F425558

General Info

Members Datasets Scaffolds Average Seq Length
370 155 370 129

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0000399|Ga0501034_0000399_33786_34250
Length 154
Sequence MQENQGFIGLQSNLINFKESLSISLDMQQPYLVIKPTASKGRGVFTLETIPEETVIEVAPVIVMTAADRALLDQTLLHDYIFEWGEKGDQCAMALGHVPIYNHSYESNCEYFMDFNDETIMIKTIRPVDKGEELTINYNGDWNNEKQVWFETMR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
110 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
111 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
112 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
113 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
114 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
115 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
116 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
117 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
118 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
119 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
120 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
121 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
122 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
123 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
124 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
125 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
126 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
127 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
128 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
129 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
130 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
131 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
132 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
133 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
134 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
140 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
141 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
142 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
144 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
145 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
146 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
147 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
148 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
149 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
150 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
151 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
152 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
153 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
154 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
155 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.7
Nodule 0
Rhizoplane 1.89
Rhizosphere 94.05
Stem 0
Stem Tuber 0
Unclassified 1.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1887178 2162886007 Bacteria 121938
2 JGI24751J29686_10037049 3300002459 Bacteria 1010
3 rootL2_10216714 3300003322 Unclassified 2299
4 rootL2_10315083 3300003322 Bacteria 1460
5 rootH1_10053297 3300003323 Bacteria 7005
6 Ga0065714_10331243 3300005288 Bacteria 657
7 Ga0065704_10070136 3300005289 Bacteria 560402
8 Ga0070658_10021635 3300005327 Bacteria 5154
9 Ga0070658_10208248 3300005327 Bacteria 1651
10 Ga0070658_10669640 3300005327 Bacteria 900
11 Ga0070658_10673184 3300005327 Bacteria 898
12 Ga0070670_100080897 3300005331 Bacteria 2792
13 Ga0068869_100142062 3300005334 Bacteria 1854
14 Ga0070666_10242629 3300005335 Bacteria 1274
15 Ga0070680_100005084 3300005336 Bacteria 9924
16 Ga0070680_100062522 3300005336 Bacteria 3049
17 Ga0070680_100151288 3300005336 Bacteria 1948
18 Ga0070680_100340113 3300005336 Bacteria 1275
19 Ga0070682_100000125 3300005337 Bacteria 67243
20 Ga0068868_100384438 3300005338 Unclassified 1208
21 Ga0068868_100941057 3300005338 Unclassified 787
22 Ga0068868_101971544 3300005338 Bacteria 554
23 Ga0068868_102182249 3300005338 Bacteria 527
24 Ga0070660_100043029 3300005339 Bacteria 3450
25 Ga0070660_100193125 3300005339 Bacteria 1650
26 Ga0070660_100224776 3300005339 Bacteria 1526
27 Ga0070660_100729419 3300005339 Bacteria 832
28 Ga0070660_101333594 3300005339 Bacteria 609
29 Ga0070691_10586539 3300005341 Bacteria 656
30 Ga0070692_10203461 3300005345 Bacteria 1161
31 Ga0070692_10445453 3300005345 Bacteria 828
32 Ga0070675_101913032 3300005354 Bacteria 547
33 Ga0070671_100004135 3300005355 Bacteria 11460
34 Ga0070688_101479442 3300005365 Bacteria 552
35 Ga0070659_100019744 3300005366 Bacteria 5113
36 Ga0070659_100047016 3300005366 Bacteria 3383
37 Ga0070659_100074273 3300005366 Bacteria 2708
38 Ga0070659_100111867 3300005366 Unclassified 2205
39 Ga0070667_100007430 3300005367 Bacteria 9103
40 Ga0070667_100446153 3300005367 Bacteria 1182
41 Ga0070667_101247012 3300005367 Bacteria 696
42 Ga0070667_101936890 3300005367 Bacteria 555
43 Ga0070714_100471829 3300005435 Bacteria 1194
44 Ga0070663_100013646 3300005455 Bacteria 5188
45 Ga0070663_100422667 3300005455 Bacteria 1093
46 Ga0070663_100944989 3300005455 Bacteria 747
47 Ga0070662_101599961 3300005457 Unclassified 562
48 Ga0070681_10008225 3300005458 Bacteria 10206
49 Ga0070681_10160061 3300005458 Bacteria 2175
50 Ga0070681_10281497 3300005458 Bacteria 1573
51 Ga0070681_10312392 3300005458 Bacteria 1481
52 Ga0070681_10338754 3300005458 Bacteria 1414
53 Ga0070681_10821799 3300005458 Bacteria 847
54 Ga0068867_100037682 3300005459 Bacteria 3515
55 Ga0068867_100041021 3300005459 Bacteria 3382
56 Ga0068867_100071796 3300005459 Bacteria 2590
57 Ga0070679_100000367 3300005530 Bacteria 38344
