F425539

General Info

Members Datasets Scaffolds Average Seq Length
370 182 740 183

Family's Representative Sequence

Representative Sequence 3300048908|Ga0496105_0511366|Ga0496105_0511366_16_645
Length 209
Sequence LIDCCAHHPTIHYPITQFPDDQIRMRVIAGTLKGRRLKAPTWDGVRPTSDKLRETLFNILAPRIAGARFLDGYAGTGAVGIEALSRGARAVTFVEHDRRAETLIAENLAHCGVENGYAIIRSTVARAIDQLDAAAFGPYELFDIVWFDPPYDEQPDAVLEAAGVLIAPGGLLVLEHARRRQVPEAAGRLMRVRQVASGDSALAFYELKN

Samples

Sample ID Description Type Environment
1 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
122 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
123 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
124 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
125 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
126 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
127 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
128 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
130 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
131 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
132 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
133 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
134 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
135 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
136 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
137 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
138 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
139 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
140 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
141 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
142 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
143 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
144 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
145 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
146 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
147 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
148 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
149 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
150 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
151 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
152 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
153 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
154 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
159 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
160 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
161 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
162 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
163 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
164 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
165 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
166 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
167 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
168 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
169 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
170 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
171 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
172 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
173 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
174 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
175 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
176 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
177 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
178 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
179 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
180 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
181 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
182 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.54
Nodule 0
Rhizoplane 2.16
Rhizosphere 97.3
Stem 0
Stem Tuber 0
Unclassified 6.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496105_0511366 3300048908 Bacteria 942
2 SwRhRL3b_contig_2108870 2162886006 Unclassified 987
3 Ga0065712_10231817 3300005290 Bacteria 1009
