F425499

General Info

Members Datasets Scaffolds Average Seq Length
370 192 740 294

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0115908|Ga0466967_0115908_434_1366
Length 310
Sequence VSVITDPEAPAGTGAKRPGPSRAGALSAMLWRRGWLRGLLTLSPPLAWFLVIYLASLVLMLITAFWTVNPLTNALEHTWSTTNFNQLFTSTYLSIIARTVAMAAIVTLTDAIIALPFAYYMARVASSRTRRAIFTAVLLPLWASYLARVYAWIVILQKGGTLSWTFQKLGLGSVNIGYTNTAMWLVFSYIWLPFMIVPVYGALERIPDSLLEASGDLGARNWRTLRSVILPLALPGLVAGSIFTFSLTLGDFITPLLVGGASSQFIGNVIYSNLGTANNLPFAATLALVPIAIMIVYLTGARSLGAFEAL

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
5 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
27 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
28 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
29 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
32 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
33 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
34 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
35 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
54 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
77 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
78 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
79 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
80 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
81 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
82 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
83 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
84 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
85 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
86 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
87 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
88 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
89 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
90 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
91 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
92 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
93 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
94 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
95 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
96 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
97 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
98 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
99 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
100 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
101 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
102 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
103 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
104 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
105 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
106 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
107 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
108 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
109 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
110 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
112 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
113 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
114 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
115 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
116 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
117 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
118 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
119 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
120 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
121 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
122 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
123 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
124 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
125 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
126 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
127 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
128 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
129 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
130 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
131 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
132 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
133 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
134 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
135 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