58 Ga0070679_100000386 3300005530 Bacteria 37602
59 Ga0070679_100182135 3300005530 Bacteria 2073
60 Ga0070679_100200136 3300005530 Bacteria 1964
61 Ga0070679_100354055 3300005530 Bacteria 1416
62 Ga0070679_100365401 3300005530 Bacteria 1390
63 Ga0070679_100590098 3300005530 Bacteria 1054
64 Ga0070679_100729885 3300005530 Bacteria 933
65 Ga0070679_100901594 3300005530 Bacteria 828
66 Ga0068853_100010530 3300005539 Bacteria 7479
67 Ga0068853_100034666 3300005539 Bacteria 4285
68 Ga0068853_100109404 3300005539 Bacteria 2453
69 Ga0068853_101262087 3300005539 Bacteria 714
70 Ga0070665_100000013 3300005548 Bacteria 484927
71 Ga0068855_100020474 3300005563 Bacteria 7931
72 Ga0068855_100045289 3300005563 Bacteria 5203
73 Ga0068855_100058580 3300005563 Bacteria 4510
74 Ga0068855_100069390 3300005563 Bacteria 4101
75 Ga0068855_100860423 3300005563 Bacteria 960
76 Ga0068855_101273953 3300005563 Bacteria 762
77 Ga0068855_101499037 3300005563 Bacteria 692
78 Ga0070664_100452251 3300005564 Unclassified 1179
79 Ga0070664_100857912 3300005564 Bacteria 850
80 Ga0070664_102040640 3300005564 Bacteria 544
81 Ga0068857_100413913 3300005577 Bacteria 1256
82 Ga0068857_100796531 3300005577 Bacteria 902
83 Ga0068857_101370496 3300005577 Bacteria 687
84 Ga0068857_101457627 3300005577 Bacteria 666
85 Ga0068857_101663596 3300005577 Bacteria 624
86 Ga0068854_100610587 3300005578 Bacteria 932
87 Ga0068854_101135666 3300005578 Bacteria 697
88 Ga0068854_101317473 3300005578 Bacteria 650
89 Ga0068856_100190669 3300005614 Bacteria 2063
90 Ga0068852_100004593 3300005616 Bacteria 9778
91 Ga0068852_100031469 3300005616 Bacteria 4379
92 Ga0068852_101299575 3300005616 Bacteria 749
93 Ga0068852_101911687 3300005616 Bacteria 616
94 Ga0068852_101992304 3300005616 Bacteria 603
95 Ga0068864_100099585 3300005618 Bacteria 2575
96 Ga0068866_10008639 3300005718 Bacteria 4301
97 Ga0068861_100824896 3300005719 Unclassified 872
98 Ga0068851_10003154 3300005834 Bacteria 7312
99 Ga0068863_100054950 3300005841 Bacteria 3772
100 Ga0068863_102450255 3300005841 Unclassified 531
101 Ga0068860_100000060 3300005843 Bacteria 195631
102 Ga0068860_100080558 3300005843 Bacteria 3096
103 Ga0068860_100195764 3300005843 Bacteria 1957
104 Ga0068860_101777301 3300005843 Bacteria 638
105 Ga0068862_100800552 3300005844 Bacteria 920
106 Ga0070715_11016313 3300006163 Bacteria 517
107 Ga0097621_100001588 3300006237 Bacteria 15542
108 Ga0097621_100397560 3300006237 Bacteria 1233
109 Ga0068871_100000332 3300006358 Bacteria 32762
110 Ga0068871_100037113 3300006358 Bacteria 3884
111 Ga0075428_100035371 3300006844 Bacteria 5506
112 Ga0075429_100027521 3300006880 Bacteria 4935
113 Ga0068865_100310628 3300006881 Bacteria 1265
114 Ga0105240_10055637 3300009093 Bacteria 4953
115 Ga0105240_10147819 3300009093 Bacteria 2802
116 Ga0105240_10319035 3300009093 Bacteria 1772
117 Ga0105240_11460088 3300009093 Bacteria 718
118 Ga0105245_10130241 3300009098 Unclassified 2359
119 Ga0114129_10202118 3300009147 Bacteria 2691
120 Ga0105241_10253343 3300009174 Bacteria 1493
121 Ga0105241_10284349 3300009174 Bacteria 1414
122 Ga0105241_11813699 3300009174 Unclassified 596
123 Ga0105242_10175279 3300009176 Bacteria 1887
124 Ga0105242_10569830 3300009176 Bacteria 1089
125 Ga0105248_10004754 3300009177 Bacteria 15030
126 Ga0105237_10152600 3300009545 Bacteria 2307
127 Ga0105237_10356484 3300009545 Bacteria 1467
128 Ga0105249_10009437 3300009553 Bacteria 8542
129 Ga0105249_10013566 3300009553 Bacteria 7198
130 Ga0105249_11741840 3300009553 Unclassified 696
131 Ga0105249_13483575 3300009553 Bacteria 507
132 Ga0105239_10052802 3300010375 Bacteria 4458
133 Ga0105239_11505884 3300010375 Bacteria 777
134 Ga0157373_10036593 3300013100 Bacteria 3522
135 Ga0157373_10070674 3300013100 Bacteria 2467
136 Ga0157373_10109750 3300013100 Bacteria 1939
137 Ga0157373_10136994 3300013100 Bacteria 1721
138 Ga0157373_10177913 3300013100 Bacteria 1498
139 Ga0157373_10179701 3300013100 Bacteria 1489
140 Ga0157373_10390592 3300013100 Bacteria 996
141 Ga0157371_10001959 3300013102 Bacteria 20458
142 Ga0157371_10002917 3300013102 Bacteria 15974
143 Ga0157371_10004645 3300013102 Bacteria 11898
144 Ga0157371_10015545 3300013102 Bacteria 5708
145 Ga0157371_10031081 3300013102 Bacteria 3848
146 Ga0157371_10072168 3300013102 Unclassified 2445
147 Ga0157371_10108619 3300013102 Bacteria 1969
148 Ga0157371_10110777 3300013102 Bacteria 1948
149 Ga0157371_10137861 3300013102 Bacteria 1738
150 Ga0157371_10169823 3300013102 Bacteria 1558
151 Ga0157371_10193752 3300013102 Bacteria 1456
152 Ga0157371_10201942 3300013102 Bacteria 1425
153 Ga0157371_10322760 3300013102 Bacteria 1121
154 Ga0157371_10329942 3300013102 Bacteria 1108
155 Ga0157371_11298044 3300013102 Bacteria 563
156 Ga0157370_10042831 3300013104 Bacteria 4360
157 Ga0157370_10106810 3300013104 Bacteria 2619
158 Ga0157370_10295372 3300013104 Bacteria 1496
159 Ga0157370_10436277 3300013104 Bacteria 1204
160 Ga0157370_11513694 3300013104 Bacteria 603
161 Ga0157369_10008343 3300013105 Bacteria 11879
162 Ga0157369_10028146 3300013105 Bacteria 6221
163 Ga0157369_10277634 3300013105 Bacteria 1745
164 Ga0157369_10319326 3300013105 Bacteria 1615
165 Ga0157369_10394260 3300013105 Bacteria 1436
166 Ga0157369_10524155 3300013105 Bacteria 1226
167 Ga0157369_11054030 3300013105 Bacteria 832
168 Ga0157374_10069256 3300013296 Bacteria 3322
169 Ga0157374_10748873 3300013296 Bacteria 992
170 Ga0157378_10012731 3300013297 Bacteria 7361
171 Ga0157378_10032842 3300013297 Bacteria 4587
172 Ga0157378_10551914 3300013297 Bacteria 1157