4 Ga0065715_10004099 3300005293 Bacteria 4789
5 Ga0065707_10000711 3300005295 Bacteria 16357
6 Ga0070676_10105820 3300005328 Bacteria 1745
7 Ga0070676_10811990 3300005328 Bacteria 691
8 Ga0070690_100574123 3300005330 Bacteria 853
9 Ga0070670_101211406 3300005331 Bacteria 690
10 Ga0068869_100230127 3300005334 Bacteria 1472
11 Ga0068869_100593857 3300005334 Bacteria 934
12 Ga0070666_10143974 3300005335 Bacteria 1660
13 Ga0068868_100057624 3300005338 Bacteria 3069
14 Ga0068868_100730220 3300005338 Bacteria 888
15 Ga0068868_100913371 3300005338 Bacteria 798
16 Ga0068868_101024912 3300005338 Bacteria 756
17 Ga0070689_100098476 3300005340 Bacteria 2313
18 Ga0070689_100158750 3300005340 Bacteria 1827
19 Ga0070689_100554058 3300005340 Bacteria 991
20 Ga0070668_101351722 3300005347 Unclassified 649
21 Ga0070669_100080011 3300005353 Bacteria 2431
22 Ga0070669_100087825 3300005353 Bacteria 2325
23 Ga0070675_100000134 3300005354 Bacteria 44325
24 Ga0070675_100004521 3300005354 Bacteria 10620
25 Ga0070675_100024928 3300005354 Bacteria 4794
26 Ga0070675_100949204 3300005354 Bacteria 789
27 Ga0070674_100178252 3300005356 Bacteria 1625
28 Ga0070673_100237720 3300005364 Bacteria 1582
29 Ga0070673_101384969 3300005364 Unclassified 662
30 Ga0070688_100108666 3300005365 Bacteria 1840
31 Ga0070688_100273513 3300005365 Bacteria 1211
32 Ga0070703_10000048 3300005406 Bacteria 58117
33 Ga0070703_10076304 3300005406 Bacteria 1131
34 Ga0070705_100146937 3300005440 Bacteria 1559
35 Ga0070705_100458559 3300005440 Bacteria 958
36 Ga0070700_100040574 3300005441 Bacteria 2850
37 Ga0070700_100225447 3300005441 Bacteria 1330
38 Ga0070700_100369032 3300005441 Bacteria 1070
39 Ga0070694_100057475 3300005444 Bacteria 2645
40 Ga0070694_100145593 3300005444 Bacteria 1725
41 Ga0070694_100781272 3300005444 Unclassified 782
42 Ga0070708_100061100 3300005445 Bacteria 3365
43 Ga0070708_100419519 3300005445 Bacteria 1262
44 Ga0070678_100792817 3300005456 Bacteria 860
45 Ga0070662_100064161 3300005457 Bacteria 2689
46 Ga0070662_100456564 3300005457 Bacteria 1061
47 Ga0068867_100096719 3300005459 Bacteria 2249
48 Ga0068867_100457418 3300005459 Unclassified 1089
49 Ga0068867_100472023 3300005459 Bacteria 1073
50 Ga0070706_100402798 3300005467 Bacteria 1274
51 Ga0070706_100518437 3300005467 Bacteria 1109
52 Ga0070707_100099400 3300005468 Bacteria 2818
53 Ga0070707_100212115 3300005468 Bacteria 1887
54 Ga0070707_100356023 3300005468 Bacteria 1422
55 Ga0070698_100074452 3300005471 Bacteria 3401
56 Ga0070698_100085385 3300005471 Bacteria 3144
57 Ga0070698_100318899 3300005471 Bacteria 1485
58 Ga0070698_100340574 3300005471 Bacteria 1431
59 Ga0070698_100374209 3300005471 Bacteria 1357
60 Ga0070698_100397217 3300005471 Bacteria 1312
61 Ga0070698_100563245 3300005471 Bacteria 1079
62 Ga0070698_100811085 3300005471 Bacteria 880
63 Ga0070699_100013766 3300005518 Bacteria 6959
64 Ga0070699_100198257 3300005518 Bacteria 1785
65 Ga0070699_100594480 3300005518 Bacteria 1009
66 Ga0070679_100730546 3300005530 Bacteria 933
67 Ga0070684_100707169 3300005535 Bacteria 939
68 Ga0070684_101375942 3300005535 Bacteria 664
69 Ga0070697_100109471 3300005536 Bacteria 2301
70 Ga0070697_100326706 3300005536 Bacteria 1322
71 Ga0070672_100047033 3300005543 Bacteria 3346
72 Ga0070672_100285132 3300005543 Bacteria 1397
73 Ga0070695_100002536 3300005545 Bacteria 10547
74 Ga0070696_100026270 3300005546 Bacteria 3961
75 Ga0070696_100145315 3300005546 Bacteria 1737
76 Ga0070696_100234128 3300005546 Bacteria 1383
77 Ga0070696_100618327 3300005546 Unclassified 875
78 Ga0070696_101102975 3300005546 Bacteria 667
79 Ga0070665_100066657 3300005548 Bacteria 3611
80 Ga0070704_101118363 3300005549 Unclassified 716
81 Ga0070664_100474603 3300005564 Bacteria 1151
82 Ga0070664_101047838 3300005564 Bacteria 767
83 Ga0070664_101444991 3300005564 Bacteria 650
84 Ga0068854_100135634 3300005578 Bacteria 1884
85 Ga0068859_100007769 3300005617 Bacteria 10889
86 Ga0068859_100029021 3300005617 Bacteria 5551
87 Ga0068859_100088847 3300005617 Bacteria 3140
88 Ga0068859_100791418 3300005617 Bacteria 1036
