F425448

General Info

Members Datasets Scaffolds Average Seq Length
370 217 360 242

Family's Representative Sequence

Representative Sequence 3300031711|Ga0265314_10025305|Ga0265314_100253053
Length 278
Sequence MEHGSFVCPLTSTNSNDMDKPTHLRADRLLVERGLFPSRAKAQAAIEAGLVHAGERQVRKASEEIAVDAALRATPAHPYVSRGGLKLAAALDRFGFDPQGRVCLDVGASTGGFTQVLLERGAKRVIAVDVGRGQLHASLRTRPEVVSLEETDIRSLLPDRLGATPDLIVVDVSFISLKLVLPAALKLTQPPAQLVALIKPQFEAGRAALKKGVVRDAAVHAAVCDDIAAFVATLGWQVLGVIPSPIEGGDGNKEFLLGAVLIAAKAAFVTRDFPVQDT

Samples

Sample ID Description Type Environment
1 2643221733 Bosea sp. Root381 Isolate Unclassified
2 2643221734 Bosea sp. Root670 Isolate Unclassified
3 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
4 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
5 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
6 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
7 2842694124 Methylopila sp. R-72369 Isolate Unclassified
8 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
9 2909042592 Labrys sp. LIt4 Isolate Nodule
10 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
37 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
38 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
93 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
94 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
95 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
96 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
97 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
98 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
99 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
100 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
101 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
102 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
103 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
104 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
105 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
106 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
107 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
108 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
109 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
110 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
111 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
112 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
113 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
114 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
116 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
117 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
118 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
119 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
120 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
121 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
122 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
123 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
124 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
125 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
126 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
127 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
128 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
129 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
130 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
131 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
132 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
133 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
134 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
135 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
136 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
137 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
138 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
139 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
140 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
141 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
142 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
143 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
144 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
145 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
146 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
147 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
148 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
149 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
150 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
151 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
152 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
153 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
154 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
155 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
156 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
157 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
158 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
159 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
160 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
161 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
162 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
163 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
164 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
176 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
177 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
178 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
179 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
180 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
181 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
182 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
183 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
184 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
185 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
186 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
187 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
189 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
190 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
191 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
192 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
193 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
194 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
195 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
196 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
197 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
198 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
199 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
200 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
201 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
202 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
203 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
204 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
205 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
206 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
207 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
208 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
209 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
210 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
211 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
212 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
213 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
214 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
215 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
216 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
217 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.3
Metatranscriptomes 0
Isolates 2.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10
Nodule 0.81
Rhizoplane 3.24
Rhizosphere 84.05
Stem 0
Stem Tuber 0
Unclassified 1.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055526_1000108 3300003771 Bacteria 72583
2 Ga0055526_1000241 3300003771 Bacteria 46273
3 Ga0055524_1000055 3300003775 Bacteria 141970
4 Ga0070658_10039901 3300005327 Bacteria 3788
5 Ga0070658_10048336 3300005327 Bacteria 3444
6 Ga0070658_10097584 3300005327 Bacteria 2426
7 Ga0070690_100061924 3300005330 Bacteria 2412
8 Ga0070670_100104707 3300005331 Bacteria 2437
9 Ga0070666_10049062 3300005335 Bacteria 2836