173 Ga0157378_10739078 3300013297 Bacteria 1006
174 Ga0157378_11205522 3300013297 Unclassified 796
175 Ga0163162_10000213 3300013306 Bacteria 53744
176 Ga0163162_10002248 3300013306 Bacteria 18138
177 Ga0163162_10005439 3300013306 Bacteria 12307
178 Ga0163162_10006787 3300013306 Bacteria 11108
179 Ga0163162_10138017 3300013306 Unclassified 2550
180 Ga0157372_10026389 3300013307 Bacteria 6322
181 Ga0157372_10054634 3300013307 Bacteria 4456
182 Ga0157372_10058629 3300013307 Bacteria 4305
183 Ga0157372_10075806 3300013307 Bacteria 3796
184 Ga0157372_10136081 3300013307 Unclassified 2829
185 Ga0157372_10190095 3300013307 Bacteria 2378
186 Ga0157372_10190535 3300013307 Bacteria 2375
187 Ga0157372_10476707 3300013307 Bacteria 1455
188 Ga0157372_10567701 3300013307 Bacteria 1323
189 Ga0157372_11112108 3300013307 Bacteria 914
190 Ga0157372_11427901 3300013307 Bacteria 798
191 Ga0157372_12326728 3300013307 Bacteria 615
192 Ga0157372_13217674 3300013307 Bacteria 521
193 Ga0157375_10000553 3300013308 Bacteria 33598
194 Ga0157375_10601293 3300013308 Bacteria 1259
195 Ga0157375_10858941 3300013308 Bacteria 1053
196 Ga0157375_12897457 3300013308 Bacteria 573
197 Ga0157380_12502082 3300014326 Unclassified 582
198 Ga0157377_10075644 3300014745 Bacteria 1956
199 Ga0157379_10012425 3300014968 Bacteria 7434
200 Ga0157379_10123955 3300014968 Unclassified 2325
201 Ga0157379_10957080 3300014968 Bacteria 814
202 Ga0157379_11838955 3300014968 Unclassified 596
203 Ga0157376_10000491 3300014969 Bacteria 25555
204 Ga0157376_10349607 3300014969 Bacteria 1414
205 Ga0163161_10232526 3300017792 Bacteria 1431
206 Ga0163161_10278091 3300017792 Bacteria 1312
207 Ga0207642_10016226 3300025899 Bacteria 2800
208 Ga0207642_10480269 3300025899 Unclassified 758
209 Ga0207680_10086673 3300025903 Bacteria 1981
210 Ga0207680_10494390 3300025903 Unclassified 871
211 Ga0207680_10724378 3300025903 Bacteria 713
212 Ga0207647_10002403 3300025904 Bacteria 14210
213 Ga0207647_10061784 3300025904 Bacteria 2284
214 Ga0207685_10492022 3300025905 Bacteria 644
215 Ga0207645_10069842 3300025907 Bacteria 2247
216 Ga0207705_10032003 3300025909 Bacteria 3757
217 Ga0207705_10114037 3300025909 Bacteria 1999
218 Ga0207705_10505564 3300025909 Bacteria 939
219 Ga0207705_10672299 3300025909 Bacteria 805
220 Ga0207705_10723977 3300025909 Bacteria 773
221 Ga0207705_10781963 3300025909 Bacteria 741
222 Ga0207705_10788593 3300025909 Bacteria 738
223 Ga0207654_10155844 3300025911 Bacteria 1471
224 Ga0207654_10216174 3300025911 Bacteria 1269
225 Ga0207654_10986196 3300025911 Unclassified 612
226 Ga0207707_10084827 3300025912 Bacteria 2767
227 Ga0207707_10127551 3300025912 Bacteria 2225
228 Ga0207707_10576147 3300025912 Bacteria 954
229 Ga0207707_11104314 3300025912 Bacteria 646
230 Ga0207695_10508769 3300025913 Bacteria 1086
231 Ga0207695_11079021 3300025913 Unclassified 683
232 Ga0207671_10076827 3300025914 Bacteria 2499
233 Ga0207671_10206470 3300025914 Bacteria 1535
234 Ga0207660_10001426 3300025917 Bacteria 16045
235 Ga0207660_10059440 3300025917 Bacteria 2744
236 Ga0207660_10343786 3300025917 Bacteria 1195
237 Ga0207660_11041423 3300025917 Bacteria 667
238 Ga0207657_10024010 3300025919 Bacteria 5661
239 Ga0207657_10040504 3300025919 Bacteria 4127
240 Ga0207657_10099144 3300025919 Bacteria 2420
241 Ga0207657_10316936 3300025919 Bacteria 1234
242 Ga0207657_10801790 3300025919 Bacteria 728
243 Ga0207649_10593321 3300025920 Bacteria 851
244 Ga0207652_10000276 3300025921 Bacteria 53325
245 Ga0207652_10000366 3300025921 Bacteria 46915
246 Ga0207652_10015015 3300025921 Bacteria 6282
247 Ga0207652_10178946 3300025921 Bacteria 1905
248 Ga0207650_10159714 3300025925 Bacteria 1785
249 Ga0207644_10002675 3300025931 Bacteria 11472
250 Ga0207690_10018020 3300025932 Bacteria 4325
251 Ga0207690_10068888 3300025932 Bacteria 2432
252 Ga0207690_10109020 3300025932 Unclassified 1991
253 Ga0207690_10564225 3300025932 Bacteria 926
254 Ga0207686_10621820 3300025934 Unclassified 852
255 Ga0207711_10429186 3300025941 Bacteria 1230
256 Ga0207661_10301811 3300025944 Bacteria 1436
257 Ga0207679_10783155 3300025945 Bacteria 869
258 Ga0207667_10005069 3300025949 Bacteria 16094
259 Ga0207667_10074466 3300025949 Unclassified 3527
260 Ga0207667_10344982 3300025949 Bacteria 1519
261 Ga0207667_10437000 3300025949 Bacteria 1331
262 Ga0207667_10873009 3300025949 Bacteria 893
263 Ga0207667_11603123 3300025949 Bacteria 619
264 Ga0207651_10300953 3300025960 Bacteria 1334
265 Ga0207712_10007124 3300025961 Bacteria 7053
266 Ga0207712_10007359 3300025961 Bacteria 6950
267 Ga0207640_10443515 3300025981 Bacteria 1068
268 Ga0207640_10548617 3300025981 Bacteria 971
269 Ga0207640_10985980 3300025981 Bacteria 740
270 Ga0207658_10811752 3300025986 Unclassified 849
271 Ga0207677_10112150 3300026023 Bacteria 2033
272 Ga0207677_10908521 3300026023 Unclassified 794
273 Ga0207677_11093784 3300026023 Bacteria 726
274 Ga0207639_10021822 3300026041 Bacteria 4603
275 Ga0207639_10071439 3300026041 Bacteria 2715
276 Ga0207639_10123576 3300026041 Bacteria 2131
277 Ga0207639_10394083 3300026041 Bacteria 1246
278 Ga0207678_10003224 3300026067 Bacteria 14742
279 Ga0207678_11116929 3300026067 Bacteria 698
280 Ga0207702_10228658 3300026078 Bacteria 1737
281 Ga0207702_10281723 3300026078 Bacteria 1572
282 Ga0207648_10029234 3300026089 Bacteria 4887
283 Ga0207648_10082299 3300026089 Bacteria 2807
284 Ga0207648_10791442 3300026089 Bacteria 882
285 Ga0207676_10083672 3300026095 Bacteria 2599
286 Ga0207674_10128623 3300026116 Bacteria 2497
287 Ga0207674_10659780 3300026116 Bacteria 1010
