F425325

General Info

Members Datasets Scaffolds Average Seq Length
370 223 740 326

Family's Representative Sequence

Representative Sequence 3300005614|Ga0068856_100292634|Ga0068856_1002926341
Length 365
Sequence MTPPPAASDPGRNPRVLIAAGGTAGHVVPSLAVAAELTARGADVVFAGTAERIESRLVPAAGYPLHTYHVTGFPRRPSFGLVRGLGLAALAPAACTRILRRVRPDVVFGGGGYVAGPMLAAAAGMRIPAALMEVDAHLGLANRMAAPFARRVFLSFPIGDLGPPRYQLTGRPVPRAVLEATGEDGRREFDLPADRRVVLVFGGSLGSTTLNRAATAAWAAEDPGFTVVHITGEREFALSSGRAAPHYRVLPYTSGLGPLLAAADLVVSRAGGSVFEIAAAGRPAILVPSPNVTADHQSRNAEFIADGGAAIVISDNELTAVRLATEVDRLLADPDRLTGMSQAARRLARPDAGERIATELLALAR

Samples

Sample ID Description Type Environment
1 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
38 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
106 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
107 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
108 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
109 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
110 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
111 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
112 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
113 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
114 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
115 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
116 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
117 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
118 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
119 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
120 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
121 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
122 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
123 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
124 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
125 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
127 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
128 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
129 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
130 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
131 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
132 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
133 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
134 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
135 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
136 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
137 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
138 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
139 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
140 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
141 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
142 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
143 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
144 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
145 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
146 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
147 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
148 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
149 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
150 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
151 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
152 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
153 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
154 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
155 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
156 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
157 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
158 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
159 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
160 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
161 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
162 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
163 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
164 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
165 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
166 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
167 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
168 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
169 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
170 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
171 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
172 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
173 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
174 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
175 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
176 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