89 Ga0068859_100980588 3300005617 Bacteria 928
90 Ga0068859_101175845 3300005617 Bacteria 844
91 Ga0068864_100303965 3300005618 Bacteria 1494
92 Ga0068864_100733065 3300005618 Bacteria 967
93 Ga0068851_10193564 3300005834 Bacteria 1131
94 Ga0068863_100324518 3300005841 Unclassified 1496
95 Ga0068858_100021389 3300005842 Bacteria 6043
96 Ga0068858_100050154 3300005842 Bacteria 3863
97 Ga0068858_100114753 3300005842 Bacteria 2517
98 Ga0068858_100335905 3300005842 Bacteria 1445
99 Ga0068860_100339864 3300005843 Bacteria 1476
100 Ga0068860_100375475 3300005843 Bacteria 1403
101 Ga0068860_100430209 3300005843 Bacteria 1310
102 Ga0068860_100845754 3300005843 Bacteria 930
103 Ga0068862_100091588 3300005844 Bacteria 2648
104 Ga0068862_100167586 3300005844 Bacteria 1964
105 Ga0068862_100183276 3300005844 Bacteria 1880
106 Ga0068862_100504280 3300005844 Bacteria 1149
107 Ga0068862_100535767 3300005844 Bacteria 1116
108 Ga0068862_101285019 3300005844 Unclassified 732
109 Ga0081455_10300964 3300005937 Bacteria 1151
110 Ga0070712_100227667 3300006175 Bacteria 1479
111 Ga0075367_10288105 3300006178 Bacteria 1033
112 Ga0097621_100003857 3300006237 Bacteria 10384
113 Ga0097621_100345294 3300006237 Unclassified 1322
114 Ga0068871_100006524 3300006358 Bacteria 8263
115 Ga0075428_100000010 3300006844 Bacteria 213631
116 Ga0075430_100052196 3300006846 Bacteria 3444
117 Ga0075430_100167975 3300006846 Bacteria 1825
118 Ga0075431_100020061 3300006847 Bacteria 6826
119 Ga0075431_100140965 3300006847 Bacteria 2485
120 Ga0075433_10046636 3300006852 Bacteria 3769
121 Ga0075433_10148689 3300006852 Bacteria 2083
122 Ga0075433_10386389 3300006852 Bacteria 1235
123 Ga0075433_10869348 3300006852 Bacteria 787
124 Ga0075434_100000442 3300006871 Bacteria 30797
125 Ga0075434_100000573 3300006871 Bacteria 28351
126 Ga0075434_100024773 3300006871 Bacteria 5866
127 Ga0075434_100042591 3300006871 Bacteria 4501
128 Ga0075434_100075393 3300006871 Bacteria 3366
129 Ga0075434_100259130 3300006871 Bacteria 1758
130 Ga0075434_100370548 3300006871 Bacteria 1453
131 Ga0075434_100515647 3300006871 Bacteria 1216
132 Ga0075434_100950740 3300006871 Bacteria 874
133 Ga0075429_100132644 3300006880 Bacteria 2179
134 Ga0075429_100136238 3300006880 Bacteria 2149
135 Ga0075429_100160918 3300006880 Bacteria 1966
136 Ga0075429_100206522 3300006880 Bacteria 1721
137 Ga0075429_100405482 3300006880 Unclassified 1194
138 Ga0075429_100667487 3300006880 Bacteria 911
139 Ga0075429_101211971 3300006880 Bacteria 659
140 Ga0068865_100042289 3300006881 Bacteria 3107
141 Ga0068865_100333043 3300006881 Bacteria 1224
142 Ga0075436_100013933 3300006914 Bacteria 5504
143 Ga0075436_100028087 3300006914 Bacteria 3872
144 Ga0075436_100173378 3300006914 Bacteria 1523
145 Ga0075436_100314699 3300006914 Bacteria 1124
146 Ga0075436_100478649 3300006914 Bacteria 909
147 Ga0097620_100007769 3300006931 Bacteria 10889
148 Ga0097620_100029020 3300006931 Bacteria 5551
149 Ga0097620_100088841 3300006931 Bacteria 3140
150 Ga0097620_100791524 3300006931 Bacteria 1036
151 Ga0097620_100980624 3300006931 Bacteria 928
152 Ga0097620_101175839 3300006931 Bacteria 844
153 Ga0075435_100000293 3300007076 Bacteria 30982
154 Ga0075435_100001872 3300007076 Bacteria 13688
155 Ga0075435_100051016 3300007076 Bacteria 3331
156 Ga0075435_100151310 3300007076 Bacteria 1951
157 Ga0075435_100153605 3300007076 Bacteria 1936
158 Ga0111539_10000001 3300009094 Bacteria 1035431
159 Ga0111539_10006183 3300009094 Bacteria 15445
160 Ga0111539_10036156 3300009094 Bacteria 5974
161 Ga0111539_10082050 3300009094 Bacteria 3792
162 Ga0111539_10655216 3300009094 Bacteria 1223
163 Ga0111539_11092224 3300009094 Unclassified 927
164 Ga0111539_11177485 3300009094 Bacteria 890
165 Ga0105245_10041567 3300009098 Bacteria 4098
166 Ga0105245_10455647 3300009098 Bacteria 1288
167 Ga0105247_10010871 3300009101 Bacteria 5499
168 Ga0114129_10001269 3300009147 Bacteria 33716
169 Ga0114129_10002338 3300009147 Bacteria 26309
170 Ga0114129_10008349 3300009147 Bacteria 14765
