclassified 582
281 Ga0207675_100015947 3300026118 Bacteria 7010
282 Ga0207675_100345388 3300026118 Bacteria 1457
283 Ga0207683_10000916 3300026121 Bacteria 27132
284 Ga0207698_10250802 3300026142 Bacteria 1619
285 Ga0207698_11026513 3300026142 Bacteria 836
286 Ga0268266_10027323 3300028379 Bacteria 4852
287 Ga0268266_10097219 3300028379 Unclassified 2589
288 Ga0268266_12010036 3300028379 Unclassified 551
289 Ga0268265_10120381 3300028380 Bacteria 2162
290 Ga0268264_10677989 3300028381 Bacteria 1022
291 Ga0307517_10011656 3300028786 Bacteria 12163
292 Ga0307515_10000430 3300028794 Bacteria 101168
293 Ga0307515_10025001 3300028794 Bacteria 10361
294 Ga0307515_10828795 3300028794 Bacteria 550
295 Ga0307515_10886513 3300028794 Bacteria 522
296 Ga0316181_1214738 3300030744 Unclassified 651
297 Ga0307513_10132692 3300031456 Bacteria 2433
298 Ga0307412_10000029 3300031911 Bacteria 209074
299 Ga0307414_10845507 3300032004 Bacteria 837
300 Ga0307414_11576441 3300032004 Unclassified 612
301 Ga0307411_10502917 3300032005 Bacteria 1025
302 Ga0395899_0001230 3300037312 Bacteria 22392
303 Ga0395900_0000721 3300037418 Bacteria 43960
304 Ga0395900_0128257 3300037418 Bacteria 2601
305 Ga0395898_0009892 3300037466 Bacteria 9999
306 Ga0395898_0625788 3300037466 Bacteria 1019
307 Ga0395905_0009374 3300037471 Bacteria 9573
308 Ga0395905_0018278 3300037471 Bacteria 6655
309 Ga0395905_0321846 3300037471 Bacteria 1436
310 Ga0395905_0682963 3300037471 Bacteria 929
311 Ga0395901_0007433 3300038443 Bacteria 11056
312 Ga0395901_0741385 3300038443 Unclassified 976
313 Ga0451791_1811324 3300041451 Bacteria 626
314 Ga0451804_0447467 3300041463 Unclassified 767
315 Ga0439449_0270790 3300042007 Bacteria 639
316 Ga0439457_006387 3300042014 Unclassified 2892
317 Ga0439462_0093078 3300042015 Bacteria 828
318 Ga0466972_0000004 3300044658 Bacteria 314413
319 Ga0466982_0019639 3300044672 Unclassified 3820
320 Ga0453684_0076251 3300044712 Unclassified 4210
321 Ga0466970_0027179 3300044765 Bacteria 3001
322 Ga0466957_0108816 3300044842 Bacteria 1756
323 Ga0466960_0157277 3300044901 Bacteria 1218
324 Ga0466967_0353029 3300045976 Unclassified 1424
325 Ga0495590_0000705 3300046457 Bacteria 15269
326 Ga0495638_0000001 3300046460 Bacteria 1114121
327 Ga0495638_0000020 3300046460 Bacteria 372434
328 Ga0495651_0135317 3300046462 Bacteria 1794
329 Ga0495607_0506219 3300046501 Bacteria 535
330 Ga0495583_0063691 3300046506 Bacteria 1638
331 Ga0495606_0045173 3300046507 Bacteria 2922
332 Ga0495606_0352574 3300046507 Bacteria 780
333 Ga0495663_0000021 3300046525 Bacteria 114041
334 Ga0495668_0001235 3300046616 Bacteria 25682
335 Ga0495611_0120765 3300046648 Bacteria 1222
336 Ga0495625_0021833 3300046660 Bacteria 4917
337 Ga0495661_0000305 3300046665 Bacteria 55940
338 Ga0495624_0806693 3300046690 Bacteria 555
339 Ga0495687_003782 3300047443 Bacteria 10686
340 Ga0495686_0002976 3300047472 Bacteria 15095
341 Ga0495686_0004307 3300047472 Bacteria 11773
342 Ga0495682_0075243 3300049460 Bacteria 1215
343 Ga0501043_0158984 3300049579 Bacteria 1766
344 Ga0501198_084683 3300049649 Unclassified 619
345 Ga0501225_0120281 3300049705 Bacteria 780
346 Ga0501284_00025 3300050005 Bacteria 76385
347 nmdc:mga0k408_165773_c1 3300050493 Bacteria 1316
348 nmdc:mga07m45_365823_c1 3300050496 Bacteria 838
349 nmdc:mga07m45_659446_c1 3300050496 Bacteria 603
350 Ga0500635_0001308 3300053080 Bacteria 5956
351 Ga0500651_0000962 3300053093 Bacteria 14158
352 Ga0500651_0314621 3300053093 Bacteria 895