177 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
178 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
179 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
180 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
181 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
182 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
183 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
184 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
185 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
186 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
187 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
188 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
189 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
190 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
191 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
192 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
193 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
201 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
202 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
203 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
204 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
205 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
206 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
207 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
208 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
209 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
210 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
211 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
212 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
213 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
214 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
215 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
216 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
217 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
218 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
219 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
220 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
221 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
222 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
223 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.19
Metatranscriptomes 0.81
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.27
Nodule 0
Rhizoplane 12.43
Rhizosphere 86.76
Stem 0
Stem Tuber 0
Unclassified 2.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068856_100292634 3300005614 Bacteria 1645
2 JGI25407J50210_10024367 3300003373 Bacteria 1569
3 Ga0070658_10001851 3300005327 Bacteria 17821
4 Ga0070683_100006914 3300005329 Bacteria 9535
5 Ga0070680_100080436 3300005336 Bacteria 2687
6 Ga0070682_100032634 3300005337 Bacteria 3159
7 Ga0070682_100193255 3300005337 Bacteria 1430
8 Ga0068868_100151843 3300005338 Bacteria 1907
9 Ga0070660_100018745 3300005339 Bacteria 5061
10 Ga0070660_100043516 3300005339 Bacteria 3432
11 Ga0070660_100074415 3300005339 Bacteria 2658
12 Ga0070661_100036691 3300005344 Bacteria 3562
13 Ga0070661_100103337 3300005344 Bacteria 2122
14 Ga0070692_10052209 3300005345 Bacteria 2129
15 Ga0070675_100136428 3300005354 Bacteria 2094
16 Ga0070674_100095247 3300005356 Bacteria 2158
17 Ga0070688_100033777 3300005365 Bacteria 3094
18 Ga0070659_100045096 3300005366 Bacteria 3453
19 Ga0070714_100011181 3300005435 Bacteria 7116
20 Ga0070714_100066891 3300005435 Bacteria 3097
21 Ga0070714_100320462 3300005435 Bacteria 1449
22 Ga0070705_100219828 3300005440 Bacteria 1315
23 Ga0070700_100004080 3300005441 Bacteria 7601
24 Ga0070700_100011979 3300005441 Bacteria 4819
25 Ga0070694_100088085 3300005444 Bacteria 2173
26 Ga0068867_100166579 3300005459 Bacteria 1742
27 Ga0070685_10017339 3300005466 Bacteria 3853
28 Ga0070685_10210006 3300005466 Bacteria 1270
29 Ga0070707_100046921 3300005468 Bacteria 4135
30 Ga0070707_100289971 3300005468 Bacteria 1590
31 Ga0070698_100066679 3300005471 Bacteria 3622
32 Ga0070684_100000780 3300005535 Bacteria 22118
33 Ga0070684_100386224 3300005535 Bacteria 1290
34 Ga0070672_100196184 3300005543 Bacteria 1687
35 Ga0070672_100276807 3300005543 Unclassified 1418
36 Ga0070695_100000081 3300005545 Bacteria 39746
37 Ga0070696_100075130 3300005546 Bacteria 2384
38 Ga0070693_100022444 3300005547 Bacteria 3356
39 Ga0070704_100092319 3300005549 Bacteria 2260
40 Ga0068855_100028764 3300005563 Bacteria 6649
41 Ga0068855_100340894 3300005563 Bacteria 1653
42 Ga0070664_100056195 3300005564 Bacteria 3344
43 Ga0070664_100207031 3300005564 Bacteria 1752
44 Ga0068857_100002096 3300005577 Bacteria 16204
45 Ga0068854_100118995 3300005578 Bacteria 2002
46 Ga0070702_100181361 3300005615 Bacteria 1378
47 Ga0070702_100213127 3300005615 Bacteria 1287