171 Ga0114129_10097222 3300009147 Bacteria 4076
172 Ga0114129_10161383 3300009147 Bacteria 3061
173 Ga0114129_10460514 3300009147 Bacteria 1666
174 Ga0114129_12109680 3300009147 Bacteria 680
175 Ga0105243_10000242 3300009148 Bacteria 62471
176 Ga0105243_10475846 3300009148 Unclassified 1178
177 Ga0105242_10000092 3300009176 Bacteria 62471
178 Ga0105242_10004931 3300009176 Bacteria 10334
179 Ga0105242_10007448 3300009176 Bacteria 8428
180 Ga0105248_10002926 3300009177 Bacteria 18953
181 Ga0105248_10045989 3300009177 Bacteria 4893
182 Ga0105248_10057537 3300009177 Bacteria 4365
183 Ga0105248_10907066 3300009177 Unclassified 995
184 Ga0105249_10219059 3300009553 Bacteria 1872
185 Ga0105249_11444050 3300009553 Unclassified 760
186 Ga0105239_10073937 3300010375 Bacteria 3747
187 Ga0105246_10521894 3300011119 Bacteria 1012
188 Ga0157374_10288075 3300013296 Bacteria 1622
189 Ga0163162_10168132 3300013306 Bacteria 2317
190 Ga0163162_10219132 3300013306 Bacteria 2033
191 Ga0157375_10125027 3300013308 Bacteria 2686
192 Ga0157375_10398949 3300013308 Bacteria 1542
193 Ga0157375_10983687 3300013308 Bacteria 984
194 Ga0163163_10010034 3300014325 Bacteria 8496
195 Ga0157380_10136005 3300014326 Bacteria 2104
196 Ga0157380_10145526 3300014326 Bacteria 2042
197 Ga0157380_11571907 3300014326 Bacteria 712
198 Ga0157380_11626753 3300014326 Bacteria 702
199 Ga0157377_10054026 3300014745 Bacteria 2273
200 Ga0157377_10097894 3300014745 Bacteria 1743
201 Ga0157379_10017769 3300014968 Bacteria 6265
202 Ga0157379_10100223 3300014968 Bacteria 2600
203 Ga0157379_10558102 3300014968 Unclassified 1066
204 Ga0157376_10025116 3300014969 Bacteria 4689
205 Ga0157376_10064134 3300014969 Bacteria 3097
206 Ga0157376_10203819 3300014969 Bacteria 1822
207 Ga0207653_10000574 3300025885 Bacteria 13189
208 Ga0207710_10004642 3300025900 Bacteria 5964
209 Ga0207680_10139182 3300025903 Bacteria 1608
210 Ga0207680_10359658 3300025903 Bacteria 1023
211 Ga0207645_10084930 3300025907 Bacteria 2032
212 Ga0207643_10223131 3300025908 Bacteria 1154
213 Ga0207684_10306559 3300025910 Bacteria 1369
214 Ga0207693_10189438 3300025915 Bacteria 1619
215 Ga0207646_10097100 3300025922 Bacteria 2640
216 Ga0207646_10311348 3300025922 Bacteria 1423
217 Ga0207659_10011934 3300025926 Bacteria 5503
218 Ga0207659_10056864 3300025926 Bacteria 2803
219 Ga0207659_10299936 3300025926 Bacteria 1319
220 Ga0207687_10109688 3300025927 Bacteria 2045
221 Ga0207644_10094733 3300025931 Bacteria 2231
222 Ga0207706_10044428 3300025933 Bacteria 3937
223 Ga0207706_10382050 3300025933 Bacteria 1222
224 Ga0207706_10403068 3300025933 Bacteria 1186
225 Ga0207686_10003880 3300025934 Bacteria 8021
226 Ga0207686_10092009 3300025934 Bacteria 2004
227 Ga0207709_10543054 3300025935 Unclassified 913
228 Ga0207670_10076954 3300025936 Bacteria 2323
229 Ga0207670_10130459 3300025936 Bacteria 1841
230 Ga0207670_10414542 3300025936 Bacteria 1079
231 Ga0207669_10734415 3300025937 Bacteria 814
232 Ga0207704_10012189 3300025938 Bacteria 4260
233 Ga0207704_10306335 3300025938 Bacteria 1219
234 Ga0207704_10775456 3300025938 Bacteria 799
235 Ga0207665_10469704 3300025939 Bacteria 968
236 Ga0207665_11000921 3300025939 Unclassified 665
237 Ga0207691_10279983 3300025940 Bacteria 1435
238 Ga0207711_10016601 3300025941 Bacteria 6114
239 Ga0207711_10119232 3300025941 Bacteria 2354
240 Ga0207711_10232791 3300025941 Bacteria 1688
241 Ga0207689_10156609 3300025942 Bacteria 1878
242 Ga0207679_10177072 3300025945 Bacteria 1761
243 Ga0207667_10540606 3300025949 Bacteria 1179
244 Ga0207651_10202805 3300025960 Bacteria 1591
245 Ga0207651_10635941 3300025960 Bacteria 936
246 Ga0207712_10202195 3300025961 Bacteria 1576
247 Ga0207668_10145055 3300025972 Bacteria 1831
248 Ga0207668_10289194 3300025972 Bacteria 1347
249 Ga0207640_10838711 3300025981 Bacteria 799
250 Ga0207658_10350850 3300025986 Bacteria 1285
251 Ga0207677_10044621 3300026023 Bacteria 2955
252 Ga0207677_10221381 3300026023 Bacteria 1518
253 Ga0207703_10022189 3300026035 Bacteria 4977
254 Ga0207703_10023896 3300026035 Bacteria 4806
255 Ga0207708_10056354 3300026075 Bacteria 2998