10 Ga0068868_100102048 3300005338 Bacteria 2322
11 Ga0070689_100180316 3300005340 Bacteria 1715
12 Ga0070675_100084634 3300005354 Bacteria 2649
13 Ga0070671_100012574 3300005355 Bacteria 6817
14 Ga0070671_100312475 3300005355 Bacteria 1339
15 Ga0070667_100008362 3300005367 Bacteria 8580
16 Ga0070667_100328357 3300005367 Bacteria 1381
17 Ga0070714_100374585 3300005435 Bacteria 1341
18 Ga0070714_100437388 3300005435 Bacteria 1241
19 Ga0070678_100113888 3300005456 Bacteria 2121
20 Ga0070699_100026686 3300005518 Bacteria 4982
21 Ga0070679_100096675 3300005530 Bacteria 2941
22 Ga0070679_100451006 3300005530 Bacteria 1231
23 Ga0070697_100006439 3300005536 Bacteria 9090
24 Ga0070697_100084969 3300005536 Bacteria 2611
25 Ga0068853_100152609 3300005539 Bacteria 2080
26 Ga0068853_100347644 3300005539 Bacteria 1379
27 Ga0070665_100569441 3300005548 Bacteria 1145
28 Ga0068855_100100354 3300005563 Bacteria 3333
29 Ga0070664_100213584 3300005564 Bacteria 1724
30 Ga0068854_100054137 3300005578 Bacteria 2885
31 Ga0068856_100463159 3300005614 Bacteria 1288
32 Ga0068859_100191791 3300005617 Bacteria 2128
33 Ga0068860_100865370 3300005843 Bacteria 919
34 Ga0081455_10006809 3300005937 Bacteria 12183
35 Ga0075363_100002104 3300006048 Bacteria 7982
36 Ga0075363_100021506 3300006048 Bacteria 3251
37 Ga0075364_10005544 3300006051 Bacteria 7350
38 Ga0070715_10049168 3300006163 Bacteria 1806
39 Ga0070716_100415101 3300006173 Bacteria 972
40 Ga0070712_100042786 3300006175 Bacteria 3116
41 Ga0070712_100055003 3300006175 Bacteria 2785
42 Ga0070712_100540327 3300006175 Bacteria 981
43 Ga0075362_10000481 3300006177 Bacteria 11598
44 Ga0075367_10014766 3300006178 Bacteria 4230
45 Ga0075367_10052309 3300006178 Bacteria 2417
46 Ga0075369_10031264 3300006186 Bacteria 2246
47 Ga0075369_10129326 3300006186 Bacteria 1147
48 Ga0075366_10003982 3300006195 Bacteria 7890
49 Ga0075428_100153638 3300006844 Bacteria 2500
50 Ga0075431_100043939 3300006847 Bacteria 4608
51 Ga0075429_100570078 3300006880 Bacteria 992
52 Ga0068865_100054157 3300006881 Bacteria 2786
53 Ga0075436_100000751 3300006914 Bacteria 21452
54 Ga0075436_100058711 3300006914 Bacteria 2657
55 Ga0097620_100191783 3300006931 Bacteria 2128
56 Ga0111539_10079726 3300009094 Bacteria 3851
57 Ga0114129_10084838 3300009147 Bacteria 4396
58 Ga0105238_10214890 3300009551 Bacteria 1899
59 Ga0157371_10060219 3300013102 Bacteria 2692
60 Ga0157370_10044118 3300013104 Bacteria 4287
61 Ga0157369_10074515 3300013105 Bacteria 3640
62 Ga0157369_10663321 3300013105 Bacteria 1075
63 Ga0171462_1009 3300013250 Bacteria 344993
64 Ga0157374_10031127 3300013296 Bacteria 4847
65 Ga0163162_10148921 3300013306 Bacteria 2457
66 Ga0157375_10309325 3300013308 Bacteria 1744
67 Ga0157375_10404616 3300013308 Bacteria 1531
68 Ga0163163_10020187 3300014325 Bacteria 6271
69 Ga0157379_10256653 3300014968 Bacteria 1588
70 Ga0157376_10227579 3300014969 Bacteria 1730
71 Ga0209673_1011412 3300025273 Bacteria 3666
72 Ga0209675_1001369 3300025291 Bacteria 14263
73 Ga0209564_1000019 3300025295 Bacteria 573686
74 Ga0209564_1000034 3300025295 Bacteria 444284
75 Ga0209256_1000026 3300025299 Bacteria 432835
76 Ga0207684_10019657 3300025910 Bacteria 5777
77 Ga0207693_10004227 3300025915 Bacteria 12178
78 Ga0207693_10468454 3300025915 Bacteria 984
79 Ga0207663_10018526 3300025916 Bacteria 3904
80 Ga0207657_10042169 3300025919 Bacteria 4028
81 Ga0207649_10208896 3300025920 Bacteria 1384
82 Ga0207649_10509658 3300025920 Bacteria 916
83 Ga0207652_10024274 3300025921 Bacteria 5029
84 Ga0207652_10513162 3300025921 Bacteria 1079
85 Ga0207646_10016729 3300025922 Bacteria 6879
86 Ga0207694_10084812 3300025924 Bacteria 2492
87 Ga0207694_10151324 3300025924 Bacteria 1870
88 Ga0207650_10309306 3300025925 Bacteria 1292
89 Ga0207659_10283933 3300025926 Bacteria 1354
90 Ga0207664_10340551 3300025929 Bacteria 1326
91 Ga0207664_10541255 3300025929 Bacteria 1044
92 Ga0207664_10748808 3300025929 Bacteria 879
93 Ga0207644_10077636 3300025931 Bacteria 2446
94 Ga0207679_10186741 3300025945 Bacteria 1719
95 Ga0207667_10237756 3300025949 Bacteria 1864
96 Ga0207667_10414885 3300025949 Bacteria 1370
97 Ga0207640_10086777 3300025981 Bacteria 2156
98 Ga0207640_10218333 3300025981 Bacteria 1458
99 Ga0207677_10220348 3300026023 Bacteria 1521
100 Ga0207639_10100570 3300026041 Bacteria 2336
101 Ga0207702_10207331 3300026078 Bacteria 1820
102 Ga0207702_10275539 3300026078 Bacteria 1588
103 Ga0207641_10629538 3300026088 Bacteria 1052
104 Ga0207674_10139751 3300026116 Bacteria 2382
105 Ga0207683_10012910 3300026121 Bacteria 7132
106 Ga0207698_10343830 3300026142 Bacteria 1406
107 Ga0207428_10249635 3300027907 Bacteria 1323
108 Ga0268266_10079714 3300028379 Bacteria 2851
109 Ga0265318_10013792 3300028577 Bacteria 3404
110 Ga0265330_10046772 3300031235 Bacteria 1906
111 Ga0265332_10002511 3300031238 Bacteria 9321
112 Ga0265332_10053193 3300031238 Bacteria 1738
113 Ga0265325_10000026 3300031241 Bacteria 109937
114 Ga0265325_10001335 3300031241 Bacteria 17486
115 Ga0265325_10047760 3300031241 Bacteria 2215
116 Ga0265325_10119845 3300031241 Bacteria 1269
117 Ga0265325_10164215 3300031241 Bacteria 1043
118 Ga0265329_10005922 3300031242 Bacteria 4899
119 Ga0265329_10008009 3300031242 Bacteria 4042
120 Ga0265340_10001399 3300031247 Bacteria 13839
121 Ga0265340_10007801 3300031247 Bacteria 5803
122 Ga0265340_10012598 3300031247 Bacteria 4464
123 Ga0265340_10030780 3300031247 Bacteria 2688
124 Ga0265340_10092638 3300031247 Bacteria 1411
125 Ga0265340_10184789 3300031247 Bacteria 941
126 Ga0265339_10004883 3300031249 Bacteria 9048
127 Ga0265339_10006391 3300031249 Bacteria 7740
128 Ga0265339_10010255 3300031249 Bacteria 5831
129 Ga0265339_10056301 3300031249 Bacteria 2129
130 Ga0265339_10129877 3300031249 Bacteria 1289
131 Ga0265331_10025133 3300031250 Bacteria 3008
132 Ga0265331_10026757 3300031250 Bacteria 2896
133 Ga0265313_10004781 3300031595 Bacteria 10206
134 Ga0265313_10022788 3300031595 Bacteria 3388
135 Ga0265313_10030120 3300031595 Bacteria 2798
136 Ga0265313_10034791 3300031595 Bacteria 2543
137 Ga0265314_10025305 3300031711 Bacteria 4481
138 Ga0265342_10000096 3300031712 Bacteria 97237
139 Ga0265342_10000502 3300031712 Bacteria 41908
140 Ga0265342_10018408 3300031712 Bacteria 4525
141 Ga0265342_10029803 3300031712 Bacteria 3385
142 Ga0265342_10037613 3300031712 Bacteria 2950
143 Ga0316583_10001459 3300032133 Bacteria 7894
144 Ga0373950_0004728 3300034818 Bacteria 2004
145 Ga0373934_0003489 3300035086 Bacteria 5775
146 Ga0373941_0001619 3300035115 Bacteria 4794
147 Ga0373953_0014782 3300035117 Bacteria 2815
148 Ga0373954_0019442 3300035118 Bacteria 3064
149 Ga0373954_0139860 3300035118 Bacteria 1181
150 Ga0373956_0054422 3300035119 Bacteria 1803
151 Ga0373956_0064808 3300035119 Bacteria 1659
152 Ga0373957_0016810 3300035120 Bacteria 2539
153 Ga0373955_0015536 3300035172 Bacteria 3729
154 Ga0373955_0031644 3300035172 Bacteria 2772
155 Ga0373931_0400240 3300035691 Bacteria 869
156 Ga0373933_0013185 3300035724 Bacteria 4579
157 Ga0373933_0031608 3300035724 Bacteria 3071
158 Ga0373937_0009014 3300036401 Bacteria 8660
159 Ga0373937_0023968 3300036401 Bacteria 5502
160 Ga0373937_0439327 3300036401 Bacteria 1239
161 Ga0373925_0040932 3300037068 Bacteria 3432
162 Ga0395905_0229233 3300037471 Bacteria 1737
163 Ga0395901_0596556 3300038443 Bacteria 1114
164 Ga0466966_0041958 3300044684 Bacteria 2939
165 Ga0466961_0186699 3300044693 Bacteria 1286
166 Ga0466963_0070107 3300044694 Bacteria 2357
167 Ga0466971_0084255 3300044719 Bacteria 1452
168 Ga0466957_0029696 3300044842 Bacteria 3261
169 Ga0466957_0061259 3300044842 Bacteria 2309
170 Ga0466957_0106793 3300044842 Bacteria 1771
171 Ga0466959_0147076 3300045049 Bacteria 1662
172 Ga0466958_0151003 3300045836 Bacteria 1465
173 Ga0466967_0286732 3300045976 Bacteria 1581
174 Ga0495592_0002638 3300046454 Bacteria 12675
175 Ga0495638_0003057 3300046460 Bacteria 13305
176 Ga0495651_0061723 3300046462 Bacteria 2868
177 Ga0495653_0196203 3300046463 Bacteria 1373
178 Ga0495584_0060523 3300046491 Bacteria 1904
179 Ga0495584_0108829 3300046491 Bacteria 1401
180 Ga0495608_0020177 3300046511 Bacteria 4580
181 Ga0495608_0108092 3300046511 Bacteria 1789
182 Ga0495628_0000115 3300046516 Bacteria 65159
183 Ga0495652_0003686 3300046529 Bacteria 14995
184 Ga0495652_0281643 3300046529 Bacteria 1217