48 Ga0068852_100061818 3300005616 Bacteria 3255
49 Ga0068852_100184925 3300005616 Bacteria 1962
50 Ga0068852_100257109 3300005616 Bacteria 1675
51 Ga0068866_10043519 3300005718 Bacteria 2242
52 Ga0081455_10010985 3300005937 Bacteria 9126
53 Ga0081538_10000108 3300005981 Bacteria 82426
54 Ga0081540_1005634 3300005983 Bacteria 9327
55 Ga0081539_10000041 3300005985 Bacteria 292660
56 Ga0070717_10079850 3300006028 Bacteria 2744
57 Ga0075432_10009606 3300006058 Bacteria 3294
58 Ga0070716_100039685 3300006173 Bacteria 2614
59 Ga0070716_100218874 3300006173 Bacteria 1278
60 Ga0070712_100032017 3300006175 Bacteria 3548
61 Ga0097621_100066275 3300006237 Bacteria 2974
62 Ga0075428_100058937 3300006844 Bacteria 4205
63 Ga0075431_100020813 3300006847 Bacteria 6703
64 Ga0075433_10049793 3300006852 Bacteria 3645
65 Ga0075434_100001878 3300006871 Bacteria 18184
66 Ga0075429_100096803 3300006880 Bacteria 2575
67 Ga0068865_100011617 3300006881 Bacteria 5518
68 Ga0075436_100001231 3300006914 Bacteria 17420
69 Ga0075436_100031903 3300006914 Bacteria 3630
70 Ga0075436_100118521 3300006914 Bacteria 1851
71 Ga0075435_100001878 3300007076 Bacteria 13662
72 Ga0075435_100036900 3300007076 Bacteria 3888
73 Ga0075435_100041411 3300007076 Bacteria 3682
74 Ga0075435_100153651 3300007076 Bacteria 1936
75 Ga0105240_10005137 3300009093 Bacteria 19588
76 Ga0105240_10011963 3300009093 Bacteria 12028
77 Ga0105240_10054805 3300009093 Bacteria 4995
78 Ga0105240_10479615 3300009093 Bacteria 1387
79 Ga0111539_10048555 3300009094 Bacteria 5067
80 Ga0111539_10059703 3300009094 Bacteria 4521
81 Ga0105245_10126076 3300009098 Bacteria 2397
82 Ga0105245_10145206 3300009098 Bacteria 2238
83 Ga0105245_10231326 3300009098 Bacteria 1788
84 Ga0105245_10296939 3300009098 Bacteria 1584
85 Ga0114129_10196273 3300009147 Bacteria 2737
86 Ga0114129_10371581 3300009147 Bacteria 1890
87 Ga0105243_10090396 3300009148 Bacteria 2519
88 Ga0105243_10179673 3300009148 Bacteria 1839
89 Ga0105243_10273090 3300009148 Bacteria 1519
90 Ga0105243_10572428 3300009148 Bacteria 1083
91 Ga0105242_10044423 3300009176 Bacteria 3599
92 Ga0105242_10087610 3300009176 Bacteria 2614
93 Ga0105238_10080484 3300009551 Bacteria 3247
94 Ga0105238_10538449 3300009551 Unclassified 1171
95 Ga0105249_10216964 3300009553 Bacteria 1881
96 Ga0105246_10009738 3300011119 Bacteria 5923
97 Ga0157370_10024715 3300013104 Bacteria 5948
98 Ga0157370_10102788 3300013104 Bacteria 2675
99 Ga0157369_10006794 3300013105 Bacteria 13198
100 Ga0157369_10008247 3300013105 Bacteria 11942
101 Ga0163162_10036771 3300013306 Bacteria 4883
102 Ga0157372_10005582 3300013307 Bacteria 13374
103 Ga0157372_10083858 3300013307 Bacteria 3610
104 Ga0157372_10231468 3300013307 Bacteria 2142
105 Ga0157375_10313673 3300013308 Bacteria 1732
106 Ga0206356_10814617 3300020070 Bacteria 4727
107 Ga0206354_11036437 3300020081 Bacteria 2127
108 Ga0206353_11002320 3300020082 Unclassified 1482
109 Ga0207692_10136029 3300025898 Bacteria 1393
110 Ga0207642_10051333 3300025899 Bacteria 1865
111 Ga0207705_10025341 3300025909 Bacteria 4235
112 Ga0207705_10070591 3300025909 Bacteria 2531
113 Ga0207654_10096627 3300025911 Bacteria 1812
114 Ga0207695_10003166 3300025913 Bacteria 23465
115 Ga0207693_10074447 3300025915 Bacteria 2660
116 Ga0207663_10056397 3300025916 Bacteria 2470
117 Ga0207660_10019206 3300025917 Bacteria 4565
118 Ga0207657_10021309 3300025919 Bacteria 6103
119 Ga0207657_10026180 3300025919 Bacteria 5365
120 Ga0207657_10118097 3300025919 Bacteria 2184
121 Ga0207649_10147424 3300025920 Bacteria 1617
122 Ga0207652_10033827 3300025921 Bacteria 4305
123 Ga0207646_10021150 3300025922 Bacteria 6018
124 Ga0207694_10120596 3300025924 Bacteria 2094
125 Ga0207659_10070688 3300025926 Bacteria 2546
126 Ga0207687_10034612 3300025927 Bacteria 3430
127 Ga0207687_10097876 3300025927 Bacteria 2153
128 Ga0207687_10104561 3300025927 Bacteria 2090
129 Ga0207700_10105203 3300025928 Bacteria 2260
130 Ga0207664_10026497 3300025929 Bacteria 4383
131 Ga0207706_10035705 3300025933 Bacteria 4418
132 Ga0207709_10065397 3300025935 Bacteria 2287
133 Ga0207709_10097605 3300025935 Bacteria 1935
134 Ga0207669_10128488 3300025937 Bacteria 1736
135 Ga0207669_10132000 3300025937 Bacteria 1718
136 Ga0207665_10000148 3300025939 Bacteria 47520
137 Ga0207665_10099352 3300025939 Bacteria 2029
138 Ga0207691_10070468 3300025940 Bacteria 3157
139 Ga0207711_10062953 3300025941 Bacteria 3201
140 Ga0207689_10073687 3300025942 Bacteria 2805
141 Ga0207661_10000956 3300025944 Bacteria 19037
142 Ga0207661_10072496 3300025944 Bacteria 2817
143 Ga0207679_10118917 3300025945 Bacteria 2100
144 Ga0207679_10174794 3300025945 Bacteria 1771
145 Ga0207667_10103360 3300025949 Bacteria 2939
146 Ga0207668_10096686 3300025972 Bacteria 2184
147 Ga0207640_10124645 3300025981 Bacteria 1852