288 Ga0207674_10939736 3300026116 Bacteria 833
289 Ga0207674_11091003 3300026116 Bacteria 768
290 Ga0207698_10002709 3300026142 Bacteria 10543
291 Ga0207698_10295954 3300026142 Bacteria 1504
292 Ga0268266_10000024 3300028379 Bacteria 490820
293 Ga0268265_10539086 3300028380 Bacteria 1106
294 Ga0268264_10000109 3300028381 Bacteria 208477
295 Ga0268264_10038603 3300028381 Bacteria 3942
296 Ga0268264_11842957 3300028381 Bacteria 615
297 Ga0307515_10000002 3300028794 Bacteria 1231751
298 Ga0307513_10566548 3300031456 Bacteria 847
299 Ga0265313_10121902 3300031595 Bacteria 1136
300 Ga0307414_10214190 3300032004 Bacteria 1577
301 Ga0307415_101412614 3300032126 Unclassified 663
302 Ga0395899_0004174 3300037312 Bacteria 11342
303 Ga0395899_0006130 3300037312 Bacteria 9319
304 Ga0395899_0019245 3300037312 Bacteria 5190
305 Ga0395899_0021641 3300037312 Bacteria 4876
306 Ga0395899_0059475 3300037312 Bacteria 2817
307 Ga0395900_0003729 3300037418 Bacteria 16354
308 Ga0395900_0007210 3300037418 Bacteria 11521
309 Ga0395900_0080346 3300037418 Bacteria 3350
310 Ga0395900_0320791 3300037418 Bacteria 1529
311 Ga0395900_0337024 3300037418 Bacteria 1484
312 Ga0395900_0416152 3300037418 Bacteria 1305
313 Ga0395900_0583722 3300037418 Bacteria 1059
314 Ga0395898_0005317 3300037466 Bacteria 13919
315 Ga0395898_0031110 3300037466 Bacteria 5337
316 Ga0395898_0047143 3300037466 Bacteria 4230
317 Ga0395898_0057011 3300037466 Bacteria 3806
318 Ga0395898_0276516 3300037466 Bacteria 1601
319 Ga0395898_0514963 3300037466 Bacteria 1137
320 Ga0395905_0515593 3300037471 Bacteria 1096
321 Ga0395905_0615087 3300037471 Bacteria 988
322 Ga0395901_0013165 3300038443 Bacteria 8399
323 Ga0395901_0029496 3300038443 Bacteria 5650
324 Ga0395901_0064598 3300038443 Bacteria 3810
325 Ga0395901_0264252 3300038443 Bacteria 1790
326 Ga0395901_0309832 3300038443 Bacteria 1635
327 Ga0451793_1686764 3300041452 Unclassified 535
328 Ga0453684_0024889 3300044712 Bacteria 8718
329 Ga0453684_2155937 3300044712 Unclassified 558
330 Ga0451576_0730585 3300045051 Bacteria 1040
331 Ga0495648_0010591 3300046524 Bacteria 7010
332 Ga0495597_0071948 3300046542 Bacteria 1488
333 Ga0495668_0000449 3300046616 Bacteria 52562
334 Ga0495672_0015254 3300047320 Bacteria 5224
335 Ga0495687_000014 3300047443 Bacteria 366896
336 Ga0495686_0000335 3300047472 Bacteria 77634
337 Ga0496100_0057821 3300048903 Bacteria 2542
338 Ga0496104_0187731 3300048907 Bacteria 1978
339 Ga0496105_1294868 3300048908 Unclassified 532
340 Ga0496106_0644200 3300048909 Unclassified 847
341 Ga0496109_0318425 3300048912 Bacteria 1468
342 Ga0496110_0865316 3300048913 Unclassified 809
343 Ga0501033_0069990 3300049570 Bacteria 2578
344 Ga0501034_0000399 3300049571 Bacteria 73348
345 Ga0501034_0140144 3300049571 Bacteria 2398
346 Ga0501034_0466183 3300049571 Bacteria 1179
347 Ga0501034_0994311 3300049571 Bacteria 723
348 Ga0501037_0211138 3300049573 Bacteria 1369
349 Ga0501043_0271088 3300049579 Bacteria 1303
350 Ga0501043_0325615 3300049579 Bacteria 1171
351 Ga0501043_0815596 3300049579 Unclassified 674
352 Ga0501047_0273541 3300049581 Bacteria 1535
353 Ga0501250_012896 3300049680 Bacteria 995
354 Ga0501251_044618 3300049681 Unclassified 683
355 Ga0501269_005546 3300049766 Bacteria 1517
356 Ga0501035_0748144 3300049822 Bacteria 785
357 Ga0501035_1527816 3300049822 Bacteria 508
358 Ga0501044_0123492 3300049823 Bacteria 2588
359 nmdc:mga05p37_282129_c1 3300050507 Bacteria 1980
360 nmdc:mga06r32_139827_c1 3300050510 Bacteria 2397
361 Ga0500644_0084331 3300053088 Bacteria 1176
362 Ga0500583_0034113 3300053092 Bacteria 2260
363 Ga0500641_0286401 3300053096 Unclassified 681
364 Ga0500556_0003830 3300053104 Bacteria 4362
365 Ga0500562_153480 3300053108 Bacteria 627
366 Ga0500592_029084 3300053116 Bacteria 891
367 Ga0500594_0002336 3300053118 Bacteria 4117
368 Ga0500642_0090017 3300053130 Unclassified 1417
369 Ga0500616_0001609 3300053153 Bacteria 21040
370 Ga0500627_0016136 3300053158 Bacteria 2907

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003322 rootL2_10315083 rootL2_103150832 126
2 3300005564 Ga0070664_100857912 Ga0070664_1008579122 126
3 3300014326 Ga0157380_12502082 Ga0157380_125020821 126
4 3300025945 Ga0207679_10783155 Ga0207679_107831551 126
5 3300002459 JGI24751J29686_10037049 JGI24751J29686_100370491 127
6 3300003322 rootL2_10216714 rootL2_102167142 127
7 3300003323 rootH1_10053297 rootH1_100532977 127
8 3300005288 Ga0065714_10331243 Ga0065714_103312431 127
9 3300005327 Ga0070658_10021635 Ga0070658_100216351 127
10 3300005327 Ga0070658_10208248 Ga0070658_102082483 127
11 3300005327 Ga0070658_10669640 Ga0070658_106696401 127
12 3300005327 Ga0070658_10673184 Ga0070658_106731842 127
13 3300005331 Ga0070670_100080897 Ga0070670_1000808972 127
14 3300005334 Ga0068869_100142062 Ga0068869_1001420622 127
15 3300005335 Ga0070666_10242629 Ga0070666_102426291 127
16 3300005336 Ga0070680_100005084 Ga0070680_10000508410 127
17 3300005336 Ga0070680_100062522 Ga0070680_1000625222 127
18 3300005336 Ga0070680_100151288 Ga0070680_1001512882 127
19 3300005336 Ga0070680_100340113 Ga0070680_1003401131 127
20 3300005337 Ga0070682_100000125 Ga0070682_10000012512 127
21 3300005338 Ga0068868_100384438 Ga0068868_1003844382 127
22 3300005338 Ga0068868_100941057 Ga0068868_1009410571 127
23 3300005338 Ga0068868_101971544 Ga0068868_1019715441 127
24 3300005339 Ga0070660_100043029 Ga0070660_1000430292 127
25 3300005339 Ga0070660_100193125 Ga0070660_1001931252 127
26 3300005339 Ga0070660_100224776 Ga0070660_1002247761 127
27 3300005339 Ga0070660_100729419 Ga0070660_1007294191 127