136 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
137 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
138 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
139 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
140 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
141 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
142 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
143 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
144 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
145 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
146 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
147 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
148 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
149 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
150 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
151 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
152 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
153 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
154 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
155 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
156 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
157 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
158 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
159 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
160 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
161 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
162 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
163 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
164 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
167 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
168 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
169 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
170 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
171 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
172 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
173 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
174 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
175 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
176 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
179 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
180 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
181 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
182 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
183 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
184 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
185 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
186 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
187 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
188 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
189 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
190 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
191 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
192 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.59
Rhizosphere 94.59
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_0115908 3300045976 Bacteria 2468
2 Ga0070683_100000759 3300005329 Bacteria 23645
3 Ga0070682_100092255 3300005337 Bacteria 1984
4 Ga0070691_10035654 3300005341 Bacteria 2343
5 Ga0070659_100299834 3300005366 Bacteria 1340
6 Ga0070714_100029653 3300005435 Bacteria 4548
7 Ga0070714_100065188 3300005435 Bacteria 3137
8 Ga0070714_100115836 3300005435 Bacteria 2379
9 Ga0070714_100193919 3300005435 Bacteria 1855
10 Ga0070713_100007820 3300005436 Bacteria 7535
11 Ga0070713_100041710 3300005436 Bacteria 3741
12 Ga0070713_100160833 3300005436 Bacteria 2004
13 Ga0070710_10005677 3300005437 Bacteria 5940
14 Ga0070710_10088368 3300005437 Bacteria 1823
15 Ga0070710_10114562 3300005437 Bacteria 1624
16 Ga0070711_100016744 3300005439 Bacteria 4659
17 Ga0070711_100178429 3300005439 Bacteria 1624
18 Ga0070708_100113594 3300005445 Bacteria 2491
19 Ga0070708_100301437 3300005445 Bacteria 1509
20 Ga0070706_100000687 3300005467 Bacteria 38295
21 Ga0070706_100001199 3300005467 Bacteria 27740
22 Ga0070706_100004004 3300005467 Bacteria 14326
23 Ga0070706_100049416 3300005467 Bacteria 3881
24 Ga0070706_100247441 3300005467 Bacteria 1665
25 Ga0070707_100003255 3300005468 Bacteria 15392
26 Ga0070707_100004651 3300005468 Bacteria 12847
