F425324

General Info

Members Datasets Scaffolds Average Seq Length
370 206 740 252

Family's Representative Sequence

Representative Sequence 3300005564|Ga0070664_100287383|Ga0070664_1002873833
Length 257
Sequence MSRTPFIAANWKMYKTVLETVAFIKEFRKLADAVHDVEIVVAPPFTALRPAVDAAHASSIGIAGQNLHWERQGAFTGEVSAEMLKEAGAEYVIIGHSERRQLFGETDETVNRKLLSAIAAHLTPIVCIGETLGQRDAGETLAVLDRQIKQGLDGLTADQIGAAVIAYEPVWAIGTGRNATPAQAGEAHAHIRARIRQWFGGTAADHCHIIYGGSVKPENIRDLASLPEVDGALVGGASLEVRSFFEIVSRSRPAAAV

Samples

Sample ID Description Type Environment
1 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
52 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
115 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
118 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
119 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
120 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
121 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
122 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
123 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
126 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
127 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
128 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
129 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
130 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
131 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
132 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
133 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
135 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
136 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
137 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
138 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
139 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
140 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
141 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
142 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
143 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
144 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
145 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
146 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
147 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
148 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
149 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
150 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
151 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
152 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
153 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
154 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
155 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
156 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
157 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
158 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
159 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
160 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
161 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
173 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
174 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
175 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
176 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
177 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
178 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
179 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
180 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
181 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
182 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
183 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
184 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
185 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
186 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
188 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
189 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
190 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
191 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
192 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