353 Ga0500569_000081 3300053109 Bacteria 15606
354 Ga0500608_000501 3300053122 Bacteria 14634
355 Ga0500628_035265 3300053129 Bacteria 1111
356 Ga0500658_0007060 3300053134 Bacteria 4157
357 Ga0500577_0001041 3300053142 Bacteria 7146
358 Ga0500577_0394182 3300053142 Bacteria 606
359 Ga0500588_0234197 3300053146 Bacteria 687
360 Ga0500604_0016831 3300053151 Bacteria 2017
361 Ga0500616_0000007 3300053153 Bacteria 836875
362 Ga0500616_0006735 3300053153 Bacteria 7455
363 Ga0500622_0003783 3300053156 Bacteria 9868
364 Ga0500611_000001 3300053727 Bacteria 385744
365 Ga0500656_014477 3300053732 Bacteria 914

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042007 Ga0439449_0270790 Ga0439449_0270790_240_608 113
2 3300009093 Ga0105240_10451905 Ga0105240_104519052 115
3 3300003316 rootH1_10076839 rootH1_100768392 117
4 3300005336 Ga0070680_101081559 Ga0070680_1010815591 117
5 3300009545 Ga0105237_10075024 Ga0105237_100750243 117
6 3300010375 Ga0105239_10031799 Ga0105239_100317994 117
7 3300025914 Ga0207671_10115594 Ga0207671_101155943 117
8 3300028794 Ga0307515_10000430 Ga0307515_1000043022 117
9 3300037471 Ga0395905_0682963 Ga0395905_0682963_274_627 117
10 3300046462 Ga0495651_0135317 Ga0495651_0135317_393_746 117
11 3300046506 Ga0495583_0063691 Ga0495583_0063691_247_600 117
12 3300047472 Ga0495686_0002976 Ga0495686_0002976_13930_14283 117
13 3300003323 rootH1_10033979 rootH1_100339793 118
14 3300005288 Ga0065714_10074727 Ga0065714_100747274 118
15 3300005288 Ga0065714_10424650 Ga0065714_104246501 118
16 3300009174 Ga0105241_10327429 Ga0105241_103274293 118
17 3300009545 Ga0105237_10000354 Ga0105237_1000035442 118
18 3300013100 Ga0157373_10002593 Ga0157373_1000259313 118
19 3300025913 Ga0207695_10570239 Ga0207695_105702392 118
20 3300025914 Ga0207671_10002358 Ga0207671_1000235815 118
21 3300031911 Ga0307412_10000029 Ga0307412_1000002973 118
22 3300046665 Ga0495661_0000305 Ga0495661_0000305_42771_43127 118
23 3300047472 Ga0495686_0004307 Ga0495686_0004307_11399_11755 118
24 3300053093 Ga0500651_0000962 Ga0500651_0000962_6161_6517 118
25 3300053156 Ga0500622_0003783 Ga0500622_0003783_1448_1804 118
26 iso_pu_bacteria 2958512119 2958515658 118
27 3300028794 Ga0307515_10828795 Ga0307515_108287951 119
28 iso_pu_bacteria 2728369107 2729200653 119
29 3300003316 rootH1_10194954 rootH1_101949542 120
30 3300005458 Ga0070681_10059653 Ga0070681_100596534 120
31 3300006195 Ga0075366_10363456 Ga0075366_103634561 120
32 3300013104 Ga0157370_10038836 Ga0157370_100388365 120
33 3300046501 Ga0495607_0506219 Ga0495607_0506219_95_457 120
34 3300050496 nmdc:mga07m45_365823_c1 nmdc:mga07m45_365823_c1_39_401 120
35 3300003323 rootH1_10252503 rootH1_102525033 121
36 3300005366 Ga0070659_100795339 Ga0070659_1007953392 121
37 3300005539 Ga0068853_100017960 Ga0068853_1000179609 121
38 3300005539 Ga0068853_100843871 Ga0068853_1008438712 121
39 3300005548 Ga0070665_100037604 Ga0070665_1000376042 121
40 3300005563 Ga0068855_100048587 Ga0068855_1000485876 121
41 3300005840 Ga0068870_10443220 Ga0068870_104432202 121
42 3300009093 Ga0105240_10013266 Ga0105240_1001326612 121
43 3300009098 Ga0105245_10189455 Ga0105245_101894553 121
44 3300010375 Ga0105239_10055131 Ga0105239_100551313 121
45 3300013105 Ga0157369_10331048 Ga0157369_103310481 121
46 3300013306 Ga0163162_10000010 Ga0163162_10000010131 121
47 3300013307 Ga0157372_10285929 Ga0157372_102859291 121
48 3300013308 Ga0157375_10026152 Ga0157375_100261528 121