27 Ga0070707_100008457 3300005468 Bacteria 9559
28 Ga0070707_100020648 3300005468 Bacteria 6216
29 Ga0070707_100027783 3300005468 Bacteria 5383
30 Ga0070707_100044488 3300005468 Bacteria 4251
31 Ga0070707_100268691 3300005468 Bacteria 1658
32 Ga0070707_100323559 3300005468 Bacteria 1498
33 Ga0070707_100354752 3300005468 Bacteria 1424
34 Ga0070698_100000862 3300005471 Bacteria 33342
35 Ga0070698_100029886 3300005471 Bacteria 5654
36 Ga0070698_100042869 3300005471 Bacteria 4641
37 Ga0070698_100051294 3300005471 Bacteria 4202
38 Ga0070699_100027861 3300005518 Bacteria 4873
39 Ga0070699_100080034 3300005518 Bacteria 2847
40 Ga0070699_100151652 3300005518 Bacteria 2050
41 Ga0070699_100192063 3300005518 Bacteria 1814
42 Ga0070699_100345452 3300005518 Bacteria 1340
43 Ga0070679_100277613 3300005530 Bacteria 1628
44 Ga0070684_100017975 3300005535 Bacteria 5813
45 Ga0070684_100465158 3300005535 Bacteria 1169
46 Ga0070684_100576098 3300005535 Bacteria 1045
47 Ga0070697_100000029 3300005536 Bacteria 114092
48 Ga0070697_100027847 3300005536 Bacteria 4524
49 Ga0070697_100050927 3300005536 Bacteria 3363
50 Ga0070696_100020818 3300005546 Bacteria 4445
51 Ga0070693_100375634 3300005547 Bacteria 979
52 Ga0070704_100032098 3300005549 Bacteria 3538
53 Ga0068857_100000846 3300005577 Bacteria 22932
54 Ga0068856_100003521 3300005614 Bacteria 15794
55 Ga0068856_100126331 3300005614 Bacteria 2561
56 Ga0081455_10075141 3300005937 Bacteria 2789
57 Ga0081540_1003201 3300005983 Bacteria 13047
58 Ga0070717_10002005 3300006028 Bacteria 14237
59 Ga0070717_10036558 3300006028 Bacteria 3983
60 Ga0070717_10125574 3300006028 Bacteria 2202
61 Ga0070717_10207456 3300006028 Bacteria 1719
62 Ga0075432_10071910 3300006058 Bacteria 1244
63 Ga0070715_10000426 3300006163 Bacteria 10765
64 Ga0070715_10014053 3300006163 Bacteria 2955
65 Ga0070716_100001720 3300006173 Bacteria 9872
66 Ga0068871_100008873 3300006358 Bacteria 7249
67 Ga0075431_100630579 3300006847 Bacteria 1054
68 Ga0075433_10061260 3300006852 Bacteria 3296
69 Ga0075434_100008021 3300006871 Bacteria 9785
70 Ga0075434_100061859 3300006871 Bacteria 3726
71 Ga0075436_100003307 3300006914 Bacteria 11031
72 Ga0075435_100008765 3300007076 Bacteria 7281
73 Ga0075435_100377840 3300007076 Bacteria 1217
74 Ga0075435_100482472 3300007076 Bacteria 1071
75 Ga0099794_10029777 3300007265 Bacteria 2545
76 Ga0099794_10084536 3300007265 Bacteria 1569
77 Ga0111539_10030351 3300009094 Bacteria 6572
78 Ga0111539_10062806 3300009094 Bacteria 4396
79 Ga0105245_10015728 3300009098 Bacteria 6599
80 Ga0105245_10273077 3300009098 Bacteria 1649
81 Ga0114129_10073774 3300009147 Bacteria 4754
82 Ga0105243_10049192 3300009148 Bacteria 3325
83 Ga0105241_10159261 3300009174 Bacteria 1854
84 Ga0105242_10167618 3300009176 Bacteria 1928
85 Ga0105237_10214282 3300009545 Bacteria 1926
86 Ga0105238_10432377 3300009551 Bacteria 1312
87 Ga0105239_10241951 3300010375 Bacteria 2025
88 Ga0157370_10303544 3300013104 Bacteria 1473
89 Ga0157369_10020880 3300013105 Bacteria 7321
90 Ga0157369_10054923 3300013105 Bacteria 4300
91 Ga0157374_10155765 3300013296 Bacteria 2223
92 Ga0157378_10305689 3300013297 Bacteria 1541
93 Ga0163162_10487840 3300013306 Bacteria 1363
94 Ga0157372_10261306 3300013307 Bacteria 2010
95 Ga0157375_10740708 3300013308 Bacteria 1135
96 Ga0157379_10254736 3300014968 Bacteria 1594
97 Ga0213876_10002771 3300021384 Bacteria 10214
98 Ga0207692_10001845 3300025898 Bacteria 8051
99 Ga0207692_10044474 3300025898 Bacteria 2216
100 Ga0207685_10000620 3300025905 Bacteria 6233
101 Ga0207685_10008339 3300025905 Bacteria 2947
102 Ga0207699_10000925 3300025906 Bacteria 14019
103 Ga0207699_10004583 3300025906 Bacteria 6604
104 Ga0207699_10106309 3300025906 Bacteria 1791
105 Ga0207684_10000151 3300025910 Bacteria 121836
106 Ga0207684_10010114 3300025910 Bacteria 8309
107 Ga0207684_10015560 3300025910 Bacteria 6545
108 Ga0207684_10106839 3300025910 Bacteria 2395
109 Ga0207684_10122690 3300025910 Bacteria 2228
110 Ga0207684_10125863 3300025910 Bacteria 2199
111 Ga0207684_10253025 3300025910 Bacteria 1520
112 Ga0207707_10225564 3300025912 Bacteria 1631
113 Ga0207693_10008730 3300025915 Bacteria 8284
114 Ga0207693_10024002 3300025915 Bacteria 4841
115 Ga0207663_10015080 3300025916 Bacteria 4253
116 Ga0207646_10000079 3300025922 Bacteria 129281
117 Ga0207646_10000237 3300025922 Bacteria 76020
118 Ga0207646_10000567 3300025922 Bacteria 48701