193 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
194 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
195 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
196 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
197 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
198 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
199 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
200 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
201 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
202 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
203 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
204 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
205 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
206 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.86
Nodule 0
Rhizoplane 5.68
Rhizosphere 89.46
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070664_100287383 3300005564 Bacteria 1484
2 JGI24751J29686_10045136 3300002459 Bacteria 911
3 Ga0065715_10027674 3300005293 Bacteria 1169
4 Ga0065715_10041944 3300005293 Bacteria 1382
5 Ga0065715_10190032 3300005293 Bacteria 1421
6 Ga0065715_10231533 3300005293 Bacteria 1232
7 Ga0065715_10262520 3300005293 Bacteria 1134
8 Ga0065715_10294676 3300005293 Bacteria 1039
9 Ga0065707_10176138 3300005295 Bacteria 1450
10 Ga0070676_10029599 3300005328 Bacteria 3116
11 Ga0070683_100002099 3300005329 Bacteria 15740
12 Ga0070683_100007549 3300005329 Bacteria 9190
13 Ga0070683_100094570 3300005329 Bacteria 2809
14 Ga0070690_100029080 3300005330 Bacteria 3425
15 Ga0070670_100061001 3300005331 Bacteria 3238
16 Ga0070670_100063704 3300005331 Bacteria 3164
17 Ga0070670_100098738 3300005331 Bacteria 2513
18 Ga0070670_100111583 3300005331 Bacteria 2356
19 Ga0068869_100013748 3300005334 Bacteria 5391
20 Ga0068869_100133117 3300005334 Bacteria 1913
21 Ga0070660_100488142 3300005339 Bacteria 1024
22 Ga0070689_100059585 3300005340 Bacteria 2967
23 Ga0070669_100003630 3300005353 Bacteria 11130
24 Ga0070669_100289280 3300005353 Bacteria 1315
25 Ga0070675_100134421 3300005354 Bacteria 2110
26 Ga0070675_100156628 3300005354 Bacteria 1956
27 Ga0070675_100424254 3300005354 Bacteria 1190
28 Ga0070671_100065954 3300005355 Bacteria 3017
29 Ga0070671_100343025 3300005355 Bacteria 1274
30 Ga0070674_100012985 3300005356 Bacteria 5132
31 Ga0070674_100035351 3300005356 Bacteria 3345
32 Ga0070673_100093514 3300005364 Bacteria 2462
33 Ga0070673_100604993 3300005364 Bacteria 1000
34 Ga0070659_100060752 3300005366 Bacteria 2986
35 Ga0070667_100242475 3300005367 Bacteria 1610
36 Ga0070667_100253051 3300005367 Bacteria 1575
37 Ga0070709_10162107 3300005434 Bacteria 1556
38 Ga0070709_10346896 3300005434 Bacteria 1096
39 Ga0070713_100024008 3300005436 Bacteria 4742
40 Ga0070701_10338395 3300005438 Bacteria 936
41 Ga0070711_100156827 3300005439 Bacteria 1722
42 Ga0070700_100023696 3300005441 Bacteria 3593
43 Ga0070663_100133674 3300005455 Bacteria 1886
44 Ga0070663_100184734 3300005455 Bacteria 1619
45 Ga0070678_100128429 3300005456 Bacteria 2010
46 Ga0070662_100461274 3300005457 Bacteria 1056
47 Ga0068867_100146583 3300005459 Bacteria 1850
48 Ga0070685_10272066 3300005466 Bacteria 1131
49 Ga0070679_100084422 3300005530 Bacteria 3164
50 Ga0070684_100000301 3300005535 Bacteria 34312
51 Ga0070684_100230584 3300005535 Bacteria 1691
52 Ga0070684_100250644 3300005535 Bacteria 1618
53 Ga0068853_100236414 3300005539 Bacteria 1673
54 Ga0070672_100548786 3300005543 Bacteria 1003
55 Ga0070695_100072264 3300005545 Bacteria 2261
56 Ga0070695_100278850 3300005545 Bacteria 1227
57 Ga0070693_100123105 3300005547 Bacteria 1611
58 Ga0070693_100127037 3300005547 Bacteria 1589
59 Ga0070665_100979094 3300005548 Bacteria 858
60 Ga0070704_100105598 3300005549 Bacteria 2133
61 Ga0070664_100061330 3300005564 Bacteria 3205
62 Ga0070664_100121424 3300005564 Bacteria 2288
63 Ga0070664_100206336 3300005564 Bacteria 1755
64 Ga0070664_100305682 3300005564 Bacteria 1438
65 Ga0068857_100019318 3300005577 Bacteria 5982
66 Ga0068857_100172863 3300005577 Bacteria 1964
67 Ga0068857_100300443 3300005577 Bacteria 1480
68 Ga0068854_100127388 3300005578 Bacteria 1940
69 Ga0070702_100151161 3300005615 Bacteria 1490
70 Ga0068852_100068835 3300005616 Bacteria 3099