148 Ga0207708_10000546 3300026075 Bacteria 29084
149 Ga0207708_10019549 3300026075 Bacteria 5107
150 Ga0207702_10040987 3300026078 Bacteria 3882
151 Ga0207702_10118181 3300026078 Bacteria 2368
152 Ga0207648_10044119 3300026089 Bacteria 3912
153 Ga0207674_10007140 3300026116 Bacteria 13048
154 Ga0207674_10033873 3300026116 Bacteria 5344
155 Ga0207683_10030661 3300026121 Bacteria 4661
156 Ga0207683_10065756 3300026121 Bacteria 3197
157 Ga0207698_10113189 3300026142 Bacteria 2279
158 Ga0207698_10401606 3300026142 Unclassified 1310
159 Ga0207428_10014390 3300027907 Bacteria 6878
160 Ga0265319_1008342 3300028563 Bacteria 4554
161 Ga0265318_10000939 3300028577 Bacteria 18829
162 Ga0265323_10037295 3300028653 Bacteria 1782
163 Ga0265322_10012793 3300028654 Bacteria 2430
164 Ga0265338_10001956 3300028800 Bacteria 32135
165 Ga0265338_10003793 3300028800 Bacteria 21009
166 Ga0265338_10006056 3300028800 Bacteria 15530
167 Ga0265338_10279604 3300028800 Bacteria 1220
168 Ga0265330_10010478 3300031235 Bacteria 4368
169 Ga0265325_10076262 3300031241 Bacteria 1673
170 Ga0265327_10002723 3300031251 Bacteria 18058
171 Ga0265314_10074990 3300031711 Bacteria 2251
172 Ga0307409_100087416 3300031995 Bacteria 2540
173 Ga0307409_100293231 3300031995 Bacteria 1509
174 Ga0307416_100010185 3300032002 Bacteria 6200
175 Ga0307415_100028016 3300032126 Bacteria 3578
176 Ga0373944_0007349 3300035089 Bacteria 2949
177 Ga0373945_0003622 3300035116 Bacteria 4867
178 Ga0373956_0089875 3300035119 Bacteria 1416
179 Ga0373946_0009483 3300035171 Bacteria 3587
180 Ga0373935_0140629 3300035692 Bacteria 1630
181 Ga0373927_0139005 3300035695 Bacteria 1588
182 Ga0373947_0000630 3300035725 Bacteria 20829
183 Ga0373937_0512188 3300036401 Bacteria 1140
184 Ga0373925_0002999 3300037068 Bacteria 13276
185 Ga0373925_0154053 3300037068 Bacteria 1807
186 Ga0395899_0003498 3300037312 Bacteria 12442
187 Ga0395899_0030202 3300037312 Bacteria 4076
188 Ga0395899_0035762 3300037312 Bacteria 3727
189 Ga0395899_0047330 3300037312 Bacteria 3202
190 Ga0395900_0019495 3300037418 Bacteria 6915
191 Ga0395900_0032602 3300037418 Bacteria 5358
192 Ga0395900_0043112 3300037418 Bacteria 4649
193 Ga0395900_0081208 3300037418 Bacteria 3330
194 Ga0395898_0004735 3300037466 Bacteria 14807
195 Ga0395898_0007071 3300037466 Bacteria 11920
196 Ga0395898_0024679 3300037466 Bacteria 6063
197 Ga0395898_0315091 3300037466 Bacteria 1492
198 Ga0395905_0003149 3300037471 Bacteria 17768
199 Ga0395905_0015177 3300037471 Bacteria 7330
200 Ga0395905_0054202 3300037471 Bacteria 3753
201 Ga0395905_0238034 3300037471 Bacteria 1701
202 Ga0395901_0007714 3300038443 Bacteria 10853
203 Ga0395901_0009051 3300038443 Bacteria 10081
204 Ga0395901_0020150 3300038443 Bacteria 6825
205 Ga0395901_0040936 3300038443 Bacteria 4800
206 Ga0395901_0083855 3300038443 Bacteria 3331
207 Ga0395901_0189426 3300038443 Bacteria 2157
208 Ga0395901_0414308 3300038443 Bacteria 1383
209 Ga0395901_0483177 3300038443 Unclassified 1263
210 Ga0436365_1656920 3300039437 Bacteria 1040
211 Ga0436360_1285586 3300039438 Unclassified 1266
212 Ga0451853_1739022 3300041512 Unclassified 1350
213 Ga0439441_014665 3300042001 Bacteria 1377
214 Ga0450920_003882 3300042122 Bacteria 2605
215 Ga0439434_0019796 3300042435 Bacteria 2019
216 Ga0439459_0007627 3300042438 Bacteria 1832
217 Ga0466965_0034093 3300044683 Bacteria 2490
218 Ga0466965_0129920 3300044683 Bacteria 1306
219 Ga0466966_0172730 3300044684 Bacteria 1313
220 Ga0466961_0041220 3300044693 Bacteria 2960
221 Ga0466963_0000094 3300044694 Bacteria 31295
222 Ga0466963_0003254 3300044694 Bacteria 9259
223 Ga0466963_0014296 3300044694 Bacteria 4891
224 Ga0466964_0005847 3300044706 Bacteria 4577
225 Ga0466964_0147380 3300044706 Bacteria 1088
226 Ga0466971_0031861 3300044719 Bacteria 2361
227 Ga0466968_0020313 3300044735 Bacteria 2680
228 Ga0466968_0086462 3300044735 Bacteria 1384
229 Ga0466957_0009069 3300044842 Bacteria 5672
230 Ga0466957_0167346 3300044842 Bacteria 1430
231 Ga0466960_0003619 3300044901 Bacteria 5961
232 Ga0466959_0006509 3300045049 Bacteria 8097
233 Ga0466959_0169507 3300045049 Bacteria 1531
234 Ga0466958_0005159 3300045836 Bacteria 6987
235 Ga0466958_0006542 3300045836 Bacteria 6349
236 Ga0466958_0140496 3300045836 Bacteria 1520
237 Ga0466967_0001299 3300045976 Bacteria 14243
238 Ga0466967_0020027 3300045976 Bacteria 5396
239 Ga0466967_0023101 3300045976 Bacteria 5091
240 Ga0466967_0027505 3300045976 Bacteria 4732
241 Ga0466967_0033407 3300045976 Bacteria 4354
242 Ga0466967_0069040 3300045976 Bacteria 3157
243 Ga0466967_0160866 3300045976 Bacteria 2107
244 Ga0495641_0036378 3300046461 Bacteria 2313
245 Ga0495653_0007273 3300046463 Bacteria 9070
246 Ga0495580_0103437 3300046472 Bacteria 1979
247 Ga0495582_0024297 3300046473 Bacteria 3314