119 Ga0207646_10001122 3300025922 Bacteria 34163
120 Ga0207646_10004842 3300025922 Bacteria 14422
121 Ga0207646_10005615 3300025922 Bacteria 13174
122 Ga0207646_10008547 3300025922 Bacteria 10241
123 Ga0207646_10014907 3300025922 Bacteria 7359
124 Ga0207646_10036749 3300025922 Bacteria 4420
125 Ga0207646_10056151 3300025922 Bacteria 3520
126 Ga0207646_10069046 3300025922 Bacteria 3156
127 Ga0207646_10210330 3300025922 Bacteria 1757
128 Ga0207694_10359372 3300025924 Bacteria 1206
129 Ga0207687_10125473 3300025927 Bacteria 1926
130 Ga0207700_10001638 3300025928 Bacteria 12721
131 Ga0207700_10011053 3300025928 Bacteria 5737
132 Ga0207664_10001956 3300025929 Bacteria 13570
133 Ga0207664_10008208 3300025929 Bacteria 7270
134 Ga0207664_10011249 3300025929 Bacteria 6349
135 Ga0207664_10084621 3300025929 Bacteria 2587
136 Ga0207690_10309015 3300025932 Bacteria 1239
137 Ga0207686_10058205 3300025934 Bacteria 2436
138 Ga0207709_10121397 3300025935 Bacteria 1765
139 Ga0207665_10000932 3300025939 Bacteria 19799
140 Ga0207665_10016581 3300025939 Bacteria 4841
141 Ga0207665_10052844 3300025939 Bacteria 2738
142 Ga0207661_10000303 3300025944 Bacteria 31267
143 Ga0207661_10595960 3300025944 Bacteria 1014
144 Ga0207679_10103455 3300025945 Bacteria 2232
145 Ga0207667_10614797 3300025949 Bacteria 1095
146 Ga0207678_10123125 3300026067 Bacteria 2213
147 Ga0207702_10010444 3300026078 Bacteria 7766
148 Ga0207702_10189058 3300026078 Bacteria 1901
149 Ga0207674_10000808 3300026116 Bacteria 40727
150 Ga0207428_10071143 3300027907 Bacteria 2733
151 Ga0265319_1000140 3300028563 Bacteria 54274
152 Ga0265319_1006274 3300028563 Bacteria 5529
153 Ga0265318_10008526 3300028577 Bacteria 4557
154 Ga0265336_10010857 3300028666 Bacteria 3108
155 Ga0265338_10004893 3300028800 Bacteria 17839
156 Ga0265338_10006401 3300028800 Bacteria 15014
157 Ga0265338_10029809 3300028800 Bacteria 5399
158 Ga0265330_10056421 3300031235 Bacteria 1714
159 Ga0265320_10065286 3300031240 Bacteria 1727
160 Ga0265320_10069626 3300031240 Bacteria 1660
161 Ga0265325_10000193 3300031241 Bacteria 43575
162 Ga0265340_10000075 3300031247 Bacteria 47375
163 Ga0265339_10004226 3300031249 Bacteria 9840
164 Ga0265339_10009942 3300031249 Bacteria 5938
165 Ga0265331_10032182 3300031250 Bacteria 2601
166 Ga0265327_10007178 3300031251 Bacteria 8674
167 Ga0265316_10269805 3300031344 Bacteria 1245
168 Ga0265313_10025388 3300031595 Bacteria 3141
169 Ga0265314_10094733 3300031711 Bacteria 1935
170 Ga0373930_0002179 3300034816 Bacteria 3012
171 Ga0373948_0015111 3300034817 Bacteria 1414
172 Ga0373958_0007115 3300034819 Bacteria 1770
173 Ga0373938_0002232 3300034957 Bacteria 3111
174 Ga0373934_0000242 3300035086 Bacteria 19650
175 Ga0373934_0008775 3300035086 Bacteria 3776
176 Ga0373940_0002782 3300035088 Bacteria 3469
177 Ga0373951_0024723 3300035091 Bacteria 1392
178 Ga0373932_0002441 3300035112 Bacteria 4714
179 Ga0373953_0000448 3300035117 Bacteria 11294
180 Ga0373953_0050938 3300035117 Bacteria 1673
181 Ga0373954_0020087 3300035118 Bacteria 3018
182 Ga0373954_0041534 3300035118 Bacteria 2145
183 Ga0373956_0000504 3300035119 Bacteria 15960
184 Ga0373956_0020018 3300035119 Bacteria 2842
185 Ga0373956_0070851 3300035119 Bacteria 1591
186 Ga0373957_0000137 3300035120 Bacteria 18132
187 Ga0373957_0001449 3300035120 Bacteria 6430
188 Ga0373943_0059623 3300035170 Bacteria 1903
189 Ga0373955_0007924 3300035172 Bacteria 4905
190 Ga0373955_0021691 3300035172 Bacteria 3246
191 Ga0373961_0014492 3300035241 Bacteria 2003
192 Ga0373931_0161595 3300035691 Bacteria 1313
193 Ga0373927_0089185 3300035695 Bacteria 2002
194 Ga0373933_0000012 3300035724 Bacteria 108156
195 Ga0373933_0002615 3300035724 Bacteria 10093
196 Ga0373933_0104787 3300035724 Bacteria 1758
197 Ga0373937_0000040 3300036401 Bacteria 108935
198 Ga0373937_0059848 3300036401 Bacteria 3500
199 Ga0373937_0129967 3300036401 Bacteria 2352
200 Ga0373925_0003357 3300037068 Bacteria 12423
201 Ga0373925_0014192 3300037068 Bacteria 5765
202 Ga0395900_0004800 3300037418 Bacteria 14241
203 Ga0395900_0050355 3300037418 Bacteria 4290
204 Ga0395900_0108400 3300037418 Bacteria 2853
205 Ga0395898_0004165 3300037466 Bacteria 15852
206 Ga0395898_0006383 3300037466 Bacteria 12598
207 Ga0395898_0020500 3300037466 Bacteria 6714
208 Ga0395898_0042570 3300037466 Bacteria 4479
209 Ga0395898_0139787 3300037466 Bacteria 2318