185 Ga0495587_0094849 3300046536 Bacteria 1722
186 Ga0495645_0005551 3300046543 Bacteria 8673
187 Ga0495667_0000674 3300046559 Bacteria 21859
188 Ga0495667_0042070 3300046559 Bacteria 3029
189 Ga0495635_0184088 3300046663 Bacteria 1419
190 Ga0495657_0044040 3300046675 Bacteria 3039
191 Ga0495657_0143740 3300046675 Bacteria 1485
192 Ga0495599_0002434 3300046678 Bacteria 10840
193 Ga0495623_0017846 3300046679 Bacteria 4583
194 Ga0495623_0196267 3300046679 Bacteria 1163
195 Ga0495658_0079922 3300046683 Bacteria 1917
196 Ga0495600_0006421 3300046809 Bacteria 7158
197 Ga0495604_0001990 3300047317 Bacteria 16501
198 Ga0495604_0086856 3300047317 Bacteria 2331
199 Ga0495674_0017159 3300047319 Bacteria 6742
200 Ga0495672_0208239 3300047320 Bacteria 973
201 Ga0495680_0008936 3300047322 Bacteria 9057
202 Ga0495675_0034246 3300047444 Bacteria 3242
203 Ga0495675_0187617 3300047444 Bacteria 1263
204 Ga0495684_0042476 3300047471 Bacteria 3483
205 Ga0495686_0114874 3300047472 Bacteria 1611
206 Ga0495602_0003665 3300048088 Bacteria 15920
207 Ga0495602_0108651 3300048088 Bacteria 2258
208 Ga0496102_0150904 3300048905 Bacteria 2184
209 Ga0496102_0238372 3300048905 Bacteria 1715
210 Ga0496104_0049009 3300048907 Bacteria 3983
211 Ga0496105_0076222 3300048908 Bacteria 2769
212 Ga0496106_0061034 3300048909 Bacteria 2859
213 Ga0496109_0011665 3300048912 Bacteria 7557
214 Ga0496109_0430951 3300048912 Bacteria 1246
215 Ga0496110_0006994 3300048913 Bacteria 8975
216 Ga0496111_0307475 3300048914 Bacteria 1175
217 Ga0496112_0265521 3300048915 Bacteria 1665
218 Ga0496114_0480667 3300048917 Bacteria 1099
219 Ga0496115_0061552 3300048918 Bacteria 3026
220 Ga0496122_0030223 3300048925 Bacteria 4546
221 Ga0496123_0034507 3300048926 Bacteria 3622
222 Ga0496125_0035617 3300048928 Bacteria 4361
223 Ga0501032_0007222 3300049569 Bacteria 8127
224 Ga0501032_0058959 3300049569 Bacteria 2576
225 Ga0501032_0181085 3300049569 Bacteria 1379
226 Ga0501033_0036989 3300049570 Bacteria 3656
227 Ga0501034_0000229 3300049571 Bacteria 105030
228 Ga0501034_0006626 3300049571 Bacteria 12429
229 Ga0501034_0014761 3300049571 Bacteria 8040
230 Ga0501034_0068861 3300049571 Bacteria 3549
231 Ga0501034_0116929 3300049571 Bacteria 2654
232 Ga0501034_0147808 3300049571 Bacteria 2326
233 Ga0501034_0252214 3300049571 Bacteria 1709
234 Ga0501034_0421153 3300049571 Bacteria 1256
235 Ga0501034_0640388 3300049571 Bacteria 965
236 Ga0501034_0836270 3300049571 Bacteria 811
237 Ga0501036_0018229 3300049572 Bacteria 5878
238 Ga0501036_0021324 3300049572 Bacteria 5445
239 Ga0501036_0031712 3300049572 Bacteria 4465
240 Ga0501036_0263222 3300049572 Bacteria 1444
241 Ga0501036_0263318 3300049572 Bacteria 1444
242 Ga0501036_0377244 3300049572 Bacteria 1183
243 Ga0501036_0414997 3300049572 Bacteria 1122
244 Ga0501037_0008787 3300049573 Bacteria 7408
245 Ga0501037_0022361 3300049573 Bacteria 4677
246 Ga0501037_0105238 3300049573 Bacteria 2034
247 Ga0501037_0134886 3300049573 Bacteria 1768
248 Ga0501037_0198882 3300049573 Bacteria 1417
249 Ga0501038_0012968 3300049574 Bacteria 7604
250 Ga0501038_0014526 3300049574 Bacteria 7176
251 Ga0501038_0021143 3300049574 Bacteria 5845
252 Ga0501038_0103198 3300049574 Bacteria 2371
253 Ga0501038_0105953 3300049574 Bacteria 2335
254 Ga0501038_0146252 3300049574 Bacteria 1929
255 Ga0501038_0236364 3300049574 Bacteria 1452
256 Ga0501039_0091370 3300049575 Bacteria 2372
257 Ga0501039_0453425 3300049575 Bacteria 1007
258 Ga0501043_0037170 3300049579 Bacteria 3830
259 Ga0501043_0051152 3300049579 Bacteria 3247
260 Ga0501043_0098909 3300049579 Bacteria 2293
261 Ga0501046_0211059 3300049580 Bacteria 1441
262 Ga0501047_0022619 3300049581 Bacteria 6037
263 Ga0501047_0025934 3300049581 Bacteria 5636
264 Ga0501047_0027613 3300049581 Bacteria 5468
265 Ga0501047_0032229 3300049581 Bacteria 5058
266 Ga0501047_0054122 3300049581 Bacteria 3882
267 Ga0501047_0125308 3300049581 Bacteria 2449
268 Ga0501047_0521826 3300049581 Bacteria 1013
269 Ga0501048_0093364 3300049582 Bacteria 2123
270 Ga0501048_0236708 3300049582 Bacteria 1295
271 Ga0501067_0064889 3300049583 Bacteria 2021
272 Ga0501068_0011475 3300049584 Bacteria 5001
273 Ga0501068_0058660 3300049584 Bacteria 2336
274 Ga0501068_0099169 3300049584 Bacteria 1804
275 Ga0501068_0129319 3300049584 Bacteria 1579
276 Ga0501068_0475487 3300049584 Bacteria 809
277 Ga0501069_0006944 3300049585 Bacteria 5919
278 Ga0501069_0221162 3300049585 Bacteria 1100
279 Ga0501069_0276079 3300049585 Bacteria 983
280 Ga0501070_0010573 3300049586 Bacteria 7800
281 Ga0501070_0013531 3300049586 Bacteria 6878
282 Ga0501070_0013828 3300049586 Bacteria 6798
283 Ga0501070_0029595 3300049586 Bacteria 4590
284 Ga0501070_0118200 3300049586 Bacteria 2190
285 Ga0501070_0119687 3300049586 Bacteria 2176
286 Ga0501070_0163363 3300049586 Bacteria 1835
287 Ga0501070_0250312 3300049586 Bacteria 1449
288 Ga0501071_0084121 3300049587 Bacteria 2331
289 Ga0501071_0577676 3300049587 Bacteria 864
290 Ga0501072_0077398 3300049588 Bacteria 2633
291 Ga0501072_0190505 3300049588 Bacteria 1635
292 Ga0501073_0015560 3300049589 Bacteria 5518
293 Ga0501073_0023790 3300049589 Bacteria 4398
294 Ga0501073_0148040 3300049589 Bacteria 1627
295 Ga0501074_0033631 3300049590 Bacteria 3715
296 Ga0501076_0280431 3300049592 Bacteria 1365
297 Ga0501080_0038786 3300049742 Bacteria 4446
298 Ga0501080_0069195 3300049742 Bacteria 3283
299 Ga0501080_0073195 3300049742 Bacteria 3187
300 Ga0501080_0327119 3300049742 Bacteria 1387
301 Ga0501080_0718152 3300049742 Bacteria 880
302 Ga0501083_0020987 3300049744 Bacteria 4540
303 Ga0501083_0047537 3300049744 Bacteria 2899
304 Ga0501083_0098104 3300049744 Bacteria 1933
305 Ga0501083_0215759 3300049744 Bacteria 1250
306 Ga0501269_015540 3300049766 Bacteria 935
307 Ga0501035_0008967 3300049822 Bacteria 9304
308 Ga0501035_0068558 3300049822 Bacteria 3145
309 Ga0501035_0071787 3300049822 Bacteria 3064
310 Ga0501035_0085335 3300049822 Bacteria 2783
311 Ga0501035_0100624 3300049822 Bacteria 2537
312 Ga0501044_0011798 3300049823 Bacteria 9467
313 Ga0501044_0023027 3300049823 Bacteria 6629
314 Ga0501044_0026694 3300049823 Bacteria 6113
315 Ga0501044_0071642 3300049823 Bacteria 3524
316 Ga0501044_0124260 3300049823 Bacteria 2578
317 Ga0501044_0149544 3300049823 Bacteria 2318
318 Ga0501044_0389676 3300049823 Bacteria 1307
319 Ga0501044_0440138 3300049823 Bacteria 1211
320 Ga0501044_0648494 3300049823 Bacteria 945
321 nmdc:mga03683_7813_c1 3300050489 Bacteria 3732
322 nmdc:mga03n38_29668_c1 3300050490 Bacteria 2292
323 nmdc:mga00v17_1740_c1 3300050491 Bacteria 11314
324 nmdc:mga0k408_9763_c1 3300050493 Bacteria 2935
325 nmdc:mga06z11_12741_c1 3300050494 Bacteria 3666
326 nmdc:mga05p37_6329_c2 3300050507 Bacteria 4315
327 nmdc:mga0qj67_101865_c1 3300050509 Bacteria 2315
328 nmdc:mga08y16_299955_c1 3300050511 Bacteria 1656
329 nmdc:mga08x19_22_c1 3300050514 Bacteria 297462
330 nmdc:mga08x19_321933_c1 3300050514 Bacteria 1076
331 nmdc:mga0a205_96472_c1 3300050515 Bacteria 2855
332 nmdc:mga0sz30_24001_c2 3300050516 Bacteria 1836
333 Ga0495601_0000305 3300053077 Bacteria 26104
334 Ga0495601_0003725 3300053077 Bacteria 8772
335 Ga0495612_0000569 3300053078 Bacteria 14847
336 Ga0495595_0002638 3300053084 Bacteria 7037
337 Ga0495595_0012356 3300053084 Bacteria 3588
338 Ga0495595_0035724 3300053084 Bacteria 2251
339 Ga0495595_0045246 3300053084 Bacteria 2024
340 Ga0495619_0000159 3300053085 Bacteria 49689
341 Ga0495619_0131298 3300053085 Bacteria 1721
342 Ga0500643_005890 3300053087 Bacteria 5206
343 Ga0500644_0000375 3300053088 Bacteria 21830
344 Ga0500646_0039383 3300053090 Bacteria 1326
345 Ga0500651_0010644 3300053093 Bacteria 5525
346 Ga0500651_0194353 3300053093 Bacteria 1200
347 Ga0500641_0104883 3300053096 Bacteria 1214
348 Ga0500593_040824 3300053117 Bacteria 2074
349 Ga0500595_000002 3300053119 Bacteria 1074388
350 Ga0500568_0004977 3300053139 Bacteria 6970
351 Ga0500588_0019122 3300053146 Bacteria 1817
352 Ga0500616_0000002 3300053153 Bacteria 1611257
353 Ga0500616_0057280 3300053153 Bacteria 2031
354 Ga0500636_0001137 3300053177 Bacteria 14272
355 Ga0500645_000252 3300053730 Bacteria 39375
356 Ga0501082_0001121 3300060353 Bacteria 23660
357 Ga0501082_0091638 3300060353 Bacteria 2624
358 Ga0501082_0290649 3300060353 Bacteria 1423
359 Ga0501082_0656710 3300060353 Bacteria 918
360 Ga0466962_0046117 3300061719 Bacteria 2083