49 3300014325 Ga0163163_10526915 Ga0163163_105269152 121
50 3300025904 Ga0207647_10266842 Ga0207647_102668423 121
51 3300025908 Ga0207643_10595700 Ga0207643_105957001 121
52 3300025913 Ga0207695_10006810 Ga0207695_1000681012 121
53 3300025927 Ga0207687_11421996 Ga0207687_114219961 121
54 3300025949 Ga0207667_10008466 Ga0207667_100084663 121
55 3300026041 Ga0207639_10011234 Ga0207639_100112342 121
56 3300026041 Ga0207639_11160229 Ga0207639_111602292 121
57 3300028379 Ga0268266_10027323 Ga0268266_100273238 121
58 3300028786 Ga0307517_10011656 Ga0307517_100116562 121
59 3300030744 Ga0316181_1214738 Ga0316181_12147381 121
60 3300032004 Ga0307414_10845507 Ga0307414_108455071 121
61 3300032005 Ga0307411_10502917 Ga0307411_105029172 121
62 3300037312 Ga0395899_0001230 Ga0395899_0001230_4403_4771 121
63 3300037418 Ga0395900_0000721 Ga0395900_0000721_16749_17117 121
64 3300037466 Ga0395898_0009892 Ga0395898_0009892_9563_9931 121
65 3300037471 Ga0395905_0018278 Ga0395905_0018278_5985_6353 121
66 3300038443 Ga0395901_0007433 Ga0395901_0007433_10258_10626 121
67 3300046507 Ga0495606_0045173 Ga0495606_0045173_287_652 121
68 3300046690 Ga0495624_0806693 Ga0495624_0806693_16_393 121
69 3300047443 Ga0495687_003782 Ga0495687_003782_3054_3422 121
70 3300049460 Ga0495682_0075243 Ga0495682_0075243_682_1050 121
71 3300049649 Ga0501198_084683 Ga0501198_084683_211_576 121
72 3300053122 Ga0500608_000501 Ga0500608_000501_4249_4617 121
73 3300003323 rootH1_10043493 rootH1_100434938 122
74 3300003323 rootH1_10112089 rootH1_101120893 122
75 3300005289 Ga0065704_10248534 Ga0065704_102485342 122
76 3300005336 Ga0070680_100283663 Ga0070680_1002836632 122
77 3300013100 Ga0157373_10011161 Ga0157373_100111613 122
78 3300013104 Ga0157370_10083553 Ga0157370_100835533 122
79 3300017792 Ga0163161_10004765 Ga0163161_100047656 122
80 3300025917 Ga0207660_11132813 Ga0207660_111328131 122
81 3300026078 Ga0207702_12247054 Ga0207702_122470541 122
82 3300046507 Ga0495606_0352574 Ga0495606_0352574_161_529 122
83 iso_pu_bacteria 2884933994 2884935095 122
84 iso_pu_bacteria 2929921140 2929926869 122
85 iso_pu_bacteria 8003151029 8003153987 122
86 3300005327 Ga0070658_10172441 Ga0070658_101724412 123
87 3300005336 Ga0070680_100086013 Ga0070680_1000860131 123
88 3300005339 Ga0070660_100148096 Ga0070660_1001480963 123
89 3300005366 Ga0070659_100090327 Ga0070659_1000903273 123
90 3300005539 Ga0068853_101102179 Ga0068853_1011021791 123
91 3300014969 Ga0157376_10118522 Ga0157376_101185221 123
92 3300025919 Ga0207657_10026991 Ga0207657_100269911 123
93 3300025932 Ga0207690_10206475 Ga0207690_102064751 123
94 3300028794 Ga0307515_10025001 Ga0307515_1002500111 123
95 3300028794 Ga0307515_10886513 Ga0307515_108865131 123
96 3300044658 Ga0466972_0000004 Ga0466972_0000004_219632_220006 123
97 3300044765 Ga0466970_0027179 Ga0466970_0027179_1200_1574 123
98 3300046525 Ga0495663_0000021 Ga0495663_0000021_20924_21301 123
99 3300046648 Ga0495611_0120765 Ga0495611_0120765_116_493 123
100 3300046660 Ga0495625_0021833 Ga0495625_0021833_2912_3289 123
101 3300053080 Ga0500635_0001308 Ga0500635_0001308_5418_5789 123
102 3300002738 JGI25154J39366_1000022 JGI25154J39366_10000229 124
103 3300002741 JGI25157J39369_1006061 JGI25157J39369_10060612 124
104 3300003215 JGI25153J46596_10007355 JGI25153J46596_100073553 124
105 3300003323 rootH1_10111030 rootH1_101110303 124
106 3300003354 JGI25160J50197_1013011 JGI25160J50197_10130112 124
107 3300005262 Ga0065165_1021991 Ga0065165_10219912 124