210 Ga0395905_0150275 3300037471 Bacteria 2191
211 Ga0395905_0294713 3300037471 Bacteria 1509
212 Ga0395901_0005619 3300038443 Bacteria 12695
213 Ga0395901_0055723 3300038443 Bacteria 4111
214 Ga0436365_0229625 3300039437 Bacteria 76076
215 Ga0436365_0802343 3300039437 Bacteria 6564
216 Ga0466969_0005695 3300044656 Bacteria 6623
217 Ga0466969_0062267 3300044656 Bacteria 1811
218 Ga0466972_0043156 3300044658 Bacteria 2191
219 Ga0466966_0002913 3300044684 Bacteria 11272
220 Ga0466966_0045251 3300044684 Bacteria 2815
221 Ga0466961_0001826 3300044693 Bacteria 13207
222 Ga0466961_0017038 3300044693 Bacteria 4666
223 Ga0466961_0141729 3300044693 Bacteria 1504
224 Ga0466961_0158545 3300044693 Bacteria 1411
225 Ga0466963_0000497 3300044694 Bacteria 18307
226 Ga0466963_0063357 3300044694 Bacteria 2474
227 Ga0466963_0168382 3300044694 Bacteria 1527
228 Ga0466963_0269246 3300044694 Bacteria 1197
229 Ga0466964_0002834 3300044706 Bacteria 6247
230 Ga0466964_0083455 3300044706 Bacteria 1376
231 Ga0466971_0044698 3300044719 Bacteria 1989
232 Ga0466971_0087437 3300044719 Bacteria 1425
233 Ga0466957_0029516 3300044842 Bacteria 3271
234 Ga0466959_0003561 3300045049 Bacteria 10245
235 Ga0466959_0026530 3300045049 Bacteria 4294
236 Ga0466959_0237397 3300045049 Bacteria 1260
237 Ga0466958_0034958 3300045836 Bacteria 3000
238 Ga0466958_0106364 3300045836 Bacteria 1749
239 Ga0466958_0107381 3300045836 Bacteria 1741
240 Ga0466958_0196869 3300045836 Bacteria 1282
241 Ga0466958_0232054 3300045836 Bacteria 1178
242 Ga0466967_0000042 3300045976 Bacteria 45895
243 Ga0466967_0064637 3300045976 Bacteria 3254
244 Ga0466967_0103057 3300045976 Bacteria 2611
245 Ga0466967_0136720 3300045976 Bacteria 2279
246 Ga0466967_0145424 3300045976 Bacteria 2211
247 Ga0495592_0000106 3300046454 Bacteria 74359
248 Ga0495592_0069103 3300046454 Bacteria 2576
249 Ga0495592_0245718 3300046454 Bacteria 1185
250 Ga0495592_0259271 3300046454 Bacteria 1146
251 Ga0495603_0074088 3300046455 Bacteria 1999
252 Ga0495629_0206189 3300046459 Bacteria 1358
253 Ga0495651_0000040 3300046462 Bacteria 94890
254 Ga0495651_0021215 3300046462 Bacteria 5047
255 Ga0495653_0042598 3300046463 Bacteria 3535
256 Ga0495653_0051680 3300046463 Bacteria 3153
257 Ga0495653_0076757 3300046463 Bacteria 2483
258 Ga0495653_0133071 3300046463 Bacteria 1757
259 Ga0495580_0109019 3300046472 Bacteria 1922
260 Ga0495582_0027066 3300046473 Bacteria 3143
261 Ga0495662_0051540 3300046476 Bacteria 1986
262 Ga0495664_0044604 3300046477 Bacteria 2627
263 Ga0495664_0180684 3300046477 Bacteria 1279
264 Ga0495608_0000044 3300046511 Bacteria 108171
265 Ga0495608_0088915 3300046511 Bacteria 1999
266 Ga0495608_0095149 3300046511 Bacteria 1924
267 Ga0495628_0000450 3300046516 Bacteria 37523
268 Ga0495628_0020344 3300046516 Bacteria 5476
269 Ga0495628_0026175 3300046516 Bacteria 4762
270 Ga0495630_0262838 3300046517 Bacteria 1318
271 Ga0495666_0061431 3300046526 Bacteria 1795
272 Ga0495652_0000108 3300046529 Bacteria 89636
273 Ga0495652_0055518 3300046529 Bacteria 3368
274 Ga0495665_0003119 3300046531 Bacteria 8964
275 Ga0495665_0032322 3300046531 Bacteria 2800
276 Ga0495640_0021960 3300046533 Bacteria 4675
277 Ga0495640_0134822 3300046533 Bacteria 1595
278 Ga0495587_0000046 3300046536 Bacteria 108171
279 Ga0495587_0017246 3300046536 Bacteria 4488
280 Ga0495587_0079835 3300046536 Bacteria 1897
281 Ga0495645_0028478 3300046543 Bacteria 4060
282 Ga0495667_0000518 3300046559 Bacteria 24595
283 Ga0495667_0036266 3300046559 Bacteria 3292
284 Ga0495667_0226686 3300046559 Bacteria 1192
285 Ga0495668_0279482 3300046616 Bacteria 915
286 Ga0495634_0150151 3300046642 Bacteria 1474
287 Ga0495635_0006342 3300046663 Bacteria 8246
288 Ga0495657_0000547 3300046675 Bacteria 34712
289 Ga0495657_0026181 3300046675 Bacteria 4132
290 Ga0495657_0047001 3300046675 Bacteria 2920
291 Ga0495599_0004224 3300046678 Bacteria 8487
292 Ga0495599_0039914 3300046678 Bacteria 2949
293 Ga0495623_0000260 3300046679 Bacteria 34082
294 Ga0495623_0031399 3300046679 Bacteria 3415
295 Ga0495623_0035500 3300046679 Bacteria 3195
296 Ga0495646_0002580 3300046680 Bacteria 11148
297 Ga0495646_0052673 3300046680 Bacteria 2457
298 Ga0495646_0167926 3300046680 Bacteria 1211
299 Ga0495613_0026446 3300046689 Bacteria 4322
300 Ga0495624_0096666 3300046690 Bacteria 1819
301 Ga0495600_0024305 3300046809 Bacteria 3899
302 Ga0495600_0088564 3300046809 Bacteria 2019