71 Ga0068852_100135599 3300005616 Bacteria 2272
72 Ga0068859_100192990 3300005617 Bacteria 2121
73 Ga0068859_100196179 3300005617 Bacteria 2103
74 Ga0068859_100470885 3300005617 Bacteria 1352
75 Ga0068864_100284388 3300005618 Bacteria 1544
76 Ga0068864_100286727 3300005618 Bacteria 1538
77 Ga0068864_100343430 3300005618 Bacteria 1407
78 Ga0068866_10104241 3300005718 Bacteria 1570
79 Ga0068861_100094217 3300005719 Bacteria 2369
80 Ga0068863_100481835 3300005841 Bacteria 1220
81 Ga0068858_100176955 3300005842 Bacteria 2013
82 Ga0068862_100057673 3300005844 Bacteria 3331
83 Ga0075365_10065477 3300006038 Bacteria 2436
84 Ga0075368_10019470 3300006042 Bacteria 2562
85 Ga0075364_10031850 3300006051 Bacteria 3387
86 Ga0075362_10000376 3300006177 Bacteria 12794
87 Ga0075367_10007622 3300006178 Bacteria 5557
88 Ga0075366_10006026 3300006195 Bacteria 6605
89 Ga0075366_10009811 3300006195 Bacteria 5354
90 Ga0097621_100270808 3300006237 Bacteria 1492
91 Ga0075370_10052165 3300006353 Bacteria 2319
92 Ga0068871_100151230 3300006358 Bacteria 1980
93 Ga0075428_100035772 3300006844 Bacteria 5474
94 Ga0075428_100040377 3300006844 Bacteria 5134
95 Ga0075428_100351683 3300006844 Bacteria 1582
96 Ga0075428_100509838 3300006844 Bacteria 1287
97 Ga0075428_100632197 3300006844 Bacteria 1142
98 Ga0075430_100002408 3300006846 Bacteria 15571
99 Ga0075430_100292388 3300006846 Bacteria 1348
100 Ga0075431_100007535 3300006847 Bacteria 10836
101 Ga0075431_100013658 3300006847 Bacteria 8207
102 Ga0075431_100215607 3300006847 Bacteria 1959
103 Ga0075433_10009133 3300006852 Bacteria 7916
104 Ga0075433_10103682 3300006852 Bacteria 2520
105 Ga0075434_100310219 3300006871 Bacteria 1598
106 Ga0075429_100000088 3300006880 Bacteria 48640
107 Ga0075429_100080053 3300006880 Bacteria 2848
108 Ga0075429_100128112 3300006880 Bacteria 2220
109 Ga0075429_100136097 3300006880 Bacteria 2150
110 Ga0075429_100176801 3300006880 Bacteria 1870
111 Ga0068865_100106761 3300006881 Bacteria 2059
112 Ga0097620_100192989 3300006931 Bacteria 2121
113 Ga0097620_100196191 3300006931 Bacteria 2103
114 Ga0097620_100470881 3300006931 Bacteria 1352
115 Ga0075435_100000569 3300007076 Bacteria 22675
116 Ga0111539_10000039 3300009094 Bacteria 139160
117 Ga0111539_10000112 3300009094 Bacteria 89047
118 Ga0105245_10041387 3300009098 Bacteria 4107
119 Ga0114129_10003739 3300009147 Bacteria 21458
120 Ga0114129_10014871 3300009147 Bacteria 11087
121 Ga0114129_10046472 3300009147 Bacteria 6101
122 Ga0114129_10102301 3300009147 Bacteria 3962
123 Ga0114129_10147229 3300009147 Bacteria 3225
124 Ga0105242_10020926 3300009176 Bacteria 5131
125 Ga0105248_10023062 3300009177 Bacteria 6913
126 Ga0105248_10084942 3300009177 Bacteria 3561
127 Ga0105237_10674572 3300009545 Bacteria 1040
128 Ga0105249_10007602 3300009553 Bacteria 9456
129 Ga0105249_10474650 3300009553 Bacteria 1293
130 Ga0105246_10590606 3300011119 Bacteria 958
131 Ga0163162_10639440 3300013306 Bacteria 1188
132 Ga0157375_10390146 3300013308 Bacteria 1559
133 Ga0163163_10020544 3300014325 Bacteria 6221
134 Ga0157380_10813136 3300014326 Bacteria 953
135 Ga0207697_10002025 3300025315 Bacteria 10718
136 Ga0207688_10011510 3300025901 Bacteria 4816
137 Ga0207688_10055635 3300025901 Bacteria 2221
138 Ga0207699_10267513 3300025906 Bacteria 1183
139 Ga0207645_10011952 3300025907 Bacteria 5906
140 Ga0207663_10144766 3300025916 Bacteria 1660
141 Ga0207662_10002158 3300025918 Bacteria 9803
142 Ga0207657_10130002 3300025919 Bacteria 2064
143 Ga0207681_10046000 3300025923 Bacteria 2933
144 Ga0207650_10004200 3300025925 Bacteria 9839
145 Ga0207650_10013581 3300025925 Bacteria 5641
146 Ga0207650_10041217 3300025925 Bacteria 3382
147 Ga0207650_10089757 3300025925 Bacteria 2346
148 Ga0207650_10361617 3300025925 Bacteria 1196
149 Ga0207659_10127800 3300025926 Bacteria 1957
150 Ga0207687_10174120 3300025927 Bacteria 1662
151 Ga0207700_10030879 3300025928 Bacteria 3800
152 Ga0207644_10087748 3300025931 Bacteria 2312
153 Ga0207690_10052104 3300025932 Bacteria 2740
154 Ga0207706_10308048 3300025933 Bacteria 1379
155 Ga0207686_10084443 3300025934 Bacteria 2080
156 Ga0207709_10208408 3300025935 Bacteria 1401
157 Ga0207709_10520709 3300025935 Bacteria 931