28 3300005339 Ga0070660_101333594 Ga0070660_1013335941 127
29 3300005341 Ga0070691_10586539 Ga0070691_105865392 127
30 3300005345 Ga0070692_10203461 Ga0070692_102034612 127
31 3300005345 Ga0070692_10445453 Ga0070692_104454532 127
32 3300005354 Ga0070675_101913032 Ga0070675_1019130321 127
33 3300005355 Ga0070671_100004135 Ga0070671_1000041357 127
34 3300005365 Ga0070688_101479442 Ga0070688_1014794421 127
35 3300005366 Ga0070659_100019744 Ga0070659_1000197442 127
36 3300005366 Ga0070659_100047016 Ga0070659_1000470162 127
37 3300005366 Ga0070659_100074273 Ga0070659_1000742733 127
38 3300005366 Ga0070659_100111867 Ga0070659_1001118672 127
39 3300005367 Ga0070667_100007430 Ga0070667_1000074302 127
40 3300005367 Ga0070667_100446153 Ga0070667_1004461532 127
41 3300005367 Ga0070667_101247012 Ga0070667_1012470121 127
42 3300005367 Ga0070667_101936890 Ga0070667_1019368901 127
43 3300005435 Ga0070714_100471829 Ga0070714_1004718292 127
44 3300005455 Ga0070663_100013646 Ga0070663_1000136465 127
45 3300005455 Ga0070663_100422667 Ga0070663_1004226672 127
46 3300005455 Ga0070663_100944989 Ga0070663_1009449891 127
47 3300005457 Ga0070662_101599961 Ga0070662_1015999611 127
48 3300005458 Ga0070681_10008225 Ga0070681_100082254 127
49 3300005458 Ga0070681_10160061 Ga0070681_101600612 127
50 3300005458 Ga0070681_10281497 Ga0070681_102814972 127
51 3300005458 Ga0070681_10312392 Ga0070681_103123922 127
52 3300005458 Ga0070681_10338754 Ga0070681_103387541 127
53 3300005458 Ga0070681_10821799 Ga0070681_108217991 127
54 3300005459 Ga0068867_100037682 Ga0068867_1000376822 127
55 3300005459 Ga0068867_100041021 Ga0068867_1000410213 127
56 3300005459 Ga0068867_100071796 Ga0068867_1000717962 127
57 3300005530 Ga0070679_100000367 Ga0070679_1000003679 127
58 3300005530 Ga0070679_100000386 Ga0070679_10000038611 127
59 3300005530 Ga0070679_100182135 Ga0070679_1001821352 127
60 3300005530 Ga0070679_100200136 Ga0070679_1002001362 127
61 3300005530 Ga0070679_100354055 Ga0070679_1003540551 127
62 3300005530 Ga0070679_100365401 Ga0070679_1003654011 127
63 3300005530 Ga0070679_100590098 Ga0070679_1005900982 127
64 3300005530 Ga0070679_100729885 Ga0070679_1007298852 127
65 3300005530 Ga0070679_100901594 Ga0070679_1009015941 127
66 3300005539 Ga0068853_100010530 Ga0068853_1000105305 127
67 3300005539 Ga0068853_100034666 Ga0068853_1000346664 127
68 3300005539 Ga0068853_100109404 Ga0068853_1001094042 127
69 3300005539 Ga0068853_101262087 Ga0068853_1012620871 127
70 3300005548 Ga0070665_100000013 Ga0070665_100000013234 127
71 3300005563 Ga0068855_100020474 Ga0068855_1000204746 127
72 3300005563 Ga0068855_100045289 Ga0068855_1000452892 127
73 3300005563 Ga0068855_100058580 Ga0068855_1000585804 127
74 3300005563 Ga0068855_100069390 Ga0068855_1000693906 127
75 3300005563 Ga0068855_100860423 Ga0068855_1008604232 127
76 3300005563 Ga0068855_101273953 Ga0068855_1012739532 127
77 3300005563 Ga0068855_101499037 Ga0068855_1014990371 127
78 3300005564 Ga0070664_100452251 Ga0070664_1004522512 127
79 3300005564 Ga0070664_102040640 Ga0070664_1020406401 127
80 3300005577 Ga0068857_100413913 Ga0068857_1004139131 127
81 3300005577 Ga0068857_100796531 Ga0068857_1007965312 127
82 3300005577 Ga0068857_101370496 Ga0068857_1013704961 127
83 3300005577 Ga0068857_101457627 Ga0068857_1014576271 127
84 3300005577 Ga0068857_101663596 Ga0068857_1016635961 127
85 3300005578 Ga0068854_100610587 Ga0068854_1006105872 127
86 3300005578 Ga0068854_101135666 Ga0068854_1011356662 127
87 3300005578 Ga0068854_101317473 Ga0068854_1013174731 127
88 3300005614 Ga0068856_100190669 Ga0068856_1001906693 127
89 3300005616 Ga0068852_100004593 Ga0068852_1000045938 127
90 3300005616 Ga0068852_100031469 Ga0068852_1000314692 127
91 3300005616 Ga0068852_101299575 Ga0068852_1012995751 127
92 3300005616 Ga0068852_101911687 Ga0068852_1019116871 127
93 3300005616 Ga0068852_101992304 Ga0068852_1019923041 127
94 3300005618 Ga0068864_100099585 Ga0068864_1000995852 127
95 3300005718 Ga0068866_10008639 Ga0068866_100086392 127
96 3300005719 Ga0068861_100824896 Ga0068861_1008248962 127
97 3300005834 Ga0068851_10003154 Ga0068851_100031544 127
98 3300005841 Ga0068863_100054950 Ga0068863_1000549502 127
99 3300005841 Ga0068863_102450255 Ga0068863_1024502551 127
100 3300005843 Ga0068860_100000060 Ga0068860_100000060130 127
101 3300005843 Ga0068860_100080558 Ga0068860_1000805583 127
102 3300005843 Ga0068860_100195764 Ga0068860_1001957641 127
103 3300005843 Ga0068860_101777301 Ga0068860_1017773012 127
104 3300005844 Ga0068862_100800552 Ga0068862_1008005522 127
105 3300006163 Ga0070715_11016313 Ga0070715_110163131 127
106 3300006237 Ga0097621_100001588 Ga0097621_10000158813 127
107 3300006237 Ga0097621_100397560 Ga0097621_1003975602 127
108 3300006358 Ga0068871_100000332 Ga0068871_10000033218 127
109 3300006358 Ga0068871_100037113 Ga0068871_1000371133 127
110 3300006844 Ga0075428_100035371 Ga0075428_1000353714 127
111 3300006880 Ga0075429_100027521 Ga0075429_1000275214 127
112 3300006881 Ga0068865_100310628 Ga0068865_1003106281 127
113 3300009093 Ga0105240_10055637 Ga0105240_100556375 127
114 3300009093 Ga0105240_10147819 Ga0105240_101478192 127
115 3300009093 Ga0105240_10319035 Ga0105240_103190352 127
116 3300009093 Ga0105240_11460088 Ga0105240_114600881 127
117 3300009098 Ga0105245_10130241 Ga0105245_101302412 127
118 3300009147 Ga0114129_10202118 Ga0114129_102021182 127
119 3300009174 Ga0105241_10253343 Ga0105241_102533432 127
120 3300009174 Ga0105241_10284349 Ga0105241_102843492 127
121 3300009174 Ga0105241_11813699 Ga0105241_118136991 127