248 Ga0495639_0000672 3300046475 Bacteria 15755
249 Ga0495662_0017648 3300046476 Bacteria 3454
250 Ga0495664_0037590 3300046477 Bacteria 2857
251 Ga0495630_0001161 3300046517 Bacteria 18180
252 Ga0495630_0078324 3300046517 Bacteria 2492
253 Ga0495666_0000195 3300046526 Bacteria 26154
254 Ga0495665_0005631 3300046531 Bacteria 6753
255 Ga0495640_0050987 3300046533 Bacteria 2847
256 Ga0495586_0025906 3300046535 Bacteria 3137
257 Ga0495645_0021032 3300046543 Bacteria 4715
258 Ga0495667_0098484 3300046559 Bacteria 1893
259 Ga0495634_0040558 3300046642 Bacteria 3165
260 Ga0495635_0039468 3300046663 Bacteria 3265
261 Ga0495635_0146214 3300046663 Bacteria 1609
262 Ga0495647_0000069 3300046681 Bacteria 24849
263 Ga0495613_0011605 3300046689 Bacteria 6547
264 Ga0495624_0034619 3300046690 Bacteria 3265
265 Ga0495589_0087704 3300046794 Bacteria 1511
266 Ga0495581_0001572 3300047315 Bacteria 12736
267 Ga0495674_0002825 3300047319 Bacteria 16877
268 Ga0495676_0004923 3300047321 Bacteria 12248
269 Ga0495680_0101678 3300047322 Bacteria 2141
270 Ga0495680_0279924 3300047322 Unclassified 1176
271 Ga0495684_0012401 3300047471 Bacteria 6572
272 Ga0495593_0000635 3300047673 Bacteria 20129
273 Ga0495614_0001744 3300048089 Bacteria 9495
274 Ga0496100_0001475 3300048903 Bacteria 11518
275 Ga0496100_0131939 3300048903 Bacteria 1761
276 Ga0496100_0197877 3300048903 Bacteria 1463
277 Ga0496101_0000450 3300048904 Bacteria 26179
278 Ga0496101_0005240 3300048904 Bacteria 8250
279 Ga0496101_0024901 3300048904 Bacteria 4148
280 Ga0496101_0064780 3300048904 Bacteria 2663
281 Ga0496102_0006410 3300048905 Bacteria 10032
282 Ga0496102_0092028 3300048905 Bacteria 2808
283 Ga0496102_0110116 3300048905 Bacteria 2567
284 Ga0496102_0186610 3300048905 Bacteria 1954
285 Ga0496103_0036472 3300048906 Bacteria 3011
286 Ga0496104_0000894 3300048907 Bacteria 25656
287 Ga0496104_0018728 3300048907 Bacteria 6321
288 Ga0496104_0035431 3300048907 Bacteria 4659
289 Ga0496104_0066450 3300048907 Bacteria 3424
290 Ga0496104_0067772 3300048907 Bacteria 3391
291 Ga0496105_0022313 3300048908 Bacteria 5127
292 Ga0496105_0041967 3300048908 Bacteria 3771
293 Ga0496105_0085993 3300048908 Bacteria 2598
294 Ga0496105_0087343 3300048908 Bacteria 2576
295 Ga0496106_0000456 3300048909 Bacteria 29280
296 Ga0496106_0013670 3300048909 Bacteria 5994
297 Ga0496106_0078334 3300048909 Bacteria 2536
298 Ga0496107_0000476 3300048910 Bacteria 22039
299 Ga0496108_0004037 3300048911 Bacteria 11779
300 Ga0496108_0009696 3300048911 Bacteria 7803
301 Ga0496108_0062238 3300048911 Bacteria 3143
302 Ga0496108_0077809 3300048911 Bacteria 2806
303 Ga0496108_0180206 3300048911 Bacteria 1829
304 Ga0496109_0000395 3300048912 Bacteria 39559
305 Ga0496109_0013478 3300048912 Bacteria 7092
306 Ga0496109_0029950 3300048912 Bacteria 4878
307 Ga0496109_0135854 3300048912 Bacteria 2297
308 Ga0496111_0000598 3300048914 Bacteria 19022
309 Ga0496112_0016981 3300048915 Bacteria 6831
310 Ga0496112_0018319 3300048915 Bacteria 6592
311 Ga0496112_0037562 3300048915 Bacteria 4726
312 Ga0496112_0067775 3300048915 Bacteria 3523
313 Ga0496113_0008680 3300048916 Bacteria 6632
314 Ga0496113_0075120 3300048916 Bacteria 2579
315 Ga0496113_0103663 3300048916 Bacteria 2206
316 Ga0496114_0003574 3300048917 Bacteria 11941
317 Ga0496114_0011904 3300048917 Bacteria 6961
318 Ga0496114_0053556 3300048917 Bacteria 3363
319 Ga0496115_0010902 3300048918 Bacteria 6803
320 Ga0501033_0037762 3300049570 Bacteria 3614
321 Ga0501036_0006896 3300049572 Bacteria 9233
322 Ga0501037_0067381 3300049573 Bacteria 2607
323 Ga0501038_0053462 3300049574 Bacteria 3477
324 Ga0501039_0043171 3300049575 Bacteria 3483
325 Ga0501042_0044612 3300049578 Bacteria 3159
326 Ga0501048_0011347 3300049582 Bacteria 6645
327 Ga0501048_0074649 3300049582 Bacteria 2393
328 Ga0501048_0099463 3300049582 Bacteria 2052
329 Ga0501067_0024385 3300049583 Bacteria 3355
330 Ga0501067_0032311 3300049583 Bacteria 2905
331 Ga0501067_0035033 3300049583 Bacteria 2786
332 Ga0501068_0067054 3300049584 Bacteria 2186
333 Ga0501069_0050540 3300049585 Bacteria 2312
334 Ga0501069_0065784 3300049585 Bacteria 2027
335 Ga0501071_0001003 3300049587 Bacteria 15510
336 Ga0501072_0026553 3300049588 Bacteria 4515
337 Ga0501074_0041800 3300049590 Bacteria 3318
338 Ga0501075_0021008 3300049591 Bacteria 4756
339 Ga0501075_0035877 3300049591 Bacteria 3699
340 Ga0501076_0002691 3300049592 Bacteria 12279
341 Ga0501079_0011546 3300049741 Bacteria 6743
342 Ga0501079_0243250 3300049741 Bacteria 1406
343 Ga0501080_0119841 3300049742 Bacteria 2439
344 Ga0501080_0278620 3300049742 Bacteria 1521
345 Ga0501035_0150530 3300049822 Bacteria 2020
346 nmdc:mga05p37_263397_c1 3300050507 Bacteria 2062
347 nmdc:mga05p37_397339_c1 3300050507 Bacteria 1610
348 nmdc:mga09592_159277_c1 3300050508 Bacteria 1949