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050516 nmdc:mga0sz30_24001_c2 nmdc:mga0sz30_24001_c2_573_1178 192
2 3300005548 Ga0070665_100569441 Ga0070665_1005694411 206
3 3300025925 Ga0207650_10309306 Ga0207650_103093062 206
4 3300025926 Ga0207659_10283933 Ga0207659_102839332 206
5 3300026088 Ga0207641_10629538 Ga0207641_106295382 206
6 3300028379 Ga0268266_10079714 Ga0268266_100797143 206
7 3300025931 Ga0207644_10077636 Ga0207644_100776363 217
8 3300026121 Ga0207683_10012910 Ga0207683_100129104 217
9 3300049569 Ga0501032_0058959 Ga0501032_0058959_819_1550 222
10 3300049572 Ga0501036_0263222 Ga0501036_0263222_681_1412 222
11 3300049581 Ga0501047_0025934 Ga0501047_0025934_180_911 222
12 3300049744 Ga0501083_0047537 Ga0501083_0047537_896_1627 222
13 3300035115 Ga0373941_0001619 Ga0373941_0001619_1152_1883 223
14 3300049571 Ga0501034_0836270 Ga0501034_0836270_34_765 223
15 3300049584 Ga0501068_0099169 Ga0501068_0099169_681_1412 223
16 3300049822 Ga0501035_0071787 Ga0501035_0071787_1445_2176 223
17 3300045836 Ga0466958_0151003 Ga0466958_0151003_33_731 225
18 3300049569 Ga0501032_0007222 Ga0501032_0007222_318_1058 226
19 3300049571 Ga0501034_0068861 Ga0501034_0068861_1815_2555 226
20 3300049572 Ga0501036_0414997 Ga0501036_0414997_213_953 226
21 3300049573 Ga0501037_0008787 Ga0501037_0008787_2046_2786 226
22 3300049574 Ga0501038_0014526 Ga0501038_0014526_2831_3571 226
23 3300049575 Ga0501039_0453425 Ga0501039_0453425_244_984 226
24 3300049581 Ga0501047_0032229 Ga0501047_0032229_388_1128 226
25 3300049586 Ga0501070_0163363 Ga0501070_0163363_165_905 226
26 3300049822 Ga0501035_0008967 Ga0501035_0008967_6831_7571 226
27 3300049823 Ga0501044_0023027 Ga0501044_0023027_1785_2525 226
28 3300026142 Ga0207698_10343830 Ga0207698_103438302 227
29 3300031238 Ga0265332_10002511 Ga0265332_100025113 227
30 3300031242 Ga0265329_10005922 Ga0265329_100059222 227
31 3300031247 Ga0265340_10001399 Ga0265340_100013993 227
32 3300031249 Ga0265339_10006391 Ga0265339_100063917 227
33 3300031250 Ga0265331_10025133 Ga0265331_100251333 227
34 3300031712 Ga0265342_10000096 Ga0265342_1000009649 227
35 3300049587 Ga0501071_0577676 Ga0501071_0577676_31_717 227
36 3300049571 Ga0501034_0421153 Ga0501034_0421153_404_1144 228
37 3300049589 Ga0501073_0015560 Ga0501073_0015560_1712_2443 228
38 3300049823 Ga0501044_0124260 Ga0501044_0124260_1157_1888 228
39 3300049823 Ga0501044_0648494 Ga0501044_0648494_190_930 228
40 3300005330 Ga0070690_100061924 Ga0070690_1000619242 229
41 3300005331 Ga0070670_100104707 Ga0070670_1001047072 229
42 3300005335 Ga0070666_10049062 Ga0070666_100490622 229
43 3300005338 Ga0068868_100102048 Ga0068868_1001020482 229
44 3300005354 Ga0070675_100084634 Ga0070675_1000846342 229
45 3300005367 Ga0070667_100008362 Ga0070667_1000083624 229
46 3300005617 Ga0068859_100191791 Ga0068859_1001917913 229
47 3300006931 Ga0097620_100191783 Ga0097620_1001917833 229
48 3300013296 Ga0157374_10031127 Ga0157374_100311272 229
49 3300013308 Ga0157375_10404616 Ga0157375_104046162 229
50 3300026023 Ga0207677_10220348 Ga0207677_102203482 229
51 3300005327 Ga0070658_10048336 Ga0070658_100483364 230
52 3300013102 Ga0157371_10060219 Ga0157371_100602192 230
53 3300013104 Ga0157370_10044118 Ga0157370_100441183 230
54 3300013105 Ga0157369_10074515 Ga0157369_100745153 230
55 3300025981 Ga0207640_10086777 Ga0207640_100867772 230
56 3300031235 Ga0265330_10046772 Ga0265330_100467722 232
57 3300031247 Ga0265340_10030780 Ga0265340_100307804 232
58 3300049571 Ga0501034_0116929 Ga0501034_0116929_430_1170 232
59 3300049573 Ga0501037_0105238 Ga0501037_0105238_1050_1790 232
60 3300049574 Ga0501038_0236364 Ga0501038_0236364_620_1360 232
61 3300049579 Ga0501043_0098909 Ga0501043_0098909_1295_2035 232
62 3300049581 Ga0501047_0054122 Ga0501047_0054122_190_924 232
63 3300049586 Ga0501070_0013828 Ga0501070_0013828_923_1663 232
64 3300049587 Ga0501071_0084121 Ga0501071_0084121_1448_2188 232
65 3300049823 Ga0501044_0149544 Ga0501044_0149544_395_1135 232
66 iso_pu_bacteria 2841911363 2841912621 233
67 iso_pu_bacteria 2841917233 2841918376 233
68 3300005340 Ga0070689_100180316 Ga0070689_1001803162 234
69 3300005435 Ga0070714_100437388 Ga0070714_1004373882 234
70 3300005843 Ga0068860_100865370 Ga0068860_1008653702 234
71 3300006175 Ga0070712_100540327 Ga0070712_1005403271 234
72 3300014969 Ga0157376_10227579 Ga0157376_102275792 234
73 3300025915 Ga0207693_10468454 Ga0207693_104684542 234
74 3300025916 Ga0207663_10018526 Ga0207663_100185262 234
75 3300025929 Ga0207664_10748808 Ga0207664_107488081 234
76 3300026078 Ga0207702_10207331 Ga0207702_102073312 234
77 3300031249 Ga0265339_10129877 Ga0265339_101298771 234
78 3300031712 Ga0265342_10037613 Ga0265342_100376133 234
79 3300006048 Ga0075363_100021506 Ga0075363_1000215062 235
80 3300031247 Ga0265340_10184789 Ga0265340_101847891 235
81 iso_pu_bacteria 2643221733 2644727827 236
82 iso_pu_bacteria 2643221734 2644733627 236
83 iso_pu_bacteria 2909042592 2909045154 236
84 iso_pu_bacteria 2917699015 2917701399 236
85 3300044694 Ga0466963_0070107 Ga0466963_0070107_103_825 237
86 3300044842 Ga0466957_0029696 Ga0466957_0029696_350_1072 237
87 3300044842 Ga0466957_0106793 Ga0466957_0106793_401_1123 237
88 3300049579 Ga0501043_0051152 Ga0501043_0051152_819_1556 237
89 iso_pu_bacteria 2829745981 2829748135 237
90 3300005327 Ga0070658_10097584 Ga0070658_100975842 238
91 3300005435 Ga0070714_100374585 Ga0070714_1003745852 238
92 3300005530 Ga0070679_100096675 Ga0070679_1000966752 238
93 3300006175 Ga0070712_100055003 Ga0070712_1000550033 238
94 3300025929 Ga0207664_10340551 Ga0207664_103405512 238
95 3300044684 Ga0466966_0041958 Ga0466966_0041958_939_1685 238
96 3300044693 Ga0466961_0186699 Ga0466961_0186699_206_952 238