303 Ga0495600_0099147 3300046809 Bacteria 1899
304 Ga0495600_0320678 3300046809 Bacteria 974
305 Ga0495581_0028764 3300047315 Bacteria 3222
306 Ga0495604_0000049 3300047317 Bacteria 108620
307 Ga0495604_0033475 3300047317 Bacteria 4068
308 Ga0495674_0002878 3300047319 Bacteria 16737
309 Ga0495674_0004734 3300047319 Bacteria 13086
310 Ga0495674_0148717 3300047319 Bacteria 1965
311 Ga0495676_0163170 3300047321 Bacteria 1574
312 Ga0495680_0000977 3300047322 Bacteria 31770
313 Ga0495680_0030723 3300047322 Bacteria 4382
314 Ga0495680_0143590 3300047322 Bacteria 1745
315 Ga0495675_0000062 3300047444 Bacteria 75661
316 Ga0495675_0025104 3300047444 Bacteria 3801
317 Ga0495675_0145384 3300047444 Bacteria 1467
318 Ga0495684_0018027 3300047471 Bacteria 5440
319 Ga0495593_0038845 3300047673 Bacteria 2569
320 Ga0495602_0000558 3300048088 Bacteria 34735
321 Ga0495602_0018522 3300048088 Bacteria 6950
322 Ga0495602_0083066 3300048088 Bacteria 2685
323 Ga0495602_0083666 3300048088 Bacteria 2672
324 Ga0496103_0077059 3300048906 Bacteria 2093
325 Ga0496104_0069770 3300048907 Bacteria 3340
326 Ga0496104_0076633 3300048907 Bacteria 3185
327 Ga0496104_0317792 3300048907 Bacteria 1470
328 Ga0496105_0012020 3300048908 Bacteria 6855
329 Ga0496105_0102056 3300048908 Bacteria 2369
330 Ga0496106_0168573 3300048909 Bacteria 1734
331 Ga0496107_0023723 3300048910 Bacteria 4336
332 Ga0496108_0193431 3300048911 Bacteria 1763
333 Ga0496110_0081367 3300048913 Bacteria 2887
334 Ga0496111_0090326 3300048914 Bacteria 2244
335 Ga0496112_0077637 3300048915 Bacteria 3284
336 Ga0496112_0117460 3300048915 Bacteria 2630
337 Ga0496113_0078273 3300048916 Bacteria 2530
338 Ga0496114_0005313 3300048917 Bacteria 10066
339 Ga0496115_0073533 3300048918 Bacteria 2774
340 Ga0496115_0154069 3300048918 Bacteria 1898
341 Ga0501042_0011766 3300049578 Bacteria 5911
342 Ga0501047_0146378 3300049581 Bacteria 2239
343 Ga0501067_0014618 3300049583 Bacteria 4346
344 Ga0501069_0005637 3300049585 Bacteria 6517
345 Ga0501076_0073593 3300049592 Bacteria 2736
346 Ga0501079_0085743 3300049741 Bacteria 2438
347 nmdc:mga05p37_27803_c1 3300050507 Bacteria 6890
348 nmdc:mga0n895_135359_c1 3300050512 Bacteria 2491
349 nmdc:mga0n895_17643_c1 3300050512 Bacteria 6585
350 nmdc:mga0n895_93291_c1 3300050512 Bacteria 3014
351 nmdc:mga0rr50_18945_c1 3300050513 Bacteria 3963
352 nmdc:mga0rr50_24725_c1 3300050513 Bacteria 4166
353 nmdc:mga0rr50_47065_c1 3300050513 Bacteria 3179
354 nmdc:mga0rr50_530164_c1 3300050513 Bacteria 1002
355 nmdc:mga08x19_19843_c1 3300050514 Bacteria 4131
356 nmdc:mga08x19_8327_c1 3300050514 Bacteria 6171
357 nmdc:mga0a205_158904_c1 3300050515 Bacteria 2158
358 nmdc:mga0a205_31106_c1 3300050515 Bacteria 5112
359 Ga0495601_0032178 3300053077 Bacteria 3264
360 Ga0495601_0045304 3300053077 Bacteria 2765
361 Ga0495601_0118933 3300053077 Bacteria 1715
362 Ga0495612_0041881 3300053078 Bacteria 1868
363 Ga0495595_0004897 3300053084 Bacteria 5400
364 Ga0495595_0155199 3300053084 Bacteria 1127
365 Ga0495619_0034064 3300053085 Bacteria 3310
366 Ga0495619_0100214 3300053085 Bacteria 1971
367 Ga0495619_0185619 3300053085 Bacteria 1439
368 Ga0501084_0050413 3300054114 Bacteria 3485
369 Ga0501084_0382763 3300054114 Bacteria 1189
370 Ga0466962_0037929 3300061719 Bacteria 2308
371 Ga0466967_0115908
372 Ga0070683_100000759
373 Ga0070682_100092255
374 Ga0070691_10035654
375 Ga0070659_100299834
376 Ga0070714_100029653
377 Ga0070714_100065188
378 Ga0070714_100115836
379 Ga0070714_100193919
380 Ga0070713_100007820
381 Ga0070713_100041710
382 Ga0070713_100160833
383 Ga0070710_10005677
384 Ga0070710_10088368
385 Ga0070710_10114562
386 Ga0070711_100016744
387 Ga0070711_100178429
388 Ga0070708_100113594
389 Ga0070708_100301437
390 Ga0070706_100000687
391 Ga0070706_100001199
392 Ga0070706_100004004
393 Ga0070706_100049416
394 Ga0070706_100247441
395 Ga0070707_100003255
396 Ga0070707_100004651
397 Ga0070707_100008457
398 Ga0070707_100020648
399 Ga0070707_100027783
400 Ga0070707_100044488
401 Ga0070707_100268691
402 Ga0070707_100323559
403 Ga0070707_100354752
404 Ga0070698_100000862
405 Ga0070698_100029886
406 Ga0070698_100042869
407 Ga0070698_100051294
408 Ga0070699_100027861
409 Ga0070699_100080034
410 Ga0070699_100151652
411 Ga0070699_100192063
412 Ga0070699_100345452
413 Ga0070679_100277613
414 Ga0070684_100017975
415 Ga0070684_100465158
416 Ga0070684_100576098
417 Ga0070697_100000029
418 Ga0070697_100027847