158 Ga0207669_10051409 3300025937 Bacteria 2469
159 Ga0207669_10266915 3300025937 Bacteria 1283
160 Ga0207704_10385497 3300025938 Bacteria 1101
161 Ga0207691_10078508 3300025940 Bacteria 2972
162 Ga0207691_10506991 3300025940 Bacteria 1024
163 Ga0207711_10100752 3300025941 Bacteria 2555
164 Ga0207711_10141361 3300025941 Bacteria 2166
165 Ga0207689_10014135 3300025942 Bacteria 6793
166 Ga0207689_10027394 3300025942 Bacteria 4771
167 Ga0207661_10005050 3300025944 Bacteria 9260
168 Ga0207661_10015588 3300025944 Bacteria 5598
169 Ga0207661_10218572 3300025944 Bacteria 1683
170 Ga0207679_10098837 3300025945 Bacteria 2277
171 Ga0207679_10218047 3300025945 Bacteria 1604
172 Ga0207679_10400168 3300025945 Bacteria 1208
173 Ga0207679_10655586 3300025945 Bacteria 950
174 Ga0207651_10000958 3300025960 Bacteria 12747
175 Ga0207712_10016382 3300025961 Bacteria 4798
176 Ga0207658_10070424 3300025986 Bacteria 2646
177 Ga0207658_10150795 3300025986 Bacteria 1894
178 Ga0207658_10277545 3300025986 Bacteria 1435
179 Ga0207658_10477192 3300025986 Bacteria 1108
180 Ga0207703_10135088 3300026035 Bacteria 2134
181 Ga0207703_10544774 3300026035 Bacteria 1093
182 Ga0207639_10171751 3300026041 Bacteria 1836
183 Ga0207678_10182957 3300026067 Bacteria 1790
184 Ga0207678_10336469 3300026067 Bacteria 1300
185 Ga0207678_10710075 3300026067 Bacteria 885
186 Ga0207708_10044151 3300026075 Bacteria 3396
187 Ga0207708_10320278 3300026075 Bacteria 1265
188 Ga0207641_10197688 3300026088 Bacteria 1852
189 Ga0207648_10172867 3300026089 Bacteria 1910
190 Ga0207648_10222801 3300026089 Bacteria 1677
191 Ga0207676_10254607 3300026095 Bacteria 1582
192 Ga0207676_10383234 3300026095 Bacteria 1309
193 Ga0207674_10066167 3300026116 Bacteria 3641
194 Ga0207674_10082820 3300026116 Bacteria 3208
195 Ga0207674_10182553 3300026116 Bacteria 2049
196 Ga0207683_10193986 3300026121 Bacteria 1845
197 Ga0209813_10059184 3300027866 Bacteria 1219
198 Ga0207428_10000946 3300027907 Bacteria 32282
199 Ga0207428_10003921 3300027907 Bacteria 14262
200 Ga0268266_10158709 3300028379 Bacteria 2045
201 Ga0268266_10844200 3300028379 Bacteria 885
202 Ga0307408_100006691 3300031548 Bacteria 7645
203 Ga0307408_100064334 3300031548 Bacteria 2686
204 Ga0307408_100091529 3300031548 Bacteria 2297
205 Ga0307405_10022369 3300031731 Bacteria 3574
206 Ga0307405_10163462 3300031731 Bacteria 1580
207 Ga0307405_10235017 3300031731 Bacteria 1354
208 Ga0307413_10422412 3300031824 Bacteria 1050
209 Ga0307410_10220728 3300031852 Bacteria 1458
210 Ga0307406_10045667 3300031901 Bacteria 2752
211 Ga0307406_10071390 3300031901 Bacteria 2276
212 Ga0307412_10229632 3300031911 Bacteria 1428
213 Ga0307409_100245116 3300031995 Bacteria 1634
214 Ga0307409_100429672 3300031995 Bacteria 1269
215 Ga0307416_100034332 3300032002 Bacteria 3859
216 Ga0307416_100098120 3300032002 Bacteria 2540
217 Ga0307416_100159621 3300032002 Bacteria 2082
218 Ga0307414_10229933 3300032004 Bacteria 1528
219 Ga0307411_10043144 3300032005 Bacteria 2884
220 Ga0307411_10071782 3300032005 Bacteria 2348
221 Ga0307411_10560705 3300032005 Bacteria 976
222 Ga0307415_100043211 3300032126 Bacteria 3005
223 Ga0307415_100192980 3300032126 Bacteria 1609
224 Ga0373956_0153153 3300035119 Bacteria 1085
225 Ga0373960_0044563 3300035121 Bacteria 1296
226 Ga0373943_0082904 3300035170 Bacteria 1647
227 Ga0373947_0009671 3300035725 Bacteria 5534
228 Ga0373937_0002653 3300036401 Bacteria 14905
229 Ga0373925_0002373 3300037068 Bacteria 15107
230 Ga0395898_0903668 3300037466 Bacteria 821
231 Ga0439431_0115212 3300041997 Bacteria 747
232 Ga0439450_021918 3300042008 Bacteria 1375
233 Ga0439434_0118203 3300042435 Bacteria 863
234 Ga0439435_0005794 3300042436 Bacteria 2739
235 Ga0439435_0006365 3300042436 Bacteria 2651
236 Ga0439464_0001405 3300042439 Bacteria 5654
237 Ga0451577_0075178 3300042876 Bacteria 3013
238 Ga0453684_0100210 3300044712 Bacteria 3546
239 Ga0453684_1042841 3300044712 Bacteria 867
240 Ga0495603_0279746 3300046455 Bacteria 959
241 Ga0495629_0089519 3300046459 Bacteria 2147
242 Ga0495658_0289556 3300046683 Bacteria 1035
243 Ga0495669_0055810 3300046684 Bacteria 1779
244 Ga0495581_0071132 3300047315 Bacteria 2013
245 Ga0495680_0479052 3300047322 Bacteria 848