97 3300044719 Ga0466971_0084255 Ga0466971_0084255_236_982 238
98 3300044842 Ga0466957_0061259 Ga0466957_0061259_442_1188 238
99 3300045049 Ga0466959_0147076 Ga0466959_0147076_408_1154 238
100 3300045976 Ga0466967_0286732 Ga0466967_0286732_693_1439 238
101 3300053088 Ga0500644_0000375 Ga0500644_0000375_8177_8902 238
102 3300053090 Ga0500646_0039383 Ga0500646_0039383_264_989 238
103 3300053093 Ga0500651_0010644 Ga0500651_0010644_1654_2379 238
104 3300053093 Ga0500651_0194353 Ga0500651_0194353_175_912 238
105 3300053119 Ga0500595_000002 Ga0500595_000002_855544_856269 238
106 3300053153 Ga0500616_0000002 Ga0500616_0000002_960783_961508 238
107 3300053730 Ga0500645_000252 Ga0500645_000252_1934_2659 238
108 3300061719 Ga0466962_0046117 Ga0466962_0046117_54_800 238
109 3300025920 Ga0207649_10509658 Ga0207649_105096581 239
110 3300047320 Ga0495672_0208239 Ga0495672_0208239_88_819 239
111 3300049571 Ga0501034_0000229 Ga0501034_0000229_43274_44002 239
112 3300049573 Ga0501037_0198882 Ga0501037_0198882_227_952 239
113 3300049588 Ga0501072_0190505 Ga0501072_0190505_520_1245 239
114 3300049744 Ga0501083_0215759 Ga0501083_0215759_462_1187 239
115 3300049823 Ga0501044_0071642 Ga0501044_0071642_2322_3047 239
116 iso_pu_bacteria 2828305725 2828305879 239
117 iso_pu_bacteria 2891088606 2891089833 239
118 3300003771 Ga0055526_1000108 Ga0055526_100010826 240
119 3300003771 Ga0055526_1000241 Ga0055526_100024138 240
120 3300003775 Ga0055524_1000055 Ga0055524_100005526 240
121 3300005327 Ga0070658_10039901 Ga0070658_100399013 240
122 3300005355 Ga0070671_100012574 Ga0070671_1000125743 240
123 3300005355 Ga0070671_100312475 Ga0070671_1003124752 240
124 3300005367 Ga0070667_100328357 Ga0070667_1003283572 240
125 3300005456 Ga0070678_100113888 Ga0070678_1001138883 240
126 3300005518 Ga0070699_100026686 Ga0070699_1000266863 240
127 3300005530 Ga0070679_100451006 Ga0070679_1004510062 240
128 3300005536 Ga0070697_100006439 Ga0070697_1000064395 240
129 3300005536 Ga0070697_100084969 Ga0070697_1000849693 240
130 3300005539 Ga0068853_100152609 Ga0068853_1001526092 240
131 3300005539 Ga0068853_100347644 Ga0068853_1003476442 240
132 3300005563 Ga0068855_100100354 Ga0068855_1001003543 240
133 3300005564 Ga0070664_100213584 Ga0070664_1002135841 240
134 3300005578 Ga0068854_100054137 Ga0068854_1000541371 240
135 3300005614 Ga0068856_100463159 Ga0068856_1004631592 240
136 3300005937 Ga0081455_10006809 Ga0081455_100068098 240
137 3300006048 Ga0075363_100002104 Ga0075363_1000021043 240
138 3300006051 Ga0075364_10005544 Ga0075364_100055443 240
139 3300006163 Ga0070715_10049168 Ga0070715_100491682 240
140 3300006173 Ga0070716_100415101 Ga0070716_1004151012 240
141 3300006175 Ga0070712_100042786 Ga0070712_1000427862 240
142 3300006177 Ga0075362_10000481 Ga0075362_100004815 240
143 3300006178 Ga0075367_10014766 Ga0075367_100147663 240
144 3300006178 Ga0075367_10052309 Ga0075367_100523092 240
145 3300006186 Ga0075369_10031264 Ga0075369_100312643 240
146 3300006186 Ga0075369_10129326 Ga0075369_101293262 240
147 3300006195 Ga0075366_10003982 Ga0075366_100039825 240
148 3300006844 Ga0075428_100153638 Ga0075428_1001536382 240
149 3300006847 Ga0075431_100043939 Ga0075431_1000439394 240
150 3300006880 Ga0075429_100570078 Ga0075429_1005700782 240
151 3300006881 Ga0068865_100054157 Ga0068865_1000541572 240
152 3300006914 Ga0075436_100000751 Ga0075436_10000075113 240
153 3300006914 Ga0075436_100058711 Ga0075436_1000587112 240
154 3300009094 Ga0111539_10079726 Ga0111539_100797262 240
155 3300009147 Ga0114129_10084838 Ga0114129_100848384 240
156 3300009551 Ga0105238_10214890 Ga0105238_102148902 240
157 3300013105 Ga0157369_10663321 Ga0157369_106633211 240
158 3300013250 Ga0171462_1009 Ga0171462_1009268 240
159 3300013306 Ga0163162_10148921 Ga0163162_101489212 240
160 3300013308 Ga0157375_10309325 Ga0157375_103093252 240
161 3300014325 Ga0163163_10020187 Ga0163163_100201872 240
162 3300014968 Ga0157379_10256653 Ga0157379_102566531 240
163 3300025273 Ga0209673_1011412 Ga0209673_10114122 240
164 3300025291 Ga0209675_1001369 Ga0209675_100136911 240
165 3300025295 Ga0209564_1000019 Ga0209564_100001939 240
166 3300025295 Ga0209564_1000034 Ga0209564_100003438 240
167 3300025299 Ga0209256_1000026 Ga0209256_100002626 240
168 3300025910 Ga0207684_10019657 Ga0207684_100196577 240
169 3300025915 Ga0207693_10004227 Ga0207693_1000422710 240
170 3300025919 Ga0207657_10042169 Ga0207657_100421693 240
171 3300025920 Ga0207649_10208896 Ga0207649_102088961 240
172 3300025921 Ga0207652_10024274 Ga0207652_100242744 240
173 3300025921 Ga0207652_10513162 Ga0207652_105131621 240
174 3300025922 Ga0207646_10016729 Ga0207646_100167296 240
175 3300025924 Ga0207694_10084812 Ga0207694_100848122 240
176 3300025924 Ga0207694_10151324 Ga0207694_101513242 240
177 3300025929 Ga0207664_10541255 Ga0207664_105412552 240
178 3300025945 Ga0207679_10186741 Ga0207679_101867411 240
179 3300025949 Ga0207667_10237756 Ga0207667_102377563 240
180 3300025949 Ga0207667_10414885 Ga0207667_104148851 240
181 3300025981 Ga0207640_10218333 Ga0207640_102183331 240
182 3300026041 Ga0207639_10100570 Ga0207639_101005702 240
183 3300026078 Ga0207702_10275539 Ga0207702_102755392 240
184 3300026116 Ga0207674_10139751 Ga0207674_101397511 240
185 3300027907 Ga0207428_10249635 Ga0207428_102496351 240
186 3300028577 Ga0265318_10013792 Ga0265318_100137922 240
187 3300031238 Ga0265332_10053193 Ga0265332_100531932 240
188 3300031241 Ga0265325_10000026 Ga0265325_1000002673 240
189 3300031241 Ga0265325_10001335 Ga0265325_100013359 240
190 3300031241 Ga0265325_10047760 Ga0265325_100477602 240
191 3300031241 Ga0265325_10119845 Ga0265325_101198452 240
192 3300031241 Ga0265325_10164215 Ga0265325_101642151 240