419 Ga0070697_100050927
420 Ga0070696_100020818
421 Ga0070693_100375634
422 Ga0070704_100032098
423 Ga0068857_100000846
424 Ga0068856_100003521
425 Ga0068856_100126331
426 Ga0081455_10075141
427 Ga0081540_1003201
428 Ga0070717_10002005
429 Ga0070717_10036558
430 Ga0070717_10125574
431 Ga0070717_10207456
432 Ga0075432_10071910
433 Ga0070715_10000426
434 Ga0070715_10014053
435 Ga0070716_100001720
436 Ga0068871_100008873
437 Ga0075431_100630579
438 Ga0075433_10061260
439 Ga0075434_100008021
440 Ga0075434_100061859
441 Ga0075436_100003307
442 Ga0075435_100008765
443 Ga0075435_100377840
444 Ga0075435_100482472
445 Ga0099794_10029777
446 Ga0099794_10084536
447 Ga0111539_10030351
448 Ga0111539_10062806
449 Ga0105245_10015728
450 Ga0105245_10273077
451 Ga0114129_10073774
452 Ga0105243_10049192
453 Ga0105241_10159261
454 Ga0105242_10167618
455 Ga0105237_10214282
456 Ga0105238_10432377
457 Ga0105239_10241951
458 Ga0157370_10303544
459 Ga0157369_10020880
460 Ga0157369_10054923
461 Ga0157374_10155765
462 Ga0157378_10305689
463 Ga0163162_10487840
464 Ga0157372_10261306
465 Ga0157375_10740708
466 Ga0157379_10254736
467 Ga0213876_10002771
468 Ga0207692_10001845
469 Ga0207692_10044474
470 Ga0207685_10000620
471 Ga0207685_10008339
472 Ga0207699_10000925
473 Ga0207699_10004583
474 Ga0207699_10106309
475 Ga0207684_10000151
476 Ga0207684_10010114
477 Ga0207684_10015560
478 Ga0207684_10106839
479 Ga0207684_10122690
480 Ga0207684_10125863
481 Ga0207684_10253025
482 Ga0207707_10225564
483 Ga0207693_10008730
484 Ga0207693_10024002
485 Ga0207663_10015080
486 Ga0207646_10000079
487 Ga0207646_10000237
488 Ga0207646_10000567
489 Ga0207646_10001122
490 Ga0207646_10004842
491 Ga0207646_10005615
492 Ga0207646_10008547
493 Ga0207646_10014907
494 Ga0207646_10036749
495 Ga0207646_10056151
496 Ga0207646_10069046
497 Ga0207646_10210330
498 Ga0207694_10359372
499 Ga0207687_10125473
500 Ga0207700_10001638
501 Ga0207700_10011053
502 Ga0207664_10001956
503 Ga0207664_10008208
504 Ga0207664_10011249
505 Ga0207664_10084621
506 Ga0207690_10309015
507 Ga0207686_10058205
508 Ga0207709_10121397
509 Ga0207665_10000932
510 Ga0207665_10016581
511 Ga0207665_10052844
512 Ga0207661_10000303
513 Ga0207661_10595960
514 Ga0207679_10103455
515 Ga0207667_10614797
516 Ga0207678_10123125
517 Ga0207702_10010444
518 Ga0207702_10189058
519 Ga0207674_10000808
520 Ga0207428_10071143
521 Ga0265319_1000140
522 Ga0265319_1006274
523 Ga0265318_10008526
524 Ga0265336_10010857
525 Ga0265338_10004893
526 Ga0265338_10006401
527 Ga0265338_10029809
528 Ga0265330_10056421
529 Ga0265320_10065286
530 Ga0265320_10069626
531 Ga0265325_10000193
532 Ga0265340_10000075
533 Ga0265339_10004226
534 Ga0265339_10009942
535 Ga0265331_10032182
536 Ga0265327_10007178
537 Ga0265316_10269805
538 Ga0265313_10025388
539 Ga0265314_10094733
540 Ga0373930_0002179
541 Ga0373948_0015111
542 Ga0373958_0007115
543 Ga0373938_0002232
544 Ga0373934_0000242
545 Ga0373934_0008775
546 Ga0373940_0002782
547 Ga0373951_0024723
548 Ga0373932_0002441
549 Ga0373953_0000448
550 Ga0373953_0050938
551 Ga0373954_0020087
552 Ga0373954_0041534
553 Ga0373956_0000504
554 Ga0373956_0020018
555 Ga0373956_0070851
556 Ga0373957_0000137
557 Ga0373957_0001449
558 Ga0373943_0059623
559 Ga0373955_0007924
560 Ga0373955_0021691
561 Ga0373961_0014492
562 Ga0373931_0161595
563 Ga0373927_0089185
564 Ga0373933_0000012
565 Ga0373933_0002615
566 Ga0373933_0104787
567 Ga0373937_0000040
568 Ga0373937_0059848
569 Ga0373937_0129967
570 Ga0373925_0003357
571 Ga0373925_0014192
572 Ga0395900_0004800
573 Ga0395900_0050355
574 Ga0395900_0108400
575 Ga0395898_0004165
576 Ga0395898_0006383
577 Ga0395898_0020500
578 Ga0395898_0042570
579 Ga0395898_0139787
580 Ga0395905_0150275
581 Ga0395905_0294713
582 Ga0395901_0005619
583 Ga0395901_0055723
584 Ga0436365_0229625
585 Ga0436365_0802343
586 Ga0466969_0005695
587 Ga0466969_0062267
588 Ga0466972_0043156
589 Ga0466966_0002913
590 Ga0466966_0045251
591 Ga0466961_0001826
592 Ga0466961_0017038
593 Ga0466961_0141729
594 Ga0466961_0158545
595 Ga0466963_0000497
596 Ga0466963_0063357
597 Ga0466963_0168382
598 Ga0466963_0269246
599 Ga0466964_0002834
600 Ga0466964_0083455
601 Ga0466971_0044698
602 Ga0466971_0087437
603 Ga0466957_0029516
604 Ga0466959_0003561
605 Ga0466959_0026530
606 Ga0466959_0237397
607 Ga0466958_0034958
608 Ga0466958_0106364
609 Ga0466958_0107381
610 Ga0466958_0196869
611 Ga0466958_0232054