246 Ga0496102_0367484 3300048905 Bacteria 1354
247 Ga0496104_0211720 3300048907 Bacteria 1850
248 Ga0496104_0221439 3300048907 Bacteria 1804
249 Ga0496105_0195615 3300048908 Bacteria 1652
250 Ga0496106_0143888 3300048909 Bacteria 1877
251 Ga0496106_0412755 3300048909 Bacteria 1085
252 Ga0496108_0088498 3300048911 Bacteria 2631
253 Ga0496109_0049736 3300048912 Bacteria 3817
254 Ga0496109_0219506 3300048912 Bacteria 1788
255 Ga0496109_0231056 3300048912 Bacteria 1740
256 Ga0496110_0019703 3300048913 Bacteria 5683
257 Ga0496110_0074764 3300048913 Bacteria 3010
258 Ga0496110_0183501 3300048913 Bacteria 1900
259 Ga0496110_0461409 3300048913 Bacteria 1157
260 Ga0496112_0004310 3300048915 Bacteria 12023
261 Ga0496112_0042226 3300048915 Bacteria 4461
262 Ga0496112_0323482 3300048915 Bacteria 1486
263 Ga0496112_0498228 3300048915 Bacteria 1154
264 Ga0496112_0765544 3300048915 Bacteria 891
265 Ga0496113_0617662 3300048916 Bacteria 868
266 Ga0496115_0544721 3300048918 Bacteria 928
267 Ga0501292_030593 3300049515 Bacteria 904
268 Ga0501298_040184 3300049521 Bacteria 947
269 Ga0501299_001448 3300049522 Bacteria 3058
270 Ga0501031_0189707 3300049568 Bacteria 1342
271 Ga0501034_0045450 3300049571 Bacteria 4437
272 Ga0501036_0324508 3300049572 Bacteria 1286
273 Ga0501037_0371566 3300049573 Bacteria 984
274 Ga0501039_0196157 3300049575 Bacteria 1587
275 Ga0501039_0684844 3300049575 Bacteria 802
276 Ga0501040_0097842 3300049576 Bacteria 2045
277 Ga0501040_0194485 3300049576 Bacteria 1440
278 Ga0501040_0428588 3300049576 Bacteria 951
279 Ga0501040_0509069 3300049576 Bacteria 868
280 Ga0501041_0058213 3300049577 Bacteria 2363
281 Ga0501041_0088540 3300049577 Bacteria 1911
282 Ga0501041_0201106 3300049577 Bacteria 1249
283 Ga0501042_0053194 3300049578 Bacteria 2889
284 Ga0501042_0327456 3300049578 Bacteria 1107
285 Ga0501046_0193234 3300049580 Bacteria 1517
286 Ga0501047_0039960 3300049581 Bacteria 4537
287 Ga0501047_0285113 3300049581 Bacteria 1496
288 Ga0501048_0391319 3300049582 Bacteria 993
289 Ga0501067_0059548 3300049583 Bacteria 2114
290 Ga0501071_0054124 3300049587 Bacteria 2896
291 Ga0501071_0073975 3300049587 Bacteria 2486
292 Ga0501071_0164991 3300049587 Bacteria 1657
293 Ga0501072_0064764 3300049588 Bacteria 2882
294 Ga0501072_0120057 3300049588 Bacteria 2094
295 Ga0501072_0205142 3300049588 Bacteria 1571
296 Ga0501074_0243707 3300049590 Bacteria 1278
297 Ga0501074_0243726 3300049590 Bacteria 1278
298 Ga0501075_0116815 3300049591 Bacteria 2028
299 Ga0501076_0029965 3300049592 Bacteria 4236
300 Ga0501076_0213472 3300049592 Bacteria 1577
301 Ga0501076_0267273 3300049592 Bacteria 1400
302 Ga0501076_0403314 3300049592 Bacteria 1124
303 Ga0501076_0738969 3300049592 Bacteria 812
304 Ga0501077_0115648 3300049593 Bacteria 1700
305 Ga0501077_0379054 3300049593 Bacteria 903
306 Ga0501217_036770 3300049661 Bacteria 1230
307 Ga0501233_007759 3300049668 Bacteria 2051
308 Ga0501249_049405 3300049679 Bacteria 964
309 Ga0501249_063567 3300049679 Bacteria 857
310 Ga0501079_0157484 3300049741 Bacteria 1770
311 Ga0501079_0175552 3300049741 Bacteria 1671
312 Ga0501079_0178542 3300049741 Bacteria 1657
313 Ga0501079_0238064 3300049741 Bacteria 1422
314 Ga0501079_0349481 3300049741 Bacteria 1158
315 Ga0501080_0158597 3300049742 Bacteria 2090
316 Ga0501080_0291954 3300049742 Bacteria 1480
317 Ga0501080_0340107 3300049742 Bacteria 1356
318 Ga0501081_0194877 3300049743 Bacteria 1468
319 Ga0501083_0159121 3300049744 Bacteria 1478
320 Ga0501035_0264968 3300049822 Bacteria 1456
321 Ga0501035_0808515 3300049822 Bacteria 748
322 Ga0501045_0013549 3300049824 Bacteria 5760
323 Ga0501045_0057471 3300049824 Bacteria 2847
324 Ga0501045_0166930 3300049824 Bacteria 1639
325 Ga0501045_0202046 3300049824 Bacteria 1481
326 Ga0501045_0406276 3300049824 Bacteria 1013
327 nmdc:mga03683_7759_c1 3300050489 Bacteria 3741
328 nmdc:mga00v17_21714_c1 3300050491 Bacteria 3694
329 nmdc:mga00v17_271002_c1 3300050491 Bacteria 1102
330 nmdc:mga0yw44_241278_c1 3300050492 Bacteria 1201
331 nmdc:mga0yw44_56754_c1 3300050492 Bacteria 2387
332 nmdc:mga0k408_10328_c1 3300050493 Bacteria 5048
333 nmdc:mga0k408_3545_c1 3300050493 Bacteria 8246
334 nmdc:mga06z11_219029_c1 3300050494 Bacteria 1112