256 Ga0207708_10079645 3300026075 Bacteria 2517
257 Ga0207641_10643587 3300026088 Bacteria 1041
258 Ga0207648_10019336 3300026089 Bacteria 6148
259 Ga0207648_10127210 3300026089 Bacteria 2241
260 Ga0207676_10098066 3300026095 Bacteria 2422
261 Ga0207676_11242985 3300026095 Bacteria 739
262 Ga0207675_100130733 3300026118 Bacteria 2381
263 Ga0207675_100980343 3300026118 Bacteria 863
264 Ga0207683_10231999 3300026121 Bacteria 1683
265 Ga0207428_10000002 3300027907 Bacteria 854851
266 Ga0207428_10013016 3300027907 Bacteria 7288
267 Ga0207428_10072541 3300027907 Bacteria 2702
268 Ga0268266_10002323 3300028379 Bacteria 20612
269 Ga0268266_10014977 3300028379 Bacteria 6656
270 Ga0268265_10351733 3300028380 Bacteria 1346
271 Ga0268265_10968515 3300028380 Bacteria 839
272 Ga0268265_11016465 3300028380 Bacteria 819
273 Ga0268265_11074577 3300028380 Bacteria 798
274 Ga0268264_10521310 3300028381 Bacteria 1162
275 Ga0268264_10674137 3300028381 Bacteria 1025
276 Ga0268264_10834545 3300028381 Bacteria 922
277 Ga0307408_100442832 3300031548 Bacteria 1125
278 Ga0307416_100074363 3300032002 Bacteria 2838
279 Ga0307411_10234680 3300032005 Bacteria 1432
280 Ga0373936_0102985 3300035113 Bacteria 1206
281 Ga0373939_0194098 3300035114 Bacteria 764
282 Ga0373941_0023922 3300035115 Bacteria 1749
283 Ga0373954_0239478 3300035118 Unclassified 893
284 Ga0373937_0268923 3300036401 Bacteria 1609
285 Ga0373937_0281089 3300036401 Bacteria 1572
286 Ga0373925_0704257 3300037068 Bacteria 833
287 Ga0439439_0021804 3300041406 Unclassified 1597
288 Ga0439453_0046196 3300041408 Bacteria 868
289 Ga0439435_0054364 3300042436 Bacteria 1153
290 Ga0439440_0109507 3300042993 Bacteria 759
291 Ga0453683_0658598 3300044673 Bacteria 685
292 Ga0466957_0417438 3300044842 Bacteria 920
293 Ga0451576_1027405 3300045051 Bacteria 864
294 Ga0495603_0126947 3300046455 Bacteria 1486
295 Ga0495582_0053638 3300046473 Bacteria 2224
296 Ga0495639_0045545 3300046475 Bacteria 1985
297 Ga0495618_0514104 3300046514 Bacteria 721
298 Ga0495640_0058826 3300046533 Bacteria 2620
299 Ga0495586_0165261 3300046535 Bacteria 1249
300 Ga0495621_0019654 3300046539 Bacteria 2208
301 Ga0495633_0127060 3300046558 Bacteria 1180
302 Ga0495658_0145803 3300046683 Bacteria 1451
303 Ga0495684_0084025 3300047471 Bacteria 2415
304 Ga0496101_0720098 3300048904 Bacteria 788
305 Ga0496104_0218360 3300048907 Bacteria 1819
306 Ga0496108_0011048 3300048911 Bacteria 7332
307 Ga0496109_0144299 3300048912 Bacteria 2227
308 Ga0496110_0644209 3300048913 Unclassified 959
309 Ga0496112_0086542 3300048915 Bacteria 3100
310 Ga0496113_0349466 3300048916 Bacteria 1186
311 Ga0501036_0176149 3300049572 Bacteria 1801
312 Ga0501039_0080558 3300049575 Bacteria 2534
313 Ga0501040_0058593 3300049576 Bacteria 2645
314 Ga0501042_0187327 3300049578 Bacteria 1493
315 Ga0501068_0355654 3300049584 Bacteria 942
316 Ga0501073_0635740 3300049589 Unclassified 737
317 Ga0501075_0020162 3300049591 Bacteria 4845
318 Ga0501076_0104548 3300049592 Bacteria 2285
319 Ga0501079_0085503 3300049741 Bacteria 2441
320 Ga0501081_0172502 3300049743 Bacteria 1562
321 Ga0501083_0123495 3300049744 Bacteria 1697
322 Ga0501045_0033959 3300049824 Bacteria 3701
323 Ga0501045_0650036 3300049824 Bacteria 779
324 nmdc:mga06z11_400096_c1 3300050494 Bacteria 826
325 nmdc:mga05p37_140787_c1 3300050507 Bacteria 2956
326 nmdc:mga05p37_3502_c1 3300050507 Bacteria 18353
327 nmdc:mga05p37_366519_c1 3300050507 Bacteria 1692
328 nmdc:mga05p37_45445_c1 3300050507 Bacteria 5401
329 nmdc:mga09592_129689_c1 3300050508 Bacteria 2169
330 nmdc:mga09592_228364_c1 3300050508 Bacteria 1612
331 nmdc:mga09592_389359_c1 3300050508 Bacteria 1205
332 nmdc:mga09592_468129_c1 3300050508 Bacteria 1087
333 nmdc:mga0qj67_152435_c1 3300050509 Bacteria 1875
334 nmdc:mga0qj67_767103_c1 3300050509 Bacteria 765
335 nmdc:mga0qj67_978005_c1 3300050509 Bacteria 665
336 nmdc:mga06r32_139277_c1 3300050510 Bacteria 2402
337 nmdc:mga08y16_1491861_c1 3300050511 Bacteria 637
338 nmdc:mga08y16_19902_c1 3300050511 Bacteria 7079