612 Ga0466967_0000042
613 Ga0466967_0064637
614 Ga0466967_0103057
615 Ga0466967_0136720
616 Ga0466967_0145424
617 Ga0495592_0000106
618 Ga0495592_0069103
619 Ga0495592_0245718
620 Ga0495592_0259271
621 Ga0495603_0074088
622 Ga0495629_0206189
623 Ga0495651_0000040
624 Ga0495651_0021215
625 Ga0495653_0042598
626 Ga0495653_0051680
627 Ga0495653_0076757
628 Ga0495653_0133071
629 Ga0495580_0109019
630 Ga0495582_0027066
631 Ga0495662_0051540
632 Ga0495664_0044604
633 Ga0495664_0180684
634 Ga0495608_0000044
635 Ga0495608_0088915
636 Ga0495608_0095149
637 Ga0495628_0000450
638 Ga0495628_0020344
639 Ga0495628_0026175
640 Ga0495630_0262838
641 Ga0495666_0061431
642 Ga0495652_0000108
643 Ga0495652_0055518
644 Ga0495665_0003119
645 Ga0495665_0032322
646 Ga0495640_0021960
647 Ga0495640_0134822
648 Ga0495587_0000046
649 Ga0495587_0017246
650 Ga0495587_0079835
651 Ga0495645_0028478
652 Ga0495667_0000518
653 Ga0495667_0036266
654 Ga0495667_0226686
655 Ga0495668_0279482
656 Ga0495634_0150151
657 Ga0495635_0006342
658 Ga0495657_0000547
659 Ga0495657_0026181
660 Ga0495657_0047001
661 Ga0495599_0004224
662 Ga0495599_0039914
663 Ga0495623_0000260
664 Ga0495623_0031399
665 Ga0495623_0035500
666 Ga0495646_0002580
667 Ga0495646_0052673
668 Ga0495646_0167926
669 Ga0495613_0026446
670 Ga0495624_0096666
671 Ga0495600_0024305
672 Ga0495600_0088564
673 Ga0495600_0099147
674 Ga0495600_0320678
675 Ga0495581_0028764
676 Ga0495604_0000049
677 Ga0495604_0033475
678 Ga0495674_0002878
679 Ga0495674_0004734
680 Ga0495674_0148717
681 Ga0495676_0163170
682 Ga0495680_0000977
683 Ga0495680_0030723
684 Ga0495680_0143590
685 Ga0495675_0000062
686 Ga0495675_0025104
687 Ga0495675_0145384
688 Ga0495684_0018027
689 Ga0495593_0038845
690 Ga0495602_0000558
691 Ga0495602_0018522
692 Ga0495602_0083066
693 Ga0495602_0083666
694 Ga0496103_0077059
695 Ga0496104_0069770
696 Ga0496104_0076633
697 Ga0496104_0317792
698 Ga0496105_0012020
699 Ga0496105_0102056
700 Ga0496106_0168573
701 Ga0496107_0023723
702 Ga0496108_0193431
703 Ga0496110_0081367
704 Ga0496111_0090326
705 Ga0496112_0077637
706 Ga0496112_0117460
707 Ga0496113_0078273
708 Ga0496114_0005313
709 Ga0496115_0073533
710 Ga0496115_0154069
711 Ga0501042_0011766
712 Ga0501047_0146378
713 Ga0501067_0014618
714 Ga0501069_0005637
715 Ga0501076_0073593
716 Ga0501079_0085743
717 nmdc:mga05p37_27803_c1
718 nmdc:mga0n895_135359_c1
719 nmdc:mga0n895_17643_c1
720 nmdc:mga0n895_93291_c1
721 nmdc:mga0rr50_18945_c1
722 nmdc:mga0rr50_24725_c1
723 nmdc:mga0rr50_47065_c1
724 nmdc:mga0rr50_530164_c1
725 nmdc:mga08x19_19843_c1
726 nmdc:mga08x19_8327_c1
727 nmdc:mga0a205_158904_c1
728 nmdc:mga0a205_31106_c1
729 Ga0495601_0032178
730 Ga0495601_0045304
731 Ga0495601_0118933
732 Ga0495612_0041881
733 Ga0495595_0004897
734 Ga0495595_0155199
735 Ga0495619_0034064
736 Ga0495619_0100214
737 Ga0495619_0185619
738 Ga0501084_0050413
739 Ga0501084_0382763
740 Ga0466962_0037929

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

114

304

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cad-assembly1.cif.gz_A mycobacterium smegmatis sugabc complex 0.8465 25 298
3d31-assembly1.cif.gz_C modbc from methanosarcina acetivorans 0.844 33 291
8hpl-assembly1.cif.gz_A lpqy-sugabc in state 1 0.8386 25 296
8ja7-assembly1.cif.gz_A cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose 0.8385 27 298
7cad-assembly1.cif.gz_A mycobacterium smegmatis sugabc complex 0.8353 25 298
ID Description Score Start End Superfamily
af_P77156_29_305_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9323 32 295 1.10.3720.10
af_P0AFK4_1_269_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9226 35 299 1.10.3720.10
af_P31135_29_312_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9105 33 297 1.10.3720.10
af_P0AFK4_1_269_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9031 35 299 1.10.3720.10
af_O53484_49_294_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8945 73 299 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A433VTG0-F1-model_v4 deleted 0.9636 43 304
AF-A0A538C588-F1-model_v4 ABC transporter permease 0.9621 20 304 GO:0005886
GO:0055085
AF-A0A5D0QF20-F1-model_v4 ABC transporter permease 0.9607 47 297 GO:0005886
GO:0055085
AF-A0A0R2FB87-F1-model_v4 Spermidine putrescine ABC transporter permease 0.9599 29 295 GO:0005886
GO:0055085
AF-A0A179ETY1-F1-model_v4 Spermidine/putrescine ABC transporter permease 0.9579 37 295 GO:0005886
GO:0055085

Map