335 nmdc:mga06z11_41749_c1 3300050494 Bacteria 2297
336 nmdc:mga05p37_127009_c1 3300050507 Bacteria 3131
337 nmdc:mga05p37_134899_c1 3300050507 Bacteria 3028
338 nmdc:mga05p37_18032_c1 3300050507 Bacteria 8526
339 nmdc:mga05p37_31374_c1 3300050507 Bacteria 6490
340 nmdc:mga05p37_5773_c1 3300050507 Bacteria 14558
341 nmdc:mga05p37_68115_c1 3300050507 Bacteria 4377
342 nmdc:mga05p37_87571_c1 3300050507 Bacteria 3838
343 nmdc:mga09592_12268_c1 3300050508 Bacteria 6975
344 nmdc:mga09592_15430_c1 3300050508 Bacteria 6241
345 nmdc:mga09592_189422_c1 3300050508 Bacteria 1780
346 nmdc:mga09592_6191_c1 3300050508 Bacteria 9737
347 nmdc:mga0qj67_127936_c1 3300050509 Bacteria 2056
348 nmdc:mga0qj67_243372_c1 3300050509 Bacteria 1459
349 nmdc:mga06r32_14468_c1 3300050510 Bacteria 7162
350 nmdc:mga06r32_54983_c1 3300050510 Bacteria 3818
351 nmdc:mga06r32_60225_c1 3300050510 Bacteria 3653
352 nmdc:mga06r32_7424_c1 3300050510 Bacteria 9862
353 nmdc:mga08y16_192765_c1 3300050511 Bacteria 2113
354 nmdc:mga08y16_23164_c1 3300050511 Bacteria 6556
355 nmdc:mga08y16_38539_c1 3300050511 Bacteria 5019
356 nmdc:mga08y16_405955_c1 3300050511 Bacteria 1394
357 nmdc:mga08y16_941559_c1 3300050511 Bacteria 847
358 nmdc:mga0n895_202959_c1 3300050512 Bacteria 2013
359 nmdc:mga0n895_81279_c1 3300050512 Bacteria 3229
360 nmdc:mga0rr50_8864_c1 3300050513 Bacteria 6283
361 nmdc:mga08x19_545088_c1 3300050514 Bacteria 820
362 nmdc:mga0a205_133088_c1 3300050515 Bacteria 2387
363 nmdc:mga0a205_20745_c1 3300050515 Bacteria 6206
364 Ga0495601_0158920 3300053077 Bacteria 1477
365 Ga0495619_0029812 3300053085 Bacteria 3528
366 Ga0501084_0023565 3300054114 Bacteria 5134
367 Ga0501084_0242046 3300054114 Bacteria 1523
368 Ga0501082_0057477 3300060353 Bacteria 3352
369 Ga0530510_0008854 3300061734 Bacteria 7045
370 Ga0530510_0097187 3300061734 Bacteria 2153
371 Ga0070664_100287383
372 JGI24751J29686_10045136
373 Ga0065715_10027674
374 Ga0065715_10041944
375 Ga0065715_10190032
376 Ga0065715_10231533
377 Ga0065715_10262520
378 Ga0065715_10294676
379 Ga0065707_10176138
380 Ga0070676_10029599
381 Ga0070683_100002099
382 Ga0070683_100007549
383 Ga0070683_100094570
384 Ga0070690_100029080
385 Ga0070670_100061001
386 Ga0070670_100063704
387 Ga0070670_100098738
388 Ga0070670_100111583
389 Ga0068869_100013748
390 Ga0068869_100133117
391 Ga0070660_100488142
392 Ga0070689_100059585
393 Ga0070669_100003630
394 Ga0070669_100289280
395 Ga0070675_100134421
396 Ga0070675_100156628
397 Ga0070675_100424254
398 Ga0070671_100065954
399 Ga0070671_100343025
400 Ga0070674_100012985
401 Ga0070674_100035351
402 Ga0070673_100093514
403 Ga0070673_100604993
404 Ga0070659_100060752
405 Ga0070667_100242475
406 Ga0070667_100253051
407 Ga0070709_10162107
408 Ga0070709_10346896
409 Ga0070713_100024008
410 Ga0070701_10338395
411 Ga0070711_100156827
412 Ga0070700_100023696
413 Ga0070663_100133674
414 Ga0070663_100184734
415 Ga0070678_100128429
416 Ga0070662_100461274
417 Ga0068867_100146583
418 Ga0070685_10272066
419 Ga0070679_100084422
420 Ga0070684_100000301
421 Ga0070684_100230584
422 Ga0070684_100250644
423 Ga0068853_100236414
424 Ga0070672_100548786
425 Ga0070695_100072264
426 Ga0070695_100278850
427 Ga0070693_100123105
428 Ga0070693_100127037
429 Ga0070665_100979094
430 Ga0070704_100105598
431 Ga0070664_100061330
432 Ga0070664_100121424
433 Ga0070664_100206336
434 Ga0070664_100305682
435 Ga0068857_100019318
436 Ga0068857_100172863
437 Ga0068857_100300443
438 Ga0068854_100127388
439 Ga0070702_100151161
440 Ga0068852_100068835
441 Ga0068852_100135599
442 Ga0068859_100192990
443 Ga0068859_100196179
444 Ga0068859_100470885
445 Ga0068864_100284388
446 Ga0068864_100286727
447 Ga0068864_100343430
448 Ga0068866_10104241
449 Ga0068861_100094217
450 Ga0068863_100481835
451 Ga0068858_100176955
452 Ga0068862_100057673
453 Ga0075365_10065477
454 Ga0075368_10019470
455 Ga0075364_10031850
456 Ga0075362_10000376
457 Ga0075367_10007622
458 Ga0075366_10006026
459 Ga0075366_10009811
460 Ga0097621_100270808
461 Ga0075370_10052165
462 Ga0068871_100151230
463 Ga0075428_100035772
464 Ga0075428_100040377
465 Ga0075428_100351683
466 Ga0075428_100509838
467 Ga0075428_100632197
468 Ga0075430_100002408