108 3300005355 Ga0070671_100075217 Ga0070671_1000752172 124
109 3300010375 Ga0105239_10305269 Ga0105239_103052693 124
110 3300013104 Ga0157370_11069242 Ga0157370_110692421 124
111 3300013307 Ga0157372_11060732 Ga0157372_110607321 124
112 3300025245 Ga0207425_1048178 Ga0207425_10481781 124
113 3300025246 Ga0209646_1000003 Ga0209646_1000003504 124
114 3300025250 Ga0209026_1001904 Ga0209026_10019043 124
115 3300025297 Ga0209758_1036522 Ga0209758_10365222 124
116 3300025302 Ga0207426_1000414 Ga0207426_100041453 124
117 3300025931 Ga0207644_10056243 Ga0207644_100562435 124
118 3300050496 nmdc:mga07m45_659446_c1 nmdc:mga07m45_659446_c1_53_433 124
119 3300053727 Ga0500611_000001 Ga0500611_000001_52980_53354 124
120 3300005288 Ga0065714_10145892 Ga0065714_101458922 125
121 3300042015 Ga0439462_0093078 Ga0439462_0093078_22_414 125
122 3300044842 Ga0466957_0108816 Ga0466957_0108816_328_705 125
123 3300046457 Ga0495590_0000705 Ga0495590_0000705_10169_10555 125
124 3300053093 Ga0500651_0314621 Ga0500651_0314621_151_543 125
125 3300053109 Ga0500569_000081 Ga0500569_000081_2220_2612 125
126 3300053134 Ga0500658_0007060 Ga0500658_0007060_1299_1691 125
127 3300053142 Ga0500577_0001041 Ga0500577_0001041_1397_1789 125
128 3300053153 Ga0500616_0006735 Ga0500616_0006735_1568_1960 125
129 3300053732 Ga0500656_014477 Ga0500656_014477_218_610 125
130 3300003322 rootL2_10065766 rootL2_1006576613 126
131 3300003323 rootH1_10032731 rootH1_100327317 126
132 3300044901 Ga0466960_0157277 Ga0466960_0157277_685_1083 126
133 3300005548 Ga0070665_101418912 Ga0070665_1014189122 127
134 3300028379 Ga0268266_12010036 Ga0268266_120100361 127
135 3300003354 JGI25160J50197_1000718 JGI25160J50197_10007186 128
136 3300003771 Ga0055526_1031193 Ga0055526_10311933 128
137 3300003771 Ga0055526_1065893 Ga0055526_10658931 128
138 3300003790 Ga0055528_1000228 Ga0055528_100022815 128
139 3300003791 Ga0055530_10000979 Ga0055530_1000097917 128
140 3300004625 Ga0055543_1045292 Ga0055543_10452921 128
141 3300005262 Ga0065165_1000017 Ga0065165_1000017148 128
142 3300005331 Ga0070670_101262379 Ga0070670_1012623791 128
143 3300005354 Ga0070675_100274672 Ga0070675_1002746722 128
144 3300005543 Ga0070672_100111405 Ga0070672_1001114054 128
145 3300006195 Ga0075366_10151041 Ga0075366_101510412 128
146 3300006237 Ga0097621_100175417 Ga0097621_1001754172 128
147 3300006358 Ga0068871_100612597 Ga0068871_1006125971 128
148 3300013100 Ga0157373_10153717 Ga0157373_101537172 128
149 3300013306 Ga0163162_10225673 Ga0163162_102256732 128
150 3300014325 Ga0163163_10140886 Ga0163163_101408863 128
151 3300014326 Ga0157380_10043505 Ga0157380_100435052 128
152 3300025273 Ga0209673_1000083 Ga0209673_100008379 128
153 3300025295 Ga0209564_1007920 Ga0209564_10079204 128
154 3300025295 Ga0209564_1037555 Ga0209564_10375552 128
155 3300025297 Ga0209758_1002463 Ga0209758_10024633 128
156 3300025297 Ga0209758_1009004 Ga0209758_10090046 128
157 3300025298 Ga0209050_1001341 Ga0209050_100134117 128
158 3300025302 Ga0207426_1000550 Ga0207426_100055039 128
159 3300025302 Ga0207426_1030876 Ga0207426_10308761 128
160 3300025303 Ga0209051_1018901 Ga0209051_10189013 128
161 3300025304 Ga0209257_1008836 Ga0209257_10088363 128
162 3300025926 Ga0207659_10236995 Ga0207659_102369951 128
163 3300025940 Ga0207691_10031327 Ga0207691_100313275 128
164 3300041463 Ga0451804_0447467 Ga0451804_0447467_63_452 128
165 3300050493 nmdc:mga0k408_165773_c1 nmdc:mga0k408_165773_c1_377_772 128