349 nmdc:mga06r32_43493_c1 3300050510 Bacteria 4274
350 nmdc:mga08y16_66148_c1 3300050511 Bacteria 3773
351 nmdc:mga08y16_95555_c1 3300050511 Bacteria 2414
352 nmdc:mga0n895_117367_c1 3300050512 Bacteria 2680
353 nmdc:mga0n895_149688_c1 3300050512 Bacteria 2364
354 nmdc:mga0n895_312560_c1 3300050512 Bacteria 1592
355 nmdc:mga0n895_447361_c1 3300050512 Bacteria 1305
356 nmdc:mga0n895_58793_c1 3300050512 Bacteria 3792
357 nmdc:mga0rr50_133014_c1 3300050513 Bacteria 1994
358 nmdc:mga0rr50_362373_c1 3300050513 Bacteria 1220
359 nmdc:mga0rr50_85243_c1 3300050513 Bacteria 2448
360 nmdc:mga0rr50_97853_c1 3300050513 Bacteria 2299
361 nmdc:mga08x19_1046_c1 3300050514 Bacteria 17298
362 nmdc:mga0a205_3154_c1 3300050515 Bacteria 14630
363 nmdc:mga0a205_63930_c1 3300050515 Bacteria 3555
364 Ga0495601_0048581 3300053077 Bacteria 2672
365 Ga0495601_0084571 3300053077 Bacteria 2038
366 Ga0495619_0004893 3300053085 Bacteria 8508
367 Ga0500566_0019208 3300053094 Bacteria 4012
368 Ga0501082_0052768 3300060353 Bacteria 3505
369 Ga0501082_0064251 3300060353 Bacteria 3161
370 Ga0530510_0133614 3300061734 Bacteria 1826
371 Ga0068856_100292634
372 JGI25407J50210_10024367
373 Ga0070658_10001851
374 Ga0070683_100006914
375 Ga0070680_100080436
376 Ga0070682_100032634
377 Ga0070682_100193255
378 Ga0068868_100151843
379 Ga0070660_100018745
380 Ga0070660_100043516
381 Ga0070660_100074415
382 Ga0070661_100036691
383 Ga0070661_100103337
384 Ga0070692_10052209
385 Ga0070675_100136428
386 Ga0070674_100095247
387 Ga0070688_100033777
388 Ga0070659_100045096
389 Ga0070714_100011181
390 Ga0070714_100066891
391 Ga0070714_100320462
392 Ga0070705_100219828
393 Ga0070700_100004080
394 Ga0070700_100011979
395 Ga0070694_100088085
396 Ga0068867_100166579
397 Ga0070685_10017339
398 Ga0070685_10210006
399 Ga0070707_100046921
400 Ga0070707_100289971
401 Ga0070698_100066679
402 Ga0070684_100000780
403 Ga0070684_100386224
404 Ga0070672_100196184
405 Ga0070672_100276807
406 Ga0070695_100000081
407 Ga0070696_100075130
408 Ga0070693_100022444
409 Ga0070704_100092319
410 Ga0068855_100028764
411 Ga0068855_100340894
412 Ga0070664_100056195
413 Ga0070664_100207031
414 Ga0068857_100002096
415 Ga0068854_100118995
416 Ga0070702_100181361
417 Ga0070702_100213127
418 Ga0068852_100061818
419 Ga0068852_100184925
420 Ga0068852_100257109
421 Ga0068866_10043519
422 Ga0081455_10010985
423 Ga0081538_10000108
424 Ga0081540_1005634
425 Ga0081539_10000041
426 Ga0070717_10079850
427 Ga0075432_10009606
428 Ga0070716_100039685
429 Ga0070716_100218874
430 Ga0070712_100032017
431 Ga0097621_100066275
432 Ga0075428_100058937
433 Ga0075431_100020813
434 Ga0075433_10049793
435 Ga0075434_100001878
436 Ga0075429_100096803
437 Ga0068865_100011617
438 Ga0075436_100001231
439 Ga0075436_100031903
440 Ga0075436_100118521
441 Ga0075435_100001878
442 Ga0075435_100036900
443 Ga0075435_100041411
444 Ga0075435_100153651
445 Ga0105240_10005137
446 Ga0105240_10011963
447 Ga0105240_10054805
448 Ga0105240_10479615
449 Ga0111539_10048555
450 Ga0111539_10059703
451 Ga0105245_10126076
452 Ga0105245_10145206
453 Ga0105245_10231326
454 Ga0105245_10296939
455 Ga0114129_10196273
456 Ga0114129_10371581
457 Ga0105243_10090396
458 Ga0105243_10179673
459 Ga0105243_10273090
460 Ga0105243_10572428
461 Ga0105242_10044423
462 Ga0105242_10087610
463 Ga0105238_10080484
464 Ga0105238_10538449
465 Ga0105249_10216964
466 Ga0105246_10009738
467 Ga0157370_10024715
468 Ga0157370_10102788
469 Ga0157369_10006794
470 Ga0157369_10008247
471 Ga0163162_10036771
472 Ga0157372_10005582
473 Ga0157372_10083858
474 Ga0157372_10231468
475 Ga0157375_10313673
476 Ga0206356_10814617
477 Ga0206354_11036437
478 Ga0206353_11002320
479 Ga0207692_10136029
480 Ga0207642_10051333
481 Ga0207705_10025341
482 Ga0207705_10070591
483 Ga0207654_10096627
484 Ga0207695_10003166
485 Ga0207693_10074447
486 Ga0207663_10056397
487 Ga0207660_10019206
488 Ga0207657_10021309
489 Ga0207657_10026180
490 Ga0207657_10118097
491 Ga0207649_10147424
492 Ga0207652_10033827
493 Ga0207646_10021150
494 Ga0207694_10120596
495 Ga0207659_10070688
496 Ga0207687_10034612
497 Ga0207687_10097876
498 Ga0207687_10104561
499 Ga0207700_10105203
500 Ga0207664_10026497
501 Ga0207706_10035705
502 Ga0207709_10065397
503 Ga0207709_10097605
504 Ga0207669_10128488
505 Ga0207669_10132000
506 Ga0207665_10000148
507 Ga0207665_10099352
508 Ga0207691_10070468
509 Ga0207711_10062953
510 Ga0207689_10073687
511 Ga0207661_10000956
512 Ga0207661_10072496
513 Ga0207679_10118917
514 Ga0207679_10174794
515 Ga0207667_10103360
516 Ga0207668_10096686
517 Ga0207640_10124645
518 Ga0207708_10000546
519 Ga0207708_10019549
520 Ga0207702_10040987
521 Ga0207702_10118181
522 Ga0207648_10044119
523 Ga0207674_10007140
524 Ga0207674_10033873
525 Ga0207683_10030661
526 Ga0207683_10065756
527 Ga0207698_10113189
528 Ga0207698_10401606