469 Ga0075430_100292388
470 Ga0075431_100007535
471 Ga0075431_100013658
472 Ga0075431_100215607
473 Ga0075433_10009133
474 Ga0075433_10103682
475 Ga0075434_100310219
476 Ga0075429_100000088
477 Ga0075429_100080053
478 Ga0075429_100128112
479 Ga0075429_100136097
480 Ga0075429_100176801
481 Ga0068865_100106761
482 Ga0097620_100192989
483 Ga0097620_100196191
484 Ga0097620_100470881
485 Ga0075435_100000569
486 Ga0111539_10000039
487 Ga0111539_10000112
488 Ga0105245_10041387
489 Ga0114129_10003739
490 Ga0114129_10014871
491 Ga0114129_10046472
492 Ga0114129_10102301
493 Ga0114129_10147229
494 Ga0105242_10020926
495 Ga0105248_10023062
496 Ga0105248_10084942
497 Ga0105237_10674572
498 Ga0105249_10007602
499 Ga0105249_10474650
500 Ga0105246_10590606
501 Ga0163162_10639440
502 Ga0157375_10390146
503 Ga0163163_10020544
504 Ga0157380_10813136
505 Ga0207697_10002025
506 Ga0207688_10011510
507 Ga0207688_10055635
508 Ga0207699_10267513
509 Ga0207645_10011952
510 Ga0207663_10144766
511 Ga0207662_10002158
512 Ga0207657_10130002
513 Ga0207681_10046000
514 Ga0207650_10004200
515 Ga0207650_10013581
516 Ga0207650_10041217
517 Ga0207650_10089757
518 Ga0207650_10361617
519 Ga0207659_10127800
520 Ga0207687_10174120
521 Ga0207700_10030879
522 Ga0207644_10087748
523 Ga0207690_10052104
524 Ga0207706_10308048
525 Ga0207686_10084443
526 Ga0207709_10208408
527 Ga0207709_10520709
528 Ga0207669_10051409
529 Ga0207669_10266915
530 Ga0207704_10385497
531 Ga0207691_10078508
532 Ga0207691_10506991
533 Ga0207711_10100752
534 Ga0207711_10141361
535 Ga0207689_10014135
536 Ga0207689_10027394
537 Ga0207661_10005050
538 Ga0207661_10015588
539 Ga0207661_10218572
540 Ga0207679_10098837
541 Ga0207679_10218047
542 Ga0207679_10400168
543 Ga0207679_10655586
544 Ga0207651_10000958
545 Ga0207712_10016382
546 Ga0207658_10070424
547 Ga0207658_10150795
548 Ga0207658_10277545
549 Ga0207658_10477192
550 Ga0207703_10135088
551 Ga0207703_10544774
552 Ga0207639_10171751
553 Ga0207678_10182957
554 Ga0207678_10336469
555 Ga0207678_10710075
556 Ga0207708_10044151
557 Ga0207708_10320278
558 Ga0207641_10197688
559 Ga0207648_10172867
560 Ga0207648_10222801
561 Ga0207676_10254607
562 Ga0207676_10383234
563 Ga0207674_10066167
564 Ga0207674_10082820
565 Ga0207674_10182553
566 Ga0207683_10193986
567 Ga0209813_10059184
568 Ga0207428_10000946
569 Ga0207428_10003921
570 Ga0268266_10158709
571 Ga0268266_10844200
572 Ga0307408_100006691
573 Ga0307408_100064334
574 Ga0307408_100091529
575 Ga0307405_10022369
576 Ga0307405_10163462
577 Ga0307405_10235017
578 Ga0307413_10422412
579 Ga0307410_10220728
580 Ga0307406_10045667
581 Ga0307406_10071390
582 Ga0307412_10229632
583 Ga0307409_100245116
584 Ga0307409_100429672
585 Ga0307416_100034332
586 Ga0307416_100098120
587 Ga0307416_100159621
588 Ga0307414_10229933
589 Ga0307411_10043144
590 Ga0307411_10071782
591 Ga0307411_10560705
592 Ga0307415_100043211
593 Ga0307415_100192980
594 Ga0373956_0153153
595 Ga0373960_0044563
596 Ga0373943_0082904
597 Ga0373947_0009671
598 Ga0373937_0002653
599 Ga0373925_0002373
600 Ga0395898_0903668
601 Ga0439431_0115212
602 Ga0439450_021918
603 Ga0439434_0118203
604 Ga0439435_0005794
605 Ga0439435_0006365
606 Ga0439464_0001405
607 Ga0451577_0075178
608 Ga0453684_0100210
609 Ga0453684_1042841
610 Ga0495603_0279746
611 Ga0495629_0089519
612 Ga0495658_0289556
613 Ga0495669_0055810
614 Ga0495581_0071132
615 Ga0495680_0479052
616 Ga0496102_0367484
617 Ga0496104_0211720
618 Ga0496104_0221439
619 Ga0496105_0195615
620 Ga0496106_0143888
621 Ga0496106_0412755
622 Ga0496108_0088498
623 Ga0496109_0049736
624 Ga0496109_0219506
625 Ga0496109_0231056
626 Ga0496110_0019703
627 Ga0496110_0074764
628 Ga0496110_0183501
629 Ga0496110_0461409
630 Ga0496112_0004310
631 Ga0496112_0042226
632 Ga0496112_0323482
633 Ga0496112_0498228
634 Ga0496112_0765544
635 Ga0496113_0617662
636 Ga0496115_0544721
637 Ga0501292_030593
638 Ga0501298_040184
639 Ga0501299_001448
640 Ga0501031_0189707
641 Ga0501034_0045450
642 Ga0501036_0324508
643 Ga0501037_0371566
644 Ga0501039_0196157
645 Ga0501039_0684844
646 Ga0501040_0097842
647 Ga0501040_0194485
648 Ga0501040_0428588
649 Ga0501040_0509069
650 Ga0501041_0058213
651 Ga0501041_0088540
652 Ga0501041_0201106