339 nmdc:mga08y16_3_c1 3300050511 Bacteria 936907
340 nmdc:mga08y16_827729_c1 3300050511 Unclassified 917
341 nmdc:mga0n895_155027_c1 3300050512 Bacteria 2321
342 nmdc:mga0n895_20333_c1 3300050512 Bacteria 6189
343 nmdc:mga0n895_206331_c1 3300050512 Bacteria 1996
344 nmdc:mga0n895_212414_c1 3300050512 Bacteria 1965
345 nmdc:mga0n895_21_c1 3300050512 Bacteria 93738
346 nmdc:mga0n895_290514_c1 3300050512 Bacteria 1658
347 nmdc:mga0rr50_165711_c1 3300050513 Bacteria 1797
348 nmdc:mga0rr50_2147_c1 3300050513 Bacteria 11026
349 nmdc:mga0rr50_455321_c1 3300050513 Bacteria 1085
350 nmdc:mga0rr50_51233_c1 3300050513 Bacteria 3062
351 nmdc:mga0rr50_741031_c1 3300050513 Unclassified 839
352 nmdc:mga0rr50_8_c1 3300050513 Bacteria 271775
353 nmdc:mga0rr50_97534_c1 3300050513 Bacteria 2302
354 nmdc:mga08x19_21369_c1 3300050514 Bacteria 3995
355 nmdc:mga08x19_333_c1 3300050514 Bacteria 34084
356 nmdc:mga08x19_437558_c1 3300050514 Bacteria 920
357 nmdc:mga08x19_485477_c1 3300050514 Bacteria 871
358 nmdc:mga08x19_9544_c1 3300050514 Bacteria 5809
359 nmdc:mga0a205_103832_c1 3300050515 Bacteria 2741
360 nmdc:mga0a205_247036_c1 3300050515 Bacteria 1664
361 nmdc:mga0a205_35671_c1 3300050515 Bacteria 4775
362 nmdc:mga0a205_3697_c1 3300050515 Bacteria 13689
363 nmdc:mga0a205_6659_c1 3300050515 Bacteria 10454
364 Ga0495601_0187772 3300053077 Bacteria 1351
365 Ga0495619_0106506 3300053085 Bacteria 1912
366 Ga0501084_1047839 3300054114 Bacteria 685
367 Ga0590071_007417 3300059421 Bacteria 2593
368 Ga0590074_001698 3300059423 Bacteria 3596
369 Ga0590075_000582 3300059424 Bacteria 9868
370 Ga0530510_0443130 3300061734 Bacteria 981
371 Ga0496105_0511366
372 SwRhRL3b_contig_2108870
373 Ga0065712_10231817
374 Ga0065715_10004099
375 Ga0065707_10000711
376 Ga0070676_10105820
377 Ga0070676_10811990
378 Ga0070690_100574123
379 Ga0070670_101211406
380 Ga0068869_100230127
381 Ga0068869_100593857
382 Ga0070666_10143974
383 Ga0068868_100057624
384 Ga0068868_100730220
385 Ga0068868_100913371
386 Ga0068868_101024912
387 Ga0070689_100098476
388 Ga0070689_100158750
389 Ga0070689_100554058
390 Ga0070668_101351722
391 Ga0070669_100080011
392 Ga0070669_100087825
393 Ga0070675_100000134
394 Ga0070675_100004521
395 Ga0070675_100024928
396 Ga0070675_100949204
397 Ga0070674_100178252
398 Ga0070673_100237720
399 Ga0070673_101384969
400 Ga0070688_100108666
401 Ga0070688_100273513
402 Ga0070703_10000048
403 Ga0070703_10076304
404 Ga0070705_100146937
405 Ga0070705_100458559
406 Ga0070700_100040574
407 Ga0070700_100225447
408 Ga0070700_100369032
409 Ga0070694_100057475
410 Ga0070694_100145593
411 Ga0070694_100781272
412 Ga0070708_100061100
413 Ga0070708_100419519
414 Ga0070678_100792817
415 Ga0070662_100064161
416 Ga0070662_100456564
417 Ga0068867_100096719
418 Ga0068867_100457418
419 Ga0068867_100472023
420 Ga0070706_100402798
421 Ga0070706_100518437
422 Ga0070707_100099400
423 Ga0070707_100212115
424 Ga0070707_100356023
425 Ga0070698_100074452
426 Ga0070698_100085385
427 Ga0070698_100318899
428 Ga0070698_100340574
429 Ga0070698_100374209
430 Ga0070698_100397217
431 Ga0070698_100563245
432 Ga0070698_100811085
433 Ga0070699_100013766
434 Ga0070699_100198257
435 Ga0070699_100594480
436 Ga0070679_100730546
437 Ga0070684_100707169
438 Ga0070684_101375942
439 Ga0070697_100109471
440 Ga0070697_100326706
441 Ga0070672_100047033
442 Ga0070672_100285132
443 Ga0070695_100002536
444 Ga0070696_100026270
445 Ga0070696_100145315
446 Ga0070696_100234128
447 Ga0070696_100618327
448 Ga0070696_101102975
449 Ga0070665_100066657
450 Ga0070704_101118363
451 Ga0070664_100474603
452 Ga0070664_101047838
453 Ga0070664_101444991
454 Ga0068854_100135634
455 Ga0068859_100007769
456 Ga0068859_100029021
457 Ga0068859_100088847
458 Ga0068859_100791418
459 Ga0068859_100980588
460 Ga0068859_101175845
461 Ga0068864_100303965
462 Ga0068864_100733065
463 Ga0068851_10193564
464 Ga0068863_100324518
465 Ga0068858_100021389
466 Ga0068858_100050154
467 Ga0068858_100114753
468 Ga0068858_100335905
469 Ga0068860_100339864
470 Ga0068860_100375475
471 Ga0068860_100430209
472 Ga0068860_100845754