193 3300031242 Ga0265329_10008009 Ga0265329_100080092 240
194 3300031247 Ga0265340_10007801 Ga0265340_100078013 240
195 3300031247 Ga0265340_10012598 Ga0265340_100125983 240
196 3300031247 Ga0265340_10092638 Ga0265340_100926382 240
197 3300031249 Ga0265339_10004883 Ga0265339_100048838 240
198 3300031249 Ga0265339_10010255 Ga0265339_100102555 240
199 3300031249 Ga0265339_10056301 Ga0265339_100563013 240
200 3300031250 Ga0265331_10026757 Ga0265331_100267573 240
201 3300031595 Ga0265313_10004781 Ga0265313_100047816 240
202 3300031595 Ga0265313_10022788 Ga0265313_100227881 240
203 3300031595 Ga0265313_10030120 Ga0265313_100301202 240
204 3300031595 Ga0265313_10034791 Ga0265313_100347912 240
205 3300031711 Ga0265314_10025305 Ga0265314_100253053 240
206 3300031712 Ga0265342_10000502 Ga0265342_1000050225 240
207 3300031712 Ga0265342_10018408 Ga0265342_100184085 240
208 3300031712 Ga0265342_10029803 Ga0265342_100298032 240
209 3300032133 Ga0316583_10001459 Ga0316583_100014597 240
210 3300034818 Ga0373950_0004728 Ga0373950_0004728_842_1573 240
211 3300035086 Ga0373934_0003489 Ga0373934_0003489_853_1590 240
212 3300035117 Ga0373953_0014782 Ga0373953_0014782_403_1140 240
213 3300035118 Ga0373954_0019442 Ga0373954_0019442_406_1143 240
214 3300035118 Ga0373954_0139860 Ga0373954_0139860_269_1006 240
215 3300035119 Ga0373956_0054422 Ga0373956_0054422_492_1229 240
216 3300035119 Ga0373956_0064808 Ga0373956_0064808_856_1593 240
217 3300035120 Ga0373957_0016810 Ga0373957_0016810_521_1255 240
218 3300035172 Ga0373955_0015536 Ga0373955_0015536_2459_3196 240
219 3300035172 Ga0373955_0031644 Ga0373955_0031644_1086_1820 240
220 3300035691 Ga0373931_0400240 Ga0373931_0400240_70_825 240
221 3300035724 Ga0373933_0013185 Ga0373933_0013185_1516_2253 240
222 3300035724 Ga0373933_0031608 Ga0373933_0031608_1174_1908 240
223 3300036401 Ga0373937_0009014 Ga0373937_0009014_5511_6245 240
224 3300036401 Ga0373937_0023968 Ga0373937_0023968_138_875 240
225 3300036401 Ga0373937_0439327 Ga0373937_0439327_429_1163 240
226 3300037068 Ga0373925_0040932 Ga0373925_0040932_1272_2006 240
227 3300037471 Ga0395905_0229233 Ga0395905_0229233_424_1152 240
228 3300038443 Ga0395901_0596556 Ga0395901_0596556_204_941 240
229 3300046454 Ga0495592_0002638 Ga0495592_0002638_11233_11967 240
230 3300046460 Ga0495638_0003057 Ga0495638_0003057_10506_11237 240
231 3300046462 Ga0495651_0061723 Ga0495651_0061723_132_866 240
232 3300046463 Ga0495653_0196203 Ga0495653_0196203_454_1188 240
233 3300046491 Ga0495584_0060523 Ga0495584_0060523_142_876 240
234 3300046491 Ga0495584_0108829 Ga0495584_0108829_626_1357 240
235 3300046511 Ga0495608_0020177 Ga0495608_0020177_3810_4544 240
236 3300046511 Ga0495608_0108092 Ga0495608_0108092_971_1708 240
237 3300046516 Ga0495628_0000115 Ga0495628_0000115_24292_25026 240
238 3300046529 Ga0495652_0003686 Ga0495652_0003686_7161_7895 240
239 3300046529 Ga0495652_0281643 Ga0495652_0281643_308_1045 240
240 3300046536 Ga0495587_0094849 Ga0495587_0094849_528_1265 240
241 3300046543 Ga0495645_0005551 Ga0495645_0005551_2725_3459 240
242 3300046559 Ga0495667_0000674 Ga0495667_0000674_744_1478 240
243 3300046559 Ga0495667_0042070 Ga0495667_0042070_1647_2384 240
244 3300046663 Ga0495635_0184088 Ga0495635_0184088_256_993 240
245 3300046675 Ga0495657_0044040 Ga0495657_0044040_1313_2047 240
246 3300046675 Ga0495657_0143740 Ga0495657_0143740_315_1052 240
247 3300046678 Ga0495599_0002434 Ga0495599_0002434_6063_6797 240
248 3300046679 Ga0495623_0017846 Ga0495623_0017846_755_1489 240
249 3300046679 Ga0495623_0196267 Ga0495623_0196267_57_794 240
250 3300046683 Ga0495658_0079922 Ga0495658_0079922_1035_1769 240
251 3300046809 Ga0495600_0006421 Ga0495600_0006421_5113_5847 240
252 3300047317 Ga0495604_0001990 Ga0495604_0001990_5083_5817 240
253 3300047317 Ga0495604_0086856 Ga0495604_0086856_1178_1915 240
254 3300047319 Ga0495674_0017159 Ga0495674_0017159_5627_6361 240
255 3300047322 Ga0495680_0008936 Ga0495680_0008936_4017_4751 240
256 3300047444 Ga0495675_0034246 Ga0495675_0034246_1386_2120 240
257 3300047444 Ga0495675_0187617 Ga0495675_0187617_358_1095 240
258 3300047471 Ga0495684_0042476 Ga0495684_0042476_2118_2852 240
259 3300047472 Ga0495686_0114874 Ga0495686_0114874_196_957 240
260 3300048088 Ga0495602_0003665 Ga0495602_0003665_13171_13905 240
261 3300048088 Ga0495602_0108651 Ga0495602_0108651_10_747 240
262 3300048905 Ga0496102_0150904 Ga0496102_0150904_762_1511 240
263 3300048905 Ga0496102_0238372 Ga0496102_0238372_569_1324 240
264 3300048907 Ga0496104_0049009 Ga0496104_0049009_1829_2584 240
265 3300048908 Ga0496105_0076222 Ga0496105_0076222_708_1463 240
266 3300048909 Ga0496106_0061034 Ga0496106_0061034_1188_1943 240
267 3300048912 Ga0496109_0011665 Ga0496109_0011665_6216_6971 240
268 3300048912 Ga0496109_0430951 Ga0496109_0430951_114_863 240
269 3300048913 Ga0496110_0006994 Ga0496110_0006994_2250_3005 240
270 3300048914 Ga0496111_0307475 Ga0496111_0307475_320_1069 240
271 3300048915 Ga0496112_0265521 Ga0496112_0265521_622_1371 240
272 3300048917 Ga0496114_0480667 Ga0496114_0480667_225_980 240
273 3300048918 Ga0496115_0061552 Ga0496115_0061552_1199_1954 240
274 3300048925 Ga0496122_0030223 Ga0496122_0030223_2656_3378 240
275 3300048926 Ga0496123_0034507 Ga0496123_0034507_1106_1828 240
276 3300048928 Ga0496125_0035617 Ga0496125_0035617_1369_2091 240
277 3300049569 Ga0501032_0181085 Ga0501032_0181085_128_859 240
278 3300049570 Ga0501033_0036989 Ga0501033_0036989_1329_2060 240
279 3300049571 Ga0501034_0006626 Ga0501034_0006626_11455_12192 240
280 3300049571 Ga0501034_0014761 Ga0501034_0014761_6976_7707 240
281 3300049571 Ga0501034_0147808 Ga0501034_0147808_968_1699 240
282 3300049571 Ga0501034_0252214 Ga0501034_0252214_303_1034 240
283 3300049571 Ga0501034_0640388 Ga0501034_0640388_66_797 240