122 3300009176 Ga0105242_10175279 Ga0105242_101752792 127
123 3300009176 Ga0105242_10569830 Ga0105242_105698302 127
124 3300009177 Ga0105248_10004754 Ga0105248_1000475413 127
125 3300009545 Ga0105237_10152600 Ga0105237_101526002 127
126 3300009545 Ga0105237_10356484 Ga0105237_103564842 127
127 3300009553 Ga0105249_10009437 Ga0105249_100094377 127
128 3300009553 Ga0105249_10013566 Ga0105249_100135664 127
129 3300009553 Ga0105249_11741840 Ga0105249_117418402 127
130 3300009553 Ga0105249_13483575 Ga0105249_134835751 127
131 3300010375 Ga0105239_10052802 Ga0105239_100528023 127
132 3300010375 Ga0105239_11505884 Ga0105239_115058842 127
133 3300013100 Ga0157373_10036593 Ga0157373_100365932 127
134 3300013100 Ga0157373_10070674 Ga0157373_100706742 127
135 3300013100 Ga0157373_10109750 Ga0157373_101097502 127
136 3300013100 Ga0157373_10136994 Ga0157373_101369942 127
137 3300013100 Ga0157373_10177913 Ga0157373_101779132 127
138 3300013100 Ga0157373_10179701 Ga0157373_101797011 127
139 3300013100 Ga0157373_10390592 Ga0157373_103905922 127
140 3300013102 Ga0157371_10001959 Ga0157371_1000195912 127
141 3300013102 Ga0157371_10002917 Ga0157371_100029172 127
142 3300013102 Ga0157371_10004645 Ga0157371_100046459 127
143 3300013102 Ga0157371_10015545 Ga0157371_100155454 127
144 3300013102 Ga0157371_10031081 Ga0157371_100310813 127
145 3300013102 Ga0157371_10072168 Ga0157371_100721681 127
146 3300013102 Ga0157371_10108619 Ga0157371_101086192 127
147 3300013102 Ga0157371_10110777 Ga0157371_101107772 127
148 3300013102 Ga0157371_10137861 Ga0157371_101378612 127
149 3300013102 Ga0157371_10169823 Ga0157371_101698232 127
150 3300013102 Ga0157371_10193752 Ga0157371_101937522 127
151 3300013102 Ga0157371_10201942 Ga0157371_102019421 127
152 3300013102 Ga0157371_10322760 Ga0157371_103227602 127
153 3300013102 Ga0157371_10329942 Ga0157371_103299421 127
154 3300013102 Ga0157371_11298044 Ga0157371_112980442 127
155 3300013104 Ga0157370_10042831 Ga0157370_100428313 127
156 3300013104 Ga0157370_10106810 Ga0157370_101068102 127
157 3300013104 Ga0157370_10295372 Ga0157370_102953721 127
158 3300013104 Ga0157370_10436277 Ga0157370_104362771 127
159 3300013104 Ga0157370_11513694 Ga0157370_115136941 127
160 3300013105 Ga0157369_10008343 Ga0157369_100083435 127
161 3300013105 Ga0157369_10028146 Ga0157369_100281464 127
162 3300013105 Ga0157369_10277634 Ga0157369_102776342 127
163 3300013105 Ga0157369_10319326 Ga0157369_103193262 127
164 3300013105 Ga0157369_10394260 Ga0157369_103942601 127
165 3300013105 Ga0157369_10524155 Ga0157369_105241552 127
166 3300013105 Ga0157369_11054030 Ga0157369_110540301 127
167 3300013296 Ga0157374_10069256 Ga0157374_100692562 127
168 3300013296 Ga0157374_10748873 Ga0157374_107488732 127
169 3300013297 Ga0157378_10012731 Ga0157378_100127316 127
170 3300013297 Ga0157378_10032842 Ga0157378_100328423 127
171 3300013297 Ga0157378_10551914 Ga0157378_105519142 127
172 3300013297 Ga0157378_10739078 Ga0157378_107390781 127
173 3300013297 Ga0157378_11205522 Ga0157378_112055221 127
174 3300013306 Ga0163162_10000213 Ga0163162_1000021350 127
175 3300013306 Ga0163162_10002248 Ga0163162_1000224810 127
176 3300013306 Ga0163162_10005439 Ga0163162_100054393 127
177 3300013306 Ga0163162_10006787 Ga0163162_100067872 127
178 3300013306 Ga0163162_10138017 Ga0163162_101380173 127
179 3300013307 Ga0157372_10026389 Ga0157372_100263896 127
180 3300013307 Ga0157372_10054634 Ga0157372_100546343 127
181 3300013307 Ga0157372_10058629 Ga0157372_100586292 127
182 3300013307 Ga0157372_10075806 Ga0157372_100758064 127
183 3300013307 Ga0157372_10136081 Ga0157372_101360812 127
184 3300013307 Ga0157372_10190095 Ga0157372_101900952 127
185 3300013307 Ga0157372_10190535 Ga0157372_101905352 127
186 3300013307 Ga0157372_10476707 Ga0157372_104767072 127
187 3300013307 Ga0157372_10567701 Ga0157372_105677011 127
188 3300013307 Ga0157372_11112108 Ga0157372_111121082 127
189 3300013307 Ga0157372_11427901 Ga0157372_114279011 127
190 3300013307 Ga0157372_12326728 Ga0157372_123267281 127
191 3300013307 Ga0157372_13217674 Ga0157372_132176741 127
192 3300013308 Ga0157375_10000553 Ga0157375_1000055316 127
193 3300013308 Ga0157375_10601293 Ga0157375_106012932 127
194 3300013308 Ga0157375_10858941 Ga0157375_108589412 127
195 3300013308 Ga0157375_12897457 Ga0157375_128974571 127
196 3300014745 Ga0157377_10075644 Ga0157377_100756442 127
197 3300014968 Ga0157379_10012425 Ga0157379_100124254 127
198 3300014968 Ga0157379_10123955 Ga0157379_101239553 127
199 3300014968 Ga0157379_10957080 Ga0157379_109570801 127
200 3300014968 Ga0157379_11838955 Ga0157379_118389551 127
201 3300014969 Ga0157376_10000491 Ga0157376_1000049112 127
202 3300014969 Ga0157376_10349607 Ga0157376_103496072 127
203 3300017792 Ga0163161_10232526 Ga0163161_102325262 127
204 3300017792 Ga0163161_10278091 Ga0163161_102780912 127
205 3300025899 Ga0207642_10016226 Ga0207642_100162261 127
206 3300025899 Ga0207642_10480269 Ga0207642_104802691 127
207 3300025903 Ga0207680_10086673 Ga0207680_100866731 127
208 3300025903 Ga0207680_10494390 Ga0207680_104943902 127
209 3300025903 Ga0207680_10724378 Ga0207680_107243781 127
210 3300025904 Ga0207647_10002403 Ga0207647_100024038 127
211 3300025904 Ga0207647_10061784 Ga0207647_100617843 127
212 3300025905 Ga0207685_10492022 Ga0207685_104920221 127
213 3300025907 Ga0207645_10069842 Ga0207645_100698423 127
214 3300025909 Ga0207705_10032003 Ga0207705_100320033 127
215 3300025909 Ga0207705_10114037 Ga0207705_101140372 127
216 3300025909 Ga0207705_10505564 Ga0207705_105055642 127
217 3300025909 Ga0207705_10672299 Ga0207705_106722991 127