653 Ga0501042_0053194
654 Ga0501042_0327456
655 Ga0501046_0193234
656 Ga0501047_0039960
657 Ga0501047_0285113
658 Ga0501048_0391319
659 Ga0501067_0059548
660 Ga0501071_0054124
661 Ga0501071_0073975
662 Ga0501071_0164991
663 Ga0501072_0064764
664 Ga0501072_0120057
665 Ga0501072_0205142
666 Ga0501074_0243707
667 Ga0501074_0243726
668 Ga0501075_0116815
669 Ga0501076_0029965
670 Ga0501076_0213472
671 Ga0501076_0267273
672 Ga0501076_0403314
673 Ga0501076_0738969
674 Ga0501077_0115648
675 Ga0501077_0379054
676 Ga0501217_036770
677 Ga0501233_007759
678 Ga0501249_049405
679 Ga0501249_063567
680 Ga0501079_0157484
681 Ga0501079_0175552
682 Ga0501079_0178542
683 Ga0501079_0238064
684 Ga0501079_0349481
685 Ga0501080_0158597
686 Ga0501080_0291954
687 Ga0501080_0340107
688 Ga0501081_0194877
689 Ga0501083_0159121
690 Ga0501035_0264968
691 Ga0501035_0808515
692 Ga0501045_0013549
693 Ga0501045_0057471
694 Ga0501045_0166930
695 Ga0501045_0202046
696 Ga0501045_0406276
697 nmdc:mga03683_7759_c1
698 nmdc:mga00v17_21714_c1
699 nmdc:mga00v17_271002_c1
700 nmdc:mga0yw44_241278_c1
701 nmdc:mga0yw44_56754_c1
702 nmdc:mga0k408_10328_c1
703 nmdc:mga0k408_3545_c1
704 nmdc:mga06z11_219029_c1
705 nmdc:mga06z11_41749_c1
706 nmdc:mga05p37_127009_c1
707 nmdc:mga05p37_134899_c1
708 nmdc:mga05p37_18032_c1
709 nmdc:mga05p37_31374_c1
710 nmdc:mga05p37_5773_c1
711 nmdc:mga05p37_68115_c1
712 nmdc:mga05p37_87571_c1
713 nmdc:mga09592_12268_c1
714 nmdc:mga09592_15430_c1
715 nmdc:mga09592_189422_c1
716 nmdc:mga09592_6191_c1
717 nmdc:mga0qj67_127936_c1
718 nmdc:mga0qj67_243372_c1
719 nmdc:mga06r32_14468_c1
720 nmdc:mga06r32_54983_c1
721 nmdc:mga06r32_60225_c1
722 nmdc:mga06r32_7424_c1
723 nmdc:mga08y16_192765_c1
724 nmdc:mga08y16_23164_c1
725 nmdc:mga08y16_38539_c1
726 nmdc:mga08y16_405955_c1
727 nmdc:mga08y16_941559_c1
728 nmdc:mga0n895_202959_c1
729 nmdc:mga0n895_81279_c1
730 nmdc:mga0rr50_8864_c1
731 nmdc:mga08x19_545088_c1
732 nmdc:mga0a205_133088_c1
733 nmdc:mga0a205_20745_c1
734 Ga0495601_0158920
735 Ga0495619_0029812
736 Ga0501084_0023565
737 Ga0501084_0242046
738 Ga0501082_0057477
739 Ga0530510_0008854
740 Ga0530510_0097187

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00121

TIM

Triosephosphate isomerase

5

251

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1b9b-assembly1.cif.gz_B triosephosphate isomerase of thermotoga maritima 0.9694 1 250
4y8f-assembly1.cif.gz_A-2 crystal structure of triosephosphate isomerase from clostridium perfringens 0.9638 3 249
2btm-assembly1.cif.gz_B does the his12-lys13 pair play a role in the adaptation of thermophilic tims to high temperatures? 0.9636 3 252
1tmh-assembly2.cif.gz_D modular mutagenesis of a tim-barrel enzyme: the crystal structure of a chimeric e. coli tim having the eighth (beta-alpha)-unit replaced by the equivalent unit of chicken tim 0.9631 3 251
1btm-assembly1.cif.gz_B triosephosphate isomerase (tim) complexed with 2-phosphoglycolic acid 0.9624 3 253
ID Description Score Start End Superfamily
af_P0A858_1_255_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9637 3 251 3.20.20.70
af_P17751_41_299_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9608 42 252 3.20.20.70
4y96A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9561 2 252 3.20.20.70
3taoB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9548 2 251 3.20.20.70
4y96A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9523 2 252 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A521T0F8-F1-model_v4 Triosephosphate isomerase (EC 5.3.1.1) 0.9846 3 235 GO:0004807
GO:0005829
GO:0006094
GO:0006096
GO:0019563
GO:0046166
AF-A0A7V9RBW2-F1-model_v4 Triosephosphate isomerase (EC 5.3.1.1) 0.9828 3 208 GO:0004807
GO:0005829
GO:0006094
GO:0006096
GO:0019563
GO:0046166
AF-A0A2V8C848-F1-model_v4 Triosephosphate isomerase (EC 5.3.1.1) 0.9815 3 188 GO:0004807
GO:0005829
GO:0006094
GO:0006096
GO:0019563
GO:0046166
AF-A0A2V6GZS1-F1-model_v4 Triosephosphate isomerase (EC 5.3.1.1) 0.9815 79 253 GO:0004807
GO:0005829
GO:0006094
GO:0006096
GO:0019563
GO:0046166
AF-A0A2D4SQP5-F1-model_v4 Triosephosphate isomerase (TIM) (TPI) (EC 5.3.1.1) (Triose-phosphate isomerase) 0.9801 3 251 GO:0004807
GO:0005829
GO:0006094
GO:0006096
GO:0019563
GO:0046166

Map