473 Ga0068862_100091588
474 Ga0068862_100167586
475 Ga0068862_100183276
476 Ga0068862_100504280
477 Ga0068862_100535767
478 Ga0068862_101285019
479 Ga0081455_10300964
480 Ga0070712_100227667
481 Ga0075367_10288105
482 Ga0097621_100003857
483 Ga0097621_100345294
484 Ga0068871_100006524
485 Ga0075428_100000010
486 Ga0075430_100052196
487 Ga0075430_100167975
488 Ga0075431_100020061
489 Ga0075431_100140965
490 Ga0075433_10046636
491 Ga0075433_10148689
492 Ga0075433_10386389
493 Ga0075433_10869348
494 Ga0075434_100000442
495 Ga0075434_100000573
496 Ga0075434_100024773
497 Ga0075434_100042591
498 Ga0075434_100075393
499 Ga0075434_100259130
500 Ga0075434_100370548
501 Ga0075434_100515647
502 Ga0075434_100950740
503 Ga0075429_100132644
504 Ga0075429_100136238
505 Ga0075429_100160918
506 Ga0075429_100206522
507 Ga0075429_100405482
508 Ga0075429_100667487
509 Ga0075429_101211971
510 Ga0068865_100042289
511 Ga0068865_100333043
512 Ga0075436_100013933
513 Ga0075436_100028087
514 Ga0075436_100173378
515 Ga0075436_100314699
516 Ga0075436_100478649
517 Ga0097620_100007769
518 Ga0097620_100029020
519 Ga0097620_100088841
520 Ga0097620_100791524
521 Ga0097620_100980624
522 Ga0097620_101175839
523 Ga0075435_100000293
524 Ga0075435_100001872
525 Ga0075435_100051016
526 Ga0075435_100151310
527 Ga0075435_100153605
528 Ga0111539_10000001
529 Ga0111539_10006183
530 Ga0111539_10036156
531 Ga0111539_10082050
532 Ga0111539_10655216
533 Ga0111539_11092224
534 Ga0111539_11177485
535 Ga0105245_10041567
536 Ga0105245_10455647
537 Ga0105247_10010871
538 Ga0114129_10001269
539 Ga0114129_10002338
540 Ga0114129_10008349
541 Ga0114129_10097222
542 Ga0114129_10161383
543 Ga0114129_10460514
544 Ga0114129_12109680
545 Ga0105243_10000242
546 Ga0105243_10475846
547 Ga0105242_10000092
548 Ga0105242_10004931
549 Ga0105242_10007448
550 Ga0105248_10002926
551 Ga0105248_10045989
552 Ga0105248_10057537
553 Ga0105248_10907066
554 Ga0105249_10219059
555 Ga0105249_11444050
556 Ga0105239_10073937
557 Ga0105246_10521894
558 Ga0157374_10288075
559 Ga0163162_10168132
560 Ga0163162_10219132
561 Ga0157375_10125027
562 Ga0157375_10398949
563 Ga0157375_10983687
564 Ga0163163_10010034
565 Ga0157380_10136005
566 Ga0157380_10145526
567 Ga0157380_11571907
568 Ga0157380_11626753
569 Ga0157377_10054026
570 Ga0157377_10097894
571 Ga0157379_10017769
572 Ga0157379_10100223
573 Ga0157379_10558102
574 Ga0157376_10025116
575 Ga0157376_10064134
576 Ga0157376_10203819
577 Ga0207653_10000574
578 Ga0207710_10004642
579 Ga0207680_10139182
580 Ga0207680_10359658
581 Ga0207645_10084930
582 Ga0207643_10223131
583 Ga0207684_10306559
584 Ga0207693_10189438
585 Ga0207646_10097100
586 Ga0207646_10311348
587 Ga0207659_10011934
588 Ga0207659_10056864
589 Ga0207659_10299936
590 Ga0207687_10109688
591 Ga0207644_10094733
592 Ga0207706_10044428
593 Ga0207706_10382050
594 Ga0207706_10403068
595 Ga0207686_10003880
596 Ga0207686_10092009
597 Ga0207709_10543054
598 Ga0207670_10076954
599 Ga0207670_10130459
600 Ga0207670_10414542
601 Ga0207669_10734415
602 Ga0207704_10012189
603 Ga0207704_10306335
604 Ga0207704_10775456
605 Ga0207665_10469704
606 Ga0207665_11000921
607 Ga0207691_10279983
608 Ga0207711_10016601
609 Ga0207711_10119232
610 Ga0207711_10232791
611 Ga0207689_10156609
612 Ga0207679_10177072
613 Ga0207667_10540606
614 Ga0207651_10202805
615 Ga0207651_10635941
616 Ga0207712_10202195
617 Ga0207668_10145055
618 Ga0207668_10289194
619 Ga0207640_10838711
620 Ga0207658_10350850
621 Ga0207677_10044621
622 Ga0207677_10221381
623 Ga0207703_10022189
624 Ga0207703_10023896
625 Ga0207708_10056354
626 Ga0207708_10079645
627 Ga0207641_10643587
628 Ga0207648_10019336
629 Ga0207648_10127210
630 Ga0207676_10098066
631 Ga0207676_11242985
632 Ga0207675_100130733
633 Ga0207675_100980343
634 Ga0207683_10231999
635 Ga0207428_10000002
636 Ga0207428_10013016
637 Ga0207428_10072541
638 Ga0268266_10002323
639 Ga0268266_10014977
640 Ga0268265_10351733
641 Ga0268265_10968515
642 Ga0268265_11016465
643 Ga0268265_11074577
644 Ga0268264_10521310
645 Ga0268264_10674137
646 Ga0268264_10834545