218 3300025909 Ga0207705_10723977 Ga0207705_107239771 127
219 3300025909 Ga0207705_10781963 Ga0207705_107819631 127
220 3300025909 Ga0207705_10788593 Ga0207705_107885931 127
221 3300025911 Ga0207654_10155844 Ga0207654_101558442 127
222 3300025911 Ga0207654_10216174 Ga0207654_102161742 127
223 3300025911 Ga0207654_10986196 Ga0207654_109861962 127
224 3300025912 Ga0207707_10084827 Ga0207707_100848271 127
225 3300025912 Ga0207707_10127551 Ga0207707_101275512 127
226 3300025912 Ga0207707_10576147 Ga0207707_105761472 127
227 3300025912 Ga0207707_11104314 Ga0207707_111043141 127
228 3300025913 Ga0207695_10508769 Ga0207695_105087692 127
229 3300025913 Ga0207695_11079021 Ga0207695_110790211 127
230 3300025914 Ga0207671_10076827 Ga0207671_100768272 127
231 3300025914 Ga0207671_10206470 Ga0207671_102064702 127
232 3300025917 Ga0207660_10001426 Ga0207660_1000142618 127
233 3300025917 Ga0207660_10059440 Ga0207660_100594402 127
234 3300025917 Ga0207660_10343786 Ga0207660_103437861 127
235 3300025917 Ga0207660_11041423 Ga0207660_110414231 127
236 3300025919 Ga0207657_10024010 Ga0207657_100240104 127
237 3300025919 Ga0207657_10040504 Ga0207657_100405043 127
238 3300025919 Ga0207657_10099144 Ga0207657_100991442 127
239 3300025919 Ga0207657_10316936 Ga0207657_103169362 127
240 3300025919 Ga0207657_10801790 Ga0207657_108017901 127
241 3300025920 Ga0207649_10593321 Ga0207649_105933212 127
242 3300025921 Ga0207652_10000276 Ga0207652_1000027639 127
243 3300025921 Ga0207652_10000366 Ga0207652_1000036642 127
244 3300025921 Ga0207652_10015015 Ga0207652_100150152 127
245 3300025921 Ga0207652_10178946 Ga0207652_101789462 127
246 3300025925 Ga0207650_10159714 Ga0207650_101597141 127
247 3300025931 Ga0207644_10002675 Ga0207644_100026757 127
248 3300025932 Ga0207690_10018020 Ga0207690_100180202 127
249 3300025932 Ga0207690_10068888 Ga0207690_100688882 127
250 3300025932 Ga0207690_10109020 Ga0207690_101090201 127
251 3300025932 Ga0207690_10564225 Ga0207690_105642252 127
252 3300025934 Ga0207686_10621820 Ga0207686_106218202 127
253 3300025941 Ga0207711_10429186 Ga0207711_104291862 127
254 3300025944 Ga0207661_10301811 Ga0207661_103018112 127
255 3300025949 Ga0207667_10005069 Ga0207667_100050693 127
256 3300025949 Ga0207667_10074466 Ga0207667_100744663 127
257 3300025949 Ga0207667_10344982 Ga0207667_103449822 127
258 3300025949 Ga0207667_10437000 Ga0207667_104370002 127
259 3300025949 Ga0207667_10873009 Ga0207667_108730091 127
260 3300025949 Ga0207667_11603123 Ga0207667_116031231 127
261 3300025960 Ga0207651_10300953 Ga0207651_103009532 127
262 3300025961 Ga0207712_10007124 Ga0207712_100071243 127
263 3300025961 Ga0207712_10007359 Ga0207712_100073592 127
264 3300025981 Ga0207640_10443515 Ga0207640_104435152 127
265 3300025981 Ga0207640_10548617 Ga0207640_105486172 127
266 3300025981 Ga0207640_10985980 Ga0207640_109859801 127
267 3300025986 Ga0207658_10811752 Ga0207658_108117521 127
268 3300026023 Ga0207677_10112150 Ga0207677_101121502 127
269 3300026023 Ga0207677_10908521 Ga0207677_109085212 127
270 3300026041 Ga0207639_10021822 Ga0207639_100218222 127
271 3300026041 Ga0207639_10071439 Ga0207639_100714392 127
272 3300026041 Ga0207639_10123576 Ga0207639_101235762 127
273 3300026041 Ga0207639_10394083 Ga0207639_103940831 127
274 3300026067 Ga0207678_10003224 Ga0207678_100032244 127
275 3300026067 Ga0207678_11116929 Ga0207678_111169291 127
276 3300026078 Ga0207702_10228658 Ga0207702_102286582 127
277 3300026078 Ga0207702_10281723 Ga0207702_102817231 127
278 3300026089 Ga0207648_10029234 Ga0207648_100292343 127
279 3300026089 Ga0207648_10082299 Ga0207648_100822992 127
280 3300026089 Ga0207648_10791442 Ga0207648_107914422 127
281 3300026095 Ga0207676_10083672 Ga0207676_100836722 127
282 3300026116 Ga0207674_10128623 Ga0207674_101286231 127
283 3300026116 Ga0207674_10659780 Ga0207674_106597801 127
284 3300026116 Ga0207674_10939736 Ga0207674_109397361 127
285 3300026116 Ga0207674_11091003 Ga0207674_110910031 127
286 3300026142 Ga0207698_10002709 Ga0207698_100027097 127
287 3300026142 Ga0207698_10295954 Ga0207698_102959542 127
288 3300028379 Ga0268266_10000024 Ga0268266_10000024168 127
289 3300028380 Ga0268265_10539086 Ga0268265_105390862 127
290 3300028381 Ga0268264_10000109 Ga0268264_10000109155 127
291 3300028381 Ga0268264_10038603 Ga0268264_100386033 127
292 3300028381 Ga0268264_11842957 Ga0268264_118429571 127
293 3300028794 Ga0307515_10000002 Ga0307515_10000002310 127
294 3300031456 Ga0307513_10566548 Ga0307513_105665481 127
295 3300031595 Ga0265313_10121902 Ga0265313_101219022 127
296 3300032004 Ga0307414_10214190 Ga0307414_102141901 127
297 3300032126 Ga0307415_101412614 Ga0307415_1014126141 127
298 3300037312 Ga0395899_0004174 Ga0395899_0004174_2972_3355 127
299 3300037312 Ga0395899_0006130 Ga0395899_0006130_1877_2260 127
300 3300037312 Ga0395899_0019245 Ga0395899_0019245_1255_1641 127
301 3300037312 Ga0395899_0021641 Ga0395899_0021641_45_431 127
302 3300037312 Ga0395899_0059475 Ga0395899_0059475_632_1015 127
303 3300037418 Ga0395900_0003729 Ga0395900_0003729_10176_10559 127
304 3300037418 Ga0395900_0007210 Ga0395900_0007210_9434_9817 127
305 3300037418 Ga0395900_0080346 Ga0395900_0080346_1875_2261 127
306 3300037418 Ga0395900_0320791 Ga0395900_0320791_1095_1481 127
307 3300037418 Ga0395900_0337024 Ga0395900_0337024_380_763 127
308 3300037418 Ga0395900_0416152 Ga0395900_0416152_387_770 127
309 3300037418 Ga0395900_0583722 Ga0395900_0583722_537_923 127
310 3300037466 Ga0395898_0005317 Ga0395898_0005317_7741_8124 127
311 3300037466 Ga0395898_0031110 Ga0395898_0031110_3115_3501 127