166 3300053129 Ga0500628_035265 Ga0500628_035265_611_1006 128
167 3300053151 Ga0500604_0016831 Ga0500604_0016831_274_660 128
168 3300003322 rootL2_10111253 rootL2_101112532 129
169 3300003322 rootL2_10202584 rootL2_102025843 129
170 3300003323 rootH1_10008391 rootH1_100083918 129
171 3300003323 rootH1_10091844 rootH1_100918449 129
172 3300005329 Ga0070683_100107434 Ga0070683_1001074344 129
173 3300005331 Ga0070670_100101365 Ga0070670_1001013654 129
174 3300005336 Ga0070680_100018288 Ga0070680_1000182883 129
175 3300005337 Ga0070682_100102402 Ga0070682_1001024022 129
176 3300005341 Ga0070691_10026339 Ga0070691_100263394 129
177 3300005344 Ga0070661_100723661 Ga0070661_1007236612 129
178 3300005364 Ga0070673_100253094 Ga0070673_1002530943 129
179 3300005458 Ga0070681_10137986 Ga0070681_101379864 129
180 3300005530 Ga0070679_100027289 Ga0070679_1000272893 129
181 3300005535 Ga0070684_100019154 Ga0070684_1000191542 129
182 3300005535 Ga0070684_100596088 Ga0070684_1005960881 129
183 3300005539 Ga0068853_100413122 Ga0068853_1004131222 129
184 3300005539 Ga0068853_101060726 Ga0068853_1010607261 129
185 3300005563 Ga0068855_100339458 Ga0068855_1003394582 129
186 3300005564 Ga0070664_100008601 Ga0070664_1000086018 129
187 3300005577 Ga0068857_100180460 Ga0068857_1001804602 129
188 3300006237 Ga0097621_100129569 Ga0097621_1001295692 129
189 3300013100 Ga0157373_10137228 Ga0157373_101372281 129
190 3300013102 Ga0157371_10050834 Ga0157371_100508342 129
191 3300013102 Ga0157371_10152478 Ga0157371_101524783 129
192 3300013102 Ga0157371_10419100 Ga0157371_104191001 129
193 3300013104 Ga0157370_10082046 Ga0157370_100820464 129
194 3300013104 Ga0157370_10416047 Ga0157370_104160472 129
195 3300013104 Ga0157370_10811927 Ga0157370_108119272 129
196 3300013296 Ga0157374_10230009 Ga0157374_102300092 129
197 3300013306 Ga0163162_10723827 Ga0163162_107238272 129
198 3300013307 Ga0157372_10037905 Ga0157372_100379054 129
199 3300013307 Ga0157372_10213967 Ga0157372_102139672 129
200 3300014969 Ga0157376_10344402 Ga0157376_103444022 129
201 3300025298 Ga0209050_1001110 Ga0209050_10011109 129
202 3300025298 Ga0209050_1012510 Ga0209050_10125102 129
203 3300025912 Ga0207707_10213101 Ga0207707_102131012 129
204 3300025913 Ga0207695_10063112 Ga0207695_100631124 129
205 3300025917 Ga0207660_10011653 Ga0207660_100116533 129
206 3300025920 Ga0207649_10140114 Ga0207649_101401141 129
207 3300025921 Ga0207652_10272175 Ga0207652_102721753 129
208 3300025921 Ga0207652_10837866 Ga0207652_108378661 129
209 3300025921 Ga0207652_11284083 Ga0207652_112840832 129
210 3300025926 Ga0207659_10369076 Ga0207659_103690762 129
211 3300025944 Ga0207661_10265845 Ga0207661_102658453 129
212 3300025944 Ga0207661_10372846 Ga0207661_103728462 129
213 3300025945 Ga0207679_10053586 Ga0207679_100535864 129
214 3300025949 Ga0207667_11412489 Ga0207667_114124891 129
215 3300026078 Ga0207702_10732046 Ga0207702_107320462 129
216 3300026116 Ga0207674_10063500 Ga0207674_100635003 129
217 3300031456 Ga0307513_10132692 Ga0307513_101326921 129
218 3300041451 Ga0451791_1811324 Ga0451791_1811324_215_607 129
219 3300044672 Ga0466982_0019639 Ga0466982_0019639_859_1254 129
220 3300045976 Ga0466967_0353029 Ga0466967_0353029_111_503 129
221 3300046460 Ga0495638_0000001 Ga0495638_0000001_949859_950260 129
222 3300046460 Ga0495638_0000020 Ga0495638_0000020_22235_22627 129
223 3300046616 Ga0495668_0001235 Ga0495668_0001235_23094_23495 129
224 3300049705 Ga0501225_0120281 Ga0501225_0120281_296_685 129