284 3300049572 Ga0501036_0018229 Ga0501036_0018229_3155_3886 240
285 3300049572 Ga0501036_0021324 Ga0501036_0021324_3441_4172 240
286 3300049572 Ga0501036_0031712 Ga0501036_0031712_3495_4226 240
287 3300049572 Ga0501036_0263318 Ga0501036_0263318_289_1023 240
288 3300049572 Ga0501036_0377244 Ga0501036_0377244_11_742 240
289 3300049573 Ga0501037_0022361 Ga0501037_0022361_1123_1854 240
290 3300049573 Ga0501037_0134886 Ga0501037_0134886_24_752 240
291 3300049574 Ga0501038_0012968 Ga0501038_0012968_2419_3150 240
292 3300049574 Ga0501038_0021143 Ga0501038_0021143_11_742 240
293 3300049574 Ga0501038_0103198 Ga0501038_0103198_367_1098 240
294 3300049574 Ga0501038_0105953 Ga0501038_0105953_1475_2203 240
295 3300049574 Ga0501038_0146252 Ga0501038_0146252_832_1563 240
296 3300049575 Ga0501039_0091370 Ga0501039_0091370_846_1577 240
297 3300049579 Ga0501043_0037170 Ga0501043_0037170_2700_3431 240
298 3300049580 Ga0501046_0211059 Ga0501046_0211059_589_1320 240
299 3300049581 Ga0501047_0022619 Ga0501047_0022619_421_1158 240
300 3300049581 Ga0501047_0027613 Ga0501047_0027613_2590_3321 240
301 3300049581 Ga0501047_0125308 Ga0501047_0125308_278_1015 240
302 3300049581 Ga0501047_0521826 Ga0501047_0521826_245_976 240
303 3300049582 Ga0501048_0093364 Ga0501048_0093364_10_741 240
304 3300049582 Ga0501048_0236708 Ga0501048_0236708_405_1136 240
305 3300049583 Ga0501067_0064889 Ga0501067_0064889_1268_1999 240
306 3300049584 Ga0501068_0011475 Ga0501068_0011475_1271_2002 240
307 3300049584 Ga0501068_0058660 Ga0501068_0058660_1389_2120 240
308 3300049584 Ga0501068_0129319 Ga0501068_0129319_752_1483 240
309 3300049584 Ga0501068_0475487 Ga0501068_0475487_21_752 240
310 3300049585 Ga0501069_0006944 Ga0501069_0006944_2026_2844 240
311 3300049585 Ga0501069_0221162 Ga0501069_0221162_20_751 240
312 3300049585 Ga0501069_0276079 Ga0501069_0276079_77_814 240
313 3300049586 Ga0501070_0010573 Ga0501070_0010573_3158_3976 240
314 3300049586 Ga0501070_0013531 Ga0501070_0013531_2584_3315 240
315 3300049586 Ga0501070_0029595 Ga0501070_0029595_1485_2216 240
316 3300049586 Ga0501070_0118200 Ga0501070_0118200_543_1274 240
317 3300049586 Ga0501070_0119687 Ga0501070_0119687_132_863 240
318 3300049586 Ga0501070_0250312 Ga0501070_0250312_655_1392 240
319 3300049588 Ga0501072_0077398 Ga0501072_0077398_1563_2294 240
320 3300049589 Ga0501073_0023790 Ga0501073_0023790_1554_2285 240
321 3300049589 Ga0501073_0148040 Ga0501073_0148040_359_1090 240
322 3300049590 Ga0501074_0033631 Ga0501074_0033631_2930_3661 240
323 3300049592 Ga0501076_0280431 Ga0501076_0280431_503_1234 240
324 3300049742 Ga0501080_0038786 Ga0501080_0038786_89_820 240
325 3300049742 Ga0501080_0069195 Ga0501080_0069195_1240_2058 240
326 3300049742 Ga0501080_0073195 Ga0501080_0073195_1076_1807 240
327 3300049742 Ga0501080_0327119 Ga0501080_0327119_594_1331 240
328 3300049742 Ga0501080_0718152 Ga0501080_0718152_121_852 240
329 3300049744 Ga0501083_0020987 Ga0501083_0020987_1648_2379 240
330 3300049744 Ga0501083_0098104 Ga0501083_0098104_851_1582 240
331 3300049766 Ga0501269_015540 Ga0501269_015540_28_756 240
332 3300049822 Ga0501035_0068558 Ga0501035_0068558_395_1132 240
333 3300049822 Ga0501035_0085335 Ga0501035_0085335_853_1584 240
334 3300049822 Ga0501035_0100624 Ga0501035_0100624_445_1176 240
335 3300049823 Ga0501044_0011798 Ga0501044_0011798_7376_8107 240
336 3300049823 Ga0501044_0026694 Ga0501044_0026694_4116_4853 240
337 3300049823 Ga0501044_0389676 Ga0501044_0389676_347_1081 240
338 3300049823 Ga0501044_0440138 Ga0501044_0440138_295_1026 240
339 3300050489 nmdc:mga03683_7813_c1 nmdc:mga03683_7813_c1_145_873 240
340 3300050490 nmdc:mga03n38_29668_c1 nmdc:mga03n38_29668_c1_1302_2030 240
341 3300050491 nmdc:mga00v17_1740_c1 nmdc:mga00v17_1740_c1_8366_9094 240
342 3300050493 nmdc:mga0k408_9763_c1 nmdc:mga0k408_9763_c1_1297_2025 240
343 3300050494 nmdc:mga06z11_12741_c1 nmdc:mga06z11_12741_c1_2075_2803 240
344 3300050507 nmdc:mga05p37_6329_c2 nmdc:mga05p37_6329_c2_2664_3398 240
345 3300050509 nmdc:mga0qj67_101865_c1 nmdc:mga0qj67_101865_c1_394_1125 240
346 3300050511 nmdc:mga08y16_299955_c1 nmdc:mga08y16_299955_c1_456_1205 240
347 3300050514 nmdc:mga08x19_22_c1 nmdc:mga08x19_22_c1_232760_233491 240
348 3300050514 nmdc:mga08x19_321933_c1 nmdc:mga08x19_321933_c1_162_896 240
349 3300050515 nmdc:mga0a205_96472_c1 nmdc:mga0a205_96472_c1_522_1256 240
350 3300053077 Ga0495601_0000305 Ga0495601_0000305_21621_22355 240
351 3300053077 Ga0495601_0003725 Ga0495601_0003725_7574_8311 240
352 3300053078 Ga0495612_0000569 Ga0495612_0000569_6706_7440 240
353 3300053084 Ga0495595_0002638 Ga0495595_0002638_969_1703 240
354 3300053084 Ga0495595_0012356 Ga0495595_0012356_1822_2556 240
355 3300053084 Ga0495595_0035724 Ga0495595_0035724_1299_2036 240
356 3300053084 Ga0495595_0045246 Ga0495595_0045246_1186_1920 240
357 3300053085 Ga0495619_0000159 Ga0495619_0000159_28632_29366 240
358 3300053085 Ga0495619_0131298 Ga0495619_0131298_276_1013 240
359 3300053087 Ga0500643_005890 Ga0500643_005890_1102_1899 240
360 3300053096 Ga0500641_0104883 Ga0500641_0104883_382_1113 240
361 3300053117 Ga0500593_040824 Ga0500593_040824_703_1446 240
362 3300053139 Ga0500568_0004977 Ga0500568_0004977_3525_4277 240
363 3300053146 Ga0500588_0019122 Ga0500588_0019122_342_1073 240
364 3300053153 Ga0500616_0057280 Ga0500616_0057280_1293_2021 240
365 3300053177 Ga0500636_0001137 Ga0500636_0001137_7976_8701 240
366 3300060353 Ga0501082_0001121 Ga0501082_0001121_13231_13962 240
367 3300060353 Ga0501082_0091638 Ga0501082_0091638_1058_1789 240
368 3300060353 Ga0501082_0290649 Ga0501082_0290649_168_899 240
369 3300060353 Ga0501082_0656710 Ga0501082_0656710_33_764 240
370 iso_pu_bacteria 2842694124 2842698006 240