647 Ga0307408_100442832
648 Ga0307416_100074363
649 Ga0307411_10234680
650 Ga0373936_0102985
651 Ga0373939_0194098
652 Ga0373941_0023922
653 Ga0373954_0239478
654 Ga0373937_0268923
655 Ga0373937_0281089
656 Ga0373925_0704257
657 Ga0439439_0021804
658 Ga0439453_0046196
659 Ga0439435_0054364
660 Ga0439440_0109507
661 Ga0453683_0658598
662 Ga0466957_0417438
663 Ga0451576_1027405
664 Ga0495603_0126947
665 Ga0495582_0053638
666 Ga0495639_0045545
667 Ga0495618_0514104
668 Ga0495640_0058826
669 Ga0495586_0165261
670 Ga0495621_0019654
671 Ga0495633_0127060
672 Ga0495658_0145803
673 Ga0495684_0084025
674 Ga0496101_0720098
675 Ga0496104_0218360
676 Ga0496108_0011048
677 Ga0496109_0144299
678 Ga0496110_0644209
679 Ga0496112_0086542
680 Ga0496113_0349466
681 Ga0501036_0176149
682 Ga0501039_0080558
683 Ga0501040_0058593
684 Ga0501042_0187327
685 Ga0501068_0355654
686 Ga0501073_0635740
687 Ga0501075_0020162
688 Ga0501076_0104548
689 Ga0501079_0085503
690 Ga0501081_0172502
691 Ga0501083_0123495
692 Ga0501045_0033959
693 Ga0501045_0650036
694 nmdc:mga06z11_400096_c1
695 nmdc:mga05p37_140787_c1
696 nmdc:mga05p37_3502_c1
697 nmdc:mga05p37_366519_c1
698 nmdc:mga05p37_45445_c1
699 nmdc:mga09592_129689_c1
700 nmdc:mga09592_228364_c1
701 nmdc:mga09592_389359_c1
702 nmdc:mga09592_468129_c1
703 nmdc:mga0qj67_152435_c1
704 nmdc:mga0qj67_767103_c1
705 nmdc:mga0qj67_978005_c1
706 nmdc:mga06r32_139277_c1
707 nmdc:mga08y16_1491861_c1
708 nmdc:mga08y16_19902_c1
709 nmdc:mga08y16_3_c1
710 nmdc:mga08y16_827729_c1
711 nmdc:mga0n895_155027_c1
712 nmdc:mga0n895_20333_c1
713 nmdc:mga0n895_206331_c1
714 nmdc:mga0n895_212414_c1
715 nmdc:mga0n895_21_c1
716 nmdc:mga0n895_290514_c1
717 nmdc:mga0rr50_165711_c1
718 nmdc:mga0rr50_2147_c1
719 nmdc:mga0rr50_455321_c1
720 nmdc:mga0rr50_51233_c1
721 nmdc:mga0rr50_741031_c1
722 nmdc:mga0rr50_8_c1
723 nmdc:mga0rr50_97534_c1
724 nmdc:mga08x19_21369_c1
725 nmdc:mga08x19_333_c1
726 nmdc:mga08x19_437558_c1
727 nmdc:mga08x19_485477_c1
728 nmdc:mga08x19_9544_c1
729 nmdc:mga0a205_103832_c1
730 nmdc:mga0a205_247036_c1
731 nmdc:mga0a205_35671_c1
732 nmdc:mga0a205_3697_c1
733 nmdc:mga0a205_6659_c1
734 Ga0495601_0187772
735 Ga0495619_0106506
736 Ga0501084_1047839
737 Ga0590071_007417
738 Ga0590074_001698
739 Ga0590075_000582
740 Ga0530510_0443130

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03602

Cons_hypoth95

Conserved hypothetical protein 95

25

206

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lwo-assembly1.cif.gz_B crystal structure of prmt6 0.9296 40 96
2esr-assembly1.cif.gz_B conserved hypothetical protein- streptococcus pyogenes 0.8894 29 173
2fhp-assembly1.cif.gz_A crystal structure of putative methylase from enterococcus faecalis 0.8883 1 171
3p9n-assembly1.cif.gz_A rv2966c of m. tuberculosis is a rsmd-like methyltransferase 0.8792 1 173
6m1c-assembly1.cif.gz_A crystal structure of rsmd methyltransferase of m. tuberculosis in complex with sinefungin reveals key interactions 0.8765 1 173
ID Description Score Start End Superfamily
af_A0A1D6EFY7_537_616_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9291 44 98 3.40.50.150
af_A0A5K1K930_343_529_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9131 3 171 3.40.50.150
af_P0ADX9_1_198_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.897 1 178 3.40.50.150
af_A0A0R0EHR2_116_316_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8944 1 174 3.40.50.150
6aieC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8788 1 173 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A2V6FNX7-F1-model_v4 16S rRNA (Guanine(966)-N(2))-methyltransferase RsmD 0.9792 1 88 GO:0008168
GO:0031167
AF-A0A1W9PWE8-F1-model_v4 16S rRNA (Guanine(966)-N(2))-methyltransferase RsmD 0.9645 1 96 GO:0008168
GO:0031167
AF-A0A7C6AX68-F1-model_v4 16S rRNA (Guanine(966)-N(2))-methyltransferase RsmD (EC 2.1.1.171) 0.9627 1 98 GO:0052913
AF-A0A2V6FNX7-F1-model_v4 16S rRNA (Guanine(966)-N(2))-methyltransferase RsmD 0.9576 1 88 GO:0008168
GO:0031167
AF-A6QKP6-F1-model_v4 N6-adenine-specific methylase 0.9548 1 97 GO:0008168
GO:0031167

Map