225 3300053146 Ga0500588_0234197 Ga0500588_0234197_40_432 129
226 3300053153 Ga0500616_0000007 Ga0500616_0000007_761495_761887 129
227 iso_pu_bacteria 2585428095 2587868383 129
228 3300003316 rootH1_10113196 rootH1_101131963 130
229 3300005290 Ga0065712_10136961 Ga0065712_101369612 130
230 3300005328 Ga0070676_10127806 Ga0070676_101278061 130
231 3300005331 Ga0070670_100088189 Ga0070670_1000881893 130
232 3300005333 Ga0070677_10049307 Ga0070677_100493073 130
233 3300005334 Ga0068869_100153865 Ga0068869_1001538651 130
234 3300005334 Ga0068869_100452409 Ga0068869_1004524092 130
235 3300005335 Ga0070666_10042042 Ga0070666_100420423 130
236 3300005338 Ga0068868_100004897 Ga0068868_1000048975 130
237 3300005338 Ga0068868_100033295 Ga0068868_1000332951 130
238 3300005344 Ga0070661_100404071 Ga0070661_1004040712 130
239 3300005345 Ga0070692_10364817 Ga0070692_103648172 130
240 3300005347 Ga0070668_100024499 Ga0070668_1000244994 130
241 3300005347 Ga0070668_100052350 Ga0070668_1000523503 130
242 3300005353 Ga0070669_100119545 Ga0070669_1001195453 130
243 3300005355 Ga0070671_100530039 Ga0070671_1005300392 130
244 3300005355 Ga0070671_100606832 Ga0070671_1006068322 130
245 3300005356 Ga0070674_100239612 Ga0070674_1002396122 130
246 3300005356 Ga0070674_100377046 Ga0070674_1003770461 130
247 3300005364 Ga0070673_100140899 Ga0070673_1001408993 130
248 3300005364 Ga0070673_100299807 Ga0070673_1002998072 130
249 3300005364 Ga0070673_100514997 Ga0070673_1005149972 130
250 3300005367 Ga0070667_100153395 Ga0070667_1001533953 130
251 3300005456 Ga0070678_100017941 Ga0070678_1000179412 130
252 3300005457 Ga0070662_100063329 Ga0070662_1000633293 130
253 3300005459 Ga0068867_100465274 Ga0068867_1004652741 130
254 3300005466 Ga0070685_10063991 Ga0070685_100639912 130
255 3300005466 Ga0070685_10154133 Ga0070685_101541333 130
256 3300005543 Ga0070672_100741642 Ga0070672_1007416422 130
257 3300005547 Ga0070693_100899315 Ga0070693_1008993151 130
258 3300005548 Ga0070665_100057414 Ga0070665_1000574143 130
259 3300005564 Ga0070664_100781534 Ga0070664_1007815341 130
260 3300005564 Ga0070664_102104696 Ga0070664_1021046961 130
261 3300005578 Ga0068854_100082622 Ga0068854_1000826222 130
262 3300005578 Ga0068854_100522305 Ga0068854_1005223052 130
263 3300005578 Ga0068854_101305933 Ga0068854_1013059332 130
264 3300005615 Ga0070702_100154583 Ga0070702_1001545832 130
265 3300005616 Ga0068852_100128006 Ga0068852_1001280061 130
266 3300005618 Ga0068864_101303256 Ga0068864_1013032561 130
267 3300005718 Ga0068866_10020896 Ga0068866_100208963 130
268 3300005718 Ga0068866_10310312 Ga0068866_103103122 130
269 3300005719 Ga0068861_100021758 Ga0068861_1000217587 130
270 3300005719 Ga0068861_100101391 Ga0068861_1001013912 130
271 3300005834 Ga0068851_10101026 Ga0068851_101010261 130
272 3300005834 Ga0068851_10244571 Ga0068851_102445712 130
273 3300005840 Ga0068870_10015515 Ga0068870_100155154 130
274 3300005841 Ga0068863_101493105 Ga0068863_1014931051 130
275 3300005842 Ga0068858_101525191 Ga0068858_1015251911 130
276 3300005843 Ga0068860_100141854 Ga0068860_1001418543 130
277 3300005843 Ga0068860_100539175 Ga0068860_1005391752 130
278 3300005844 Ga0068862_100070701 Ga0068862_1000707012 130
279 3300005844 Ga0068862_100088050 Ga0068862_1000880503 130
280 3300006237 Ga0097621_100059319 Ga0097621_1000593193 130
281 3300006358 Ga0068871_100072167 Ga0068871_1000721673 130
282 3300006881 Ga0068865_100167471 Ga0068865_1001674712 130