529 Ga0207428_10014390
530 Ga0265319_1008342
531 Ga0265318_10000939
532 Ga0265323_10037295
533 Ga0265322_10012793
534 Ga0265338_10001956
535 Ga0265338_10003793
536 Ga0265338_10006056
537 Ga0265338_10279604
538 Ga0265330_10010478
539 Ga0265325_10076262
540 Ga0265327_10002723
541 Ga0265314_10074990
542 Ga0307409_100087416
543 Ga0307409_100293231
544 Ga0307416_100010185
545 Ga0307415_100028016
546 Ga0373944_0007349
547 Ga0373945_0003622
548 Ga0373956_0089875
549 Ga0373946_0009483
550 Ga0373935_0140629
551 Ga0373927_0139005
552 Ga0373947_0000630
553 Ga0373937_0512188
554 Ga0373925_0002999
555 Ga0373925_0154053
556 Ga0395899_0003498
557 Ga0395899_0030202
558 Ga0395899_0035762
559 Ga0395899_0047330
560 Ga0395900_0019495
561 Ga0395900_0032602
562 Ga0395900_0043112
563 Ga0395900_0081208
564 Ga0395898_0004735
565 Ga0395898_0007071
566 Ga0395898_0024679
567 Ga0395898_0315091
568 Ga0395905_0003149
569 Ga0395905_0015177
570 Ga0395905_0054202
571 Ga0395905_0238034
572 Ga0395901_0007714
573 Ga0395901_0009051
574 Ga0395901_0020150
575 Ga0395901_0040936
576 Ga0395901_0083855
577 Ga0395901_0189426
578 Ga0395901_0414308
579 Ga0395901_0483177
580 Ga0436365_1656920
581 Ga0436360_1285586
582 Ga0451853_1739022
583 Ga0439441_014665
584 Ga0450920_003882
585 Ga0439434_0019796
586 Ga0439459_0007627
587 Ga0466965_0034093
588 Ga0466965_0129920
589 Ga0466966_0172730
590 Ga0466961_0041220
591 Ga0466963_0000094
592 Ga0466963_0003254
593 Ga0466963_0014296
594 Ga0466964_0005847
595 Ga0466964_0147380
596 Ga0466971_0031861
597 Ga0466968_0020313
598 Ga0466968_0086462
599 Ga0466957_0009069
600 Ga0466957_0167346
601 Ga0466960_0003619
602 Ga0466959_0006509
603 Ga0466959_0169507
604 Ga0466958_0005159
605 Ga0466958_0006542
606 Ga0466958_0140496
607 Ga0466967_0001299
608 Ga0466967_0020027
609 Ga0466967_0023101
610 Ga0466967_0027505
611 Ga0466967_0033407
612 Ga0466967_0069040
613 Ga0466967_0160866
614 Ga0495641_0036378
615 Ga0495653_0007273
616 Ga0495580_0103437
617 Ga0495582_0024297
618 Ga0495639_0000672
619 Ga0495662_0017648
620 Ga0495664_0037590
621 Ga0495630_0001161
622 Ga0495630_0078324
623 Ga0495666_0000195
624 Ga0495665_0005631
625 Ga0495640_0050987
626 Ga0495586_0025906
627 Ga0495645_0021032
628 Ga0495667_0098484
629 Ga0495634_0040558
630 Ga0495635_0039468
631 Ga0495635_0146214
632 Ga0495647_0000069
633 Ga0495613_0011605
634 Ga0495624_0034619
635 Ga0495589_0087704
636 Ga0495581_0001572
637 Ga0495674_0002825
638 Ga0495676_0004923
639 Ga0495680_0101678
640 Ga0495680_0279924
641 Ga0495684_0012401
642 Ga0495593_0000635
643 Ga0495614_0001744
644 Ga0496100_0001475
645 Ga0496100_0131939
646 Ga0496100_0197877
647 Ga0496101_0000450
648 Ga0496101_0005240
649 Ga0496101_0024901
650 Ga0496101_0064780
651 Ga0496102_0006410
652 Ga0496102_0092028
653 Ga0496102_0110116
654 Ga0496102_0186610
655 Ga0496103_0036472
656 Ga0496104_0000894
657 Ga0496104_0018728
658 Ga0496104_0035431
659 Ga0496104_0066450
660 Ga0496104_0067772
661 Ga0496105_0022313
662 Ga0496105_0041967
663 Ga0496105_0085993
664 Ga0496105_0087343
665 Ga0496106_0000456
666 Ga0496106_0013670
667 Ga0496106_0078334
668 Ga0496107_0000476
669 Ga0496108_0004037
670 Ga0496108_0009696
671 Ga0496108_0062238
672 Ga0496108_0077809
673 Ga0496108_0180206
674 Ga0496109_0000395
675 Ga0496109_0013478
676 Ga0496109_0029950
677 Ga0496109_0135854
678 Ga0496111_0000598
679 Ga0496112_0016981
680 Ga0496112_0018319
681 Ga0496112_0037562
682 Ga0496112_0067775
683 Ga0496113_0008680
684 Ga0496113_0075120
685 Ga0496113_0103663
686 Ga0496114_0003574
687 Ga0496114_0011904
688 Ga0496114_0053556
689 Ga0496115_0010902
690 Ga0501033_0037762
691 Ga0501036_0006896
692 Ga0501037_0067381
693 Ga0501038_0053462
694 Ga0501039_0043171
695 Ga0501042_0044612
696 Ga0501048_0011347
697 Ga0501048_0074649
698 Ga0501048_0099463
699 Ga0501067_0024385
700 Ga0501067_0032311
701 Ga0501067_0035033
702 Ga0501068_0067054
703 Ga0501069_0050540
704 Ga0501069_0065784
705 Ga0501071_0001003
706 Ga0501072_0026553
707 Ga0501074_0041800
708 Ga0501075_0021008
709 Ga0501075_0035877
710 Ga0501076_0002691
711 Ga0501079_0011546
712 Ga0501079_0243250
713 Ga0501080_0119841
714 Ga0501080_0278620
715 Ga0501035_0150530
716 nmdc:mga05p37_263397_c1
717 nmdc:mga05p37_397339_c1
718 nmdc:mga09592_159277_c1
719 nmdc:mga06r32_43493_c1
720 nmdc:mga08y16_66148_c1
721 nmdc:mga08y16_95555_c1
722 nmdc:mga0n895_117367_c1
723 nmdc:mga0n895_149688_c1
724 nmdc:mga0n895_312560_c1
725 nmdc:mga0n895_447361_c1
726 nmdc:mga0n895_58793_c1
727 nmdc:mga0rr50_133014_c1
728 nmdc:mga0rr50_362373_c1
729 nmdc:mga0rr50_85243_c1
730 nmdc:mga0rr50_97853_c1
731 nmdc:mga08x19_1046_c1
732 nmdc:mga0a205_3154_c1
733 nmdc:mga0a205_63930_c1
734 Ga0495601_0048581
735 Ga0495601_0084571
736 Ga0495619_0004893
737 Ga0500566_0019208
738 Ga0501082_0052768
739 Ga0501082_0064251
740 Ga0530510_0133614