312 3300037466 Ga0395898_0047143 Ga0395898_0047143_828_1214 127
313 3300037466 Ga0395898_0057011 Ga0395898_0057011_953_1339 127
314 3300037466 Ga0395898_0276516 Ga0395898_0276516_647_1030 127
315 3300037466 Ga0395898_0514963 Ga0395898_0514963_31_414 127
316 3300037471 Ga0395905_0515593 Ga0395905_0515593_646_1032 127
317 3300037471 Ga0395905_0615087 Ga0395905_0615087_235_618 127
318 3300038443 Ga0395901_0013165 Ga0395901_0013165_2001_2387 127
319 3300038443 Ga0395901_0029496 Ga0395901_0029496_2181_2567 127
320 3300038443 Ga0395901_0064598 Ga0395901_0064598_1035_1418 127
321 3300038443 Ga0395901_0264252 Ga0395901_0264252_622_1005 127
322 3300038443 Ga0395901_0309832 Ga0395901_0309832_140_526 127
323 3300041452 Ga0451793_1686764 Ga0451793_1686764_135_518 127
324 3300044712 Ga0453684_0024889 Ga0453684_0024889_3511_3909 127
325 3300044712 Ga0453684_2155937 Ga0453684_2155937_10_393 127
326 3300045051 Ga0451576_0730585 Ga0451576_0730585_339_737 127
327 3300046524 Ga0495648_0010591 Ga0495648_0010591_5969_6415 127
328 3300046542 Ga0495597_0071948 Ga0495597_0071948_231_617 127
329 3300046616 Ga0495668_0000449 Ga0495668_0000449_22446_22838 127
330 3300047320 Ga0495672_0015254 Ga0495672_0015254_1960_2343 127
331 3300047443 Ga0495687_000014 Ga0495687_000014_183275_183661 127
332 3300047472 Ga0495686_0000335 Ga0495686_0000335_22050_22442 127
333 3300048903 Ga0496100_0057821 Ga0496100_0057821_1278_1661 127
334 3300048907 Ga0496104_0187731 Ga0496104_0187731_1529_1912 127
335 3300048908 Ga0496105_1294868 Ga0496105_1294868_51_446 127
336 3300048909 Ga0496106_0644200 Ga0496106_0644200_31_414 127
337 3300048912 Ga0496109_0318425 Ga0496109_0318425_451_846 127
338 3300048913 Ga0496110_0865316 Ga0496110_0865316_55_438 127
339 3300049570 Ga0501033_0069990 Ga0501033_0069990_1970_2353 127
340 3300049571 Ga0501034_0000399 Ga0501034_0000399_33786_34250 127
341 3300049571 Ga0501034_0140144 Ga0501034_0140144_1255_1638 127
342 3300049571 Ga0501034_0466183 Ga0501034_0466183_196_582 127
343 3300049571 Ga0501034_0994311 Ga0501034_0994311_311_694 127
344 3300049573 Ga0501037_0211138 Ga0501037_0211138_69_455 127
345 3300049579 Ga0501043_0271088 Ga0501043_0271088_546_932 127
346 3300049579 Ga0501043_0325615 Ga0501043_0325615_151_534 127
347 3300049579 Ga0501043_0815596 Ga0501043_0815596_245_634 127
348 3300049581 Ga0501047_0273541 Ga0501047_0273541_60_446 127
349 3300049680 Ga0501250_012896 Ga0501250_012896_21_413 127
350 3300049681 Ga0501251_044618 Ga0501251_044618_259_651 127
351 3300049766 Ga0501269_005546 Ga0501269_005546_334_726 127
352 3300049822 Ga0501035_0748144 Ga0501035_0748144_141_527 127
353 3300049822 Ga0501035_1527816 Ga0501035_1527816_106_489 127
354 3300049823 Ga0501044_0123492 Ga0501044_0123492_1191_1577 127
355 3300050507 nmdc:mga05p37_282129_c1 nmdc:mga05p37_282129_c1_1281_1685 127
356 3300050510 nmdc:mga06r32_139827_c1 nmdc:mga06r32_139827_c1_1206_1610 127
357 3300053088 Ga0500644_0084331 Ga0500644_0084331_625_1071 127
358 3300053092 Ga0500583_0034113 Ga0500583_0034113_198_644 127
359 3300053096 Ga0500641_0286401 Ga0500641_0286401_46_438 127
360 3300053104 Ga0500556_0003830 Ga0500556_0003830_3109_3501 127
361 3300053108 Ga0500562_153480 Ga0500562_153480_158_550 127
362 3300053118 Ga0500594_0002336 Ga0500594_0002336_3124_3516 127
363 3300053130 Ga0500642_0090017 Ga0500642_0090017_731_1123 127
364 3300053153 Ga0500616_0001609 Ga0500616_0001609_1596_1988 127
365 3300053158 Ga0500627_0016136 Ga0500627_0016136_1856_2248 127
366 2162886007 SwRhRL2b_contig_1887178 SwRhRL2b_0407.00006010 128
367 3300005289 Ga0065704_10070136 Ga0065704_10070136355 128
368 3300005338 Ga0068868_102182249 Ga0068868_1021822491 128
369 3300026023 Ga0207677_11093784 Ga0207677_110937841 128
370 3300053116 Ga0500592_029084 Ga0500592_029084_379_765 128

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00856

SET

SET domain

41

139

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ww0-assembly1.cif.gz_B crystal structure of set7, a novel histone methyltransferase in schizossacharomyces pombe 0.878 2 111
3kma-assembly1.cif.gz_B crystal structure of vset under condition a 0.8593 1 113
3kma-assembly1.cif.gz_B crystal structure of vset under condition a 0.8519 1 113
2r3a-assembly1.cif.gz_A methyltransferase domain of human suppressor of variegation 3-9 homolog 2 0.8282 6 111
5jjy-assembly1.cif.gz_A crystal structure of setd2 bound to histone h3.3 k36m peptide 0.824 6 113
ID Description Score Start End Superfamily
3kmtA01 Mainly Beta;Beta Complex;Beta-clip-like;SET domain 0.8516 1 110 2.170.270.10
af_Q9Y7Q6_6_127_2.170.270.10 Mainly Beta;Beta Complex;Beta-clip-like;SET domain 0.8488 5 126 2.170.270.10
3kmtA01 Mainly Beta;Beta Complex;Beta-clip-like;SET domain 0.8441 1 110 2.170.270.10
af_A4IAE8_9_355_3.90.1410.10 Alpha Beta;Alpha-Beta Complex;set domain protein methyltransferase, domain 1;set domain protein methyltransferase, domain 1 0.8292 1 34 3.90.1410.10
2r3aA00 Mainly Beta;Beta Complex;Beta-clip-like;SET domain 0.8282 6 111 2.170.270.10
ID Description Score Start End GO Terms
AF-R7U6Y9-F1-model_v4 SET domain-containing protein 0.9184 6 111 GO:0062122
AF-A0A2L0F6Z6-F1-model_v4 SET domain-containing protein 0.9112 3 113 GO:0062122
AF-A0A3M1J698-F1-model_v4 SET domain-containing protein-lysine N-methyltransferase 0.9103 2 115 GO:0032259
GO:0062122
AF-R9AFE9-F1-model_v4 SET domain-containing protein 7 0.8999 7 115 GO:0062122
AF-A0A841LD79-F1-model_v4 SET domain-containing protein 0.8993 6 116 GO:0062122

Feature Viewer

pLDDT pTM Quality
84.7 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map