283 3300009174 Ga0105241_10186275 Ga0105241_101862752 130
284 3300009176 Ga0105242_10191313 Ga0105242_101913134 130
285 3300009545 Ga0105237_10376589 Ga0105237_103765893 130
286 3300009553 Ga0105249_10270762 Ga0105249_102707623 130
287 3300009553 Ga0105249_10292709 Ga0105249_102927093 130
288 3300011119 Ga0105246_10029947 Ga0105246_100299472 130
289 3300013100 Ga0157373_11451989 Ga0157373_114519891 130
290 3300013102 Ga0157371_10087450 Ga0157371_100874501 130
291 3300013102 Ga0157371_10257253 Ga0157371_102572533 130
292 3300013296 Ga0157374_11302354 Ga0157374_113023542 130
293 3300013297 Ga0157378_10029674 Ga0157378_100296742 130
294 3300013297 Ga0157378_10031687 Ga0157378_100316872 130
295 3300013307 Ga0157372_10247968 Ga0157372_102479682 130
296 3300013307 Ga0157372_10304665 Ga0157372_103046653 130
297 3300013307 Ga0157372_10356815 Ga0157372_103568153 130
298 3300013307 Ga0157372_10397592 Ga0157372_103975922 130
299 3300013308 Ga0157375_10115510 Ga0157375_101155103 130
300 3300013308 Ga0157375_10187257 Ga0157375_101872571 130
301 3300013308 Ga0157375_10867004 Ga0157375_108670042 130
302 3300014745 Ga0157377_10090240 Ga0157377_100902402 130
303 3300014968 Ga0157379_10060153 Ga0157379_100601532 130
304 3300025893 Ga0207682_10060724 Ga0207682_100607243 130
305 3300025899 Ga0207642_10044392 Ga0207642_100443923 130
306 3300025901 Ga0207688_10006190 Ga0207688_100061903 130
307 3300025903 Ga0207680_10005880 Ga0207680_100058805 130
308 3300025904 Ga0207647_10132997 Ga0207647_101329972 130
309 3300025904 Ga0207647_10648899 Ga0207647_106488991 130
310 3300025907 Ga0207645_10000279 Ga0207645_100002796 130
311 3300025908 Ga0207643_10093018 Ga0207643_100930183 130
312 3300025914 Ga0207671_10354140 Ga0207671_103541403 130
313 3300025920 Ga0207649_10403065 Ga0207649_104030652 130
314 3300025923 Ga0207681_10333068 Ga0207681_103330683 130
315 3300025925 Ga0207650_10090541 Ga0207650_100905412 130
316 3300025925 Ga0207650_10374450 Ga0207650_103744502 130
317 3300025925 Ga0207650_10455567 Ga0207650_104555671 130
318 3300025931 Ga0207644_10074908 Ga0207644_100749083 130
319 3300025931 Ga0207644_10459876 Ga0207644_104598761 130
320 3300025934 Ga0207686_10227174 Ga0207686_102271742 130
321 3300025938 Ga0207704_10527167 Ga0207704_105271672 130
322 3300025940 Ga0207691_10092214 Ga0207691_100922143 130
323 3300025940 Ga0207691_10587904 Ga0207691_105879041 130
324 3300025942 Ga0207689_10000865 Ga0207689_100008654 130
325 3300025942 Ga0207689_10010013 Ga0207689_100100134 130
326 3300025960 Ga0207651_10010799 Ga0207651_100107994 130
327 3300025960 Ga0207651_10367309 Ga0207651_103673092 130
328 3300025961 Ga0207712_10183388 Ga0207712_101833882 130
329 3300025972 Ga0207668_10075000 Ga0207668_100750002 130
330 3300025981 Ga0207640_10700796 Ga0207640_107007961 130
331 3300025986 Ga0207658_10234663 Ga0207658_102346632 130
332 3300026023 Ga0207677_10003787 Ga0207677_100037873 130
333 3300026035 Ga0207703_10358951 Ga0207703_103589511 130
334 3300026041 Ga0207639_11030867 Ga0207639_110308671 130
335 3300026089 Ga0207648_10000282 Ga0207648_1000028232 130
336 3300026089 Ga0207648_10519767 Ga0207648_105197672 130
337 3300026095 Ga0207676_10953561 Ga0207676_109535612 130
338 3300026095 Ga0207676_11928150 Ga0207676_119281501 130
339 3300026116 Ga0207674_11784663 Ga0207674_117846631 130
340 3300026118 Ga0207675_100015947 Ga0207675_1000159473 130
341 3300026118 Ga0207675_100345388 Ga0207675_1003453882 130
342 3300026121 Ga0207683_10000916 Ga0207683_1000091618 130