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03033

Glyco_transf_28

Glycosyltransferase family 28 N-terminal domain

16

154

0.99

PF04101

Glyco_tran_28_C

Glycosyltransferase family 28 C-terminal domain

197

356

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3s2u-assembly1.cif.gz_A crystal structure of the pseudomonas aeruginosa murg:udp-glcnac substrate complex 0.841 1 317
7d1i-assembly1.cif.gz_B-2 crystal structure of acinetobacter baumannii murg 0.8304 1 316
1nlm-assembly1.cif.gz_B crystal structure of murg:glcnac complex 0.8136 4 318
7d1i-assembly1.cif.gz_A-2 crystal structure of acinetobacter baumannii murg 0.8094 1 316
1nlm-assembly1.cif.gz_B crystal structure of murg:glcnac complex 0.7957 4 318
ID Description Score Start End Superfamily
af_Q2FYL5_1_178_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9372 2 132 3.40.50.2000
af_P17443_6_162_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9197 1 130 3.40.50.2000
af_P9WJK9_38_202_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9063 1 129 3.40.50.2000
af_Q9C9T8_55_222_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9026 2 113 3.40.50.2000
af_K7KRG7_210_378_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8975 147 301 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A537YQ64-F1-model_v4 UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase (EC 2.4.1.227) (Undecaprenyl-PP-MurNAc-pentapeptide-UDPGlcNAc GlcNAc transferase) 0.9669 1 318 GO:0005886
GO:0005975
GO:0008360
GO:0009252
GO:0030259
GO:0050511
GO:0051301
GO:0051991
GO:0071555
AF-A0A7W0SGK0-F1-model_v4 UDP-N-acetylglucosamine--N-acetylmuramyl-(Pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase 0.963 121 318 GO:0016758
AF-A0A6B0Q607-F1-model_v4 deleted 0.9612 4 103
AF-A0A6I4XJN6-F1-model_v4 UDP-N-acetylglucosamine--N-acetylmuramyl-(Pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase 0.9587 1 129 GO:0005975
GO:0016758
GO:0030259
GO:1901137
AF-A0A538GGD0-F1-model_v4 UDP-N-acetylglucosamine--N-acetylmuramyl-(Pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase 0.9577 1 185 GO:0005975
GO:0016758
GO:0030259
GO:1901137

Map