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01728

FtsJ

FtsJ-like methyltransferase

79

260

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3opn-assembly1.cif.gz_A the crystal structure of a putative hemolysin from lactococcus lactis 0.9742 58 239
5wxm-assembly1.cif.gz_A crystal structure of the imp3 and mpp10 complex 0.9654 3 44
5eov-assembly1.cif.gz_A c-terminal domain of the 16s/23s rrna (cytidine-2'-o)-methyltransferase tlya. 0.954 60 239
5opt-assembly1.cif.gz_b structure of ksrp in context of trypanosoma cruzi 40s 0.9383 3 44
3jbn-assembly1.cif.gz_E cryo-electron microscopy reconstruction of the plasmodium falciparum 80s ribosome bound to p-trna 0.9377 3 44
ID Description Score Start End Superfamily
af_C0P590_106_292_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9757 65 240 3.40.50.150
3opnA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9651 58 239 3.40.50.150
5eovA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.954 60 239 3.40.50.150
af_A0A144A2N8_107_181_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9419 4 45 3.10.290.10
af_Q9LXG1_108_164_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9397 3 45 3.10.290.10
ID Description Score Start End GO Terms
AF-A0A086QSW7-F1-model_v4 Ribosomal RNA large subunit methyltransferase J 0.9939 75 131 GO:0003723
GO:0008168
GO:0016020
GO:0032259
AF-A0A1Q7SI60-F1-model_v4 Ribosomal RNA methyltransferase FtsJ domain-containing protein 0.9831 75 239 GO:0008168
GO:0032259
AF-A0A832BVT6-F1-model_v4 deleted 0.9824 75 239
AF-A0A7W0ULN3-F1-model_v4 TlyA family RNA methyltransferase 0.9802 82 239 GO:0008168
GO:0032259
AF-A0A357V0D7-F1-model_v4 TlyA family rRNA (Cytidine-2'-O)-methyltransferase 0.9792 53 240 GO:0008168
GO:0032259

Feature Viewer

pLDDT pTM Quality
93.83 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map