343 3300026142 Ga0207698_10250802 Ga0207698_102508021 130
344 3300026142 Ga0207698_11026513 Ga0207698_110265132 130
345 3300028379 Ga0268266_10097219 Ga0268266_100972192 130
346 3300028380 Ga0268265_10120381 Ga0268265_101203813 130
347 3300028381 Ga0268264_10677989 Ga0268264_106779891 130
348 3300032004 Ga0307414_11576441 Ga0307414_115764411 130
349 3300037418 Ga0395900_0128257 Ga0395900_0128257_679_1071 130
350 3300037466 Ga0395898_0625788 Ga0395898_0625788_233_625 130
351 3300037471 Ga0395905_0009374 Ga0395905_0009374_3002_3394 130
352 3300037471 Ga0395905_0321846 Ga0395905_0321846_56_448 130
353 3300038443 Ga0395901_0741385 Ga0395901_0741385_373_765 130
354 3300042014 Ga0439457_006387 Ga0439457_006387_1125_1544 130
355 3300044712 Ga0453684_0076251 Ga0453684_0076251_3142_3534 130
356 3300049579 Ga0501043_0158984 Ga0501043_0158984_1287_1679 130
357 3300053142 Ga0500577_0394182 Ga0500577_0394182_164_559 130
358 3300013296 Ga0157374_10172097 Ga0157374_101720972 131
359 3300014325 Ga0163163_10011851 Ga0163163_100118519 131
360 3300014745 Ga0157377_10082157 Ga0157377_100821572 131
361 3300014969 Ga0157376_10237716 Ga0157376_102377163 131
362 3300013102 Ga0157371_10033419 Ga0157371_100334193 132
363 3300013307 Ga0157372_10104074 Ga0157372_101040741 132
364 3300050005 Ga0501284_00025 Ga0501284_00025_36627_37046 135
365 3300025298 Ga0209050_1002630 Ga0209050_10026307 136
366 3300002459 JGI24751J29686_10050655 JGI24751J29686_100506552 138
367 3300005331 Ga0070670_100095190 Ga0070670_1000951902 138
368 3300005339 Ga0070660_100215320 Ga0070660_1002153202 138
369 3300025919 Ga0207657_10344762 Ga0207657_103447623 138
370 3300025925 Ga0207650_10001513 Ga0207650_100015135 138
371 3300025945 Ga0207679_10133852 Ga0207679_101338523 138

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01638

HxlR

HxlR-like helix-turn-helix

37

127

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5j6x-assembly2.cif.gz_B crystal structure of the apo-zalpha of zebrafish pkz 0.9286 44 103
4a5m-assembly1.cif.gz_B redox regulator hypr in its oxidized form 0.9249 30 121
2hzt-assembly1.cif.gz_B crystal structure of a putative hth-type transcriptional regulator ytcd 0.92 31 124
2hzt-assembly2.cif.gz_D crystal structure of a putative hth-type transcriptional regulator ytcd 0.9185 31 124
7kd3-assembly1.cif.gz_A structure of an hxlr/duf24 family transcription regulator, cdtr_3200 from hypervirulent clostridioides difficile r20291 0.9139 31 124
ID Description Score Start End Superfamily
5j6xB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9286 44 103 1.10.10.10
af_Q13156_194_261_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9262 55 86 1.10.10.10
af_P9WMG3_11_158_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9097 30 122 1.10.10.10
2hztA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9067 31 124 1.10.10.10
5hs7B00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8942 30 121 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A5R9KFA8-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9826 17 131 GO:0003677
GO:0005737
AF-A0A495T8C7-F1-model_v4 deleted 0.9803 14 129
AF-A0A6A5L6Y5-F1-model_v4 deleted 0.9799 23 134
AF-A0A832TIG1-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9743 31 123 GO:0003677
AF-A0A5C6LNJ4-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9733 15 126 GO:0003677
GO:0005737

Feature Viewer

pLDDT pTM Quality
86.53 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map