F425298

General Info

Members Datasets Scaffolds Average Seq Length
370 175 740 204

Family's Representative Sequence

Representative Sequence 3300005441|Ga0070700_100419401|Ga0070700_1004194012
Length 216
Sequence MPSHRPAIVGIGGFQSNIGKTTLVCELLKQFPGWEAIKTTRGHYRSCGKDPHACCVSHLLADQPVVHSGKQETYTQGKDTGRYWDAGAVNVHWVIATDEQIERGITEALERVNRPGVFIEGNSFSDFVEVDAMLMVASVNHWTIKKSAKKALLRSTGIILTAENFEVISPQEVDEFTQWLTAQKILADGAMPAVYPWQDKHRLGSHIRELTDSLAA

Samples

Sample ID Description Type Environment
1 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
130 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
131 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
134 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
135 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
136 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
137 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
138 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
139 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
140 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
141 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
142 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
143 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
144 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
145 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
146 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
147 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
148 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
149 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
150 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
151 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
152 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
153 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
154 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
155 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
156 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
157 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
158 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
159 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
160 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
161 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
162 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
163 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
164 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
165 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
166 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
167 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
168 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
169 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
170 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
171 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
172 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
173 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
174 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
175 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.62
Rhizosphere 98.11
Stem 0
Stem Tuber 0
Unclassified 21.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070700_100419401 3300005441 Unclassified 1011
2 MBSR1b_contig_372111 2162886012 Unclassified 959
3 JGI24751J29686_10000124 3300002459 Bacteria 38798
4 rootH2_10176230 3300003320 Unclassified 1374
5 Ga0065704_10012703 3300005289 Bacteria 1797
6 Ga0065704_10200313 3300005289 Unclassified 1149
7 Ga0065712_10006655 3300005290 Bacteria 3151
8 Ga0065712_10161405 3300005290 Bacteria 1300
9 Ga0065712_10187738 3300005290 Unclassified 1162
10 Ga0065715_10004159 3300005293 Bacteria 3972
11 Ga0065715_10019429 3300005293 Bacteria 2076
12 Ga0065707_10160661 3300005295 Bacteria 1566
13 Ga0070690_100174583 3300005330 Bacteria 1481
14 Ga0070670_100002011 3300005331 Bacteria 16631
15 Ga0070670_100527331 3300005331 Unclassified 1052
16 Ga0068869_100040052 3300005334 Bacteria 3349
17 Ga0068869_100052326 3300005334 Unclassified 2965
18 Ga0068869_100164344 3300005334 Bacteria 1730
19 Ga0070666_10049652 3300005335 Bacteria 2820
20 Ga0070682_100000247 3300005337 Bacteria 39158
21 Ga0070682_100016927 3300005337 Bacteria 4243
22 Ga0070682_100051226 3300005337 Bacteria 2580
23 Ga0068868_100085711 3300005338 Bacteria 2531
24 Ga0070689_100158736 3300005340 Bacteria 1827
25 Ga0070687_100186333 3300005343 Unclassified 1247
26 Ga0070687_100328974 3300005343 Unclassified 979
27 Ga0070687_100449048 3300005343 Bacteria 857
28 Ga0070661_100247990 3300005344 Bacteria 1373
29 Ga0070692_10034204 3300005345 Bacteria 2565
30 Ga0070692_10168717 3300005345 Bacteria 1260
31 Ga0070669_100069106 3300005353 Bacteria 2608
32 Ga0070669_100204179 3300005353 Bacteria 1556
33 Ga0070675_100888466 3300005354 Unclassified 816
34 Ga0070671_100008634 3300005355 Bacteria 8170
35 Ga0070671_100218912 3300005355 Bacteria 1615
36 Ga0070673_100046153 3300005364 Bacteria 3383
37 Ga0070673_100067240 3300005364 Bacteria 2865
38 Ga0070673_100071453 3300005364 Bacteria 2789
39 Ga0070688_100078139 3300005365 Bacteria 2134
40 Ga0070688_100207024 3300005365 Bacteria 1375
41 Ga0070667_100027380 3300005367 Bacteria 4741
42 Ga0070701_10592659 3300005438 Unclassified 733
43 Ga0070705_100007011 3300005440 Bacteria 5540
44 Ga0070705_100134890 3300005440 Bacteria 1616
45 Ga0070705_100413632 3300005440 Bacteria 1002
46 Ga0070700_100000173 3300005441 Bacteria 36530
47 Ga0070700_100038294 3300005441 Bacteria 2921
48 Ga0070700_100264558 3300005441 Bacteria 1240
49 Ga0070694_100010128 3300005444 Bacteria 5800
50 Ga0070694_100024860 3300005444 Bacteria 3870
51 Ga0070694_100323610 3300005444 Bacteria 1187
52 Ga0070694_100532162 3300005444 Unclassified 939
53 Ga0070694_100550744 3300005444 Unclassified 923
54 Ga0070678_100208455 3300005456 Bacteria 1618
55 Ga0070681_10008664 3300005458 Bacteria 9976
56 Ga0068867_100022612 3300005459 Bacteria 4495
57 Ga0068867_100105279 3300005459 Unclassified 2160
58 Ga0070685_10031321 3300005466 Bacteria 2970
59 Ga0070685_10166763 3300005466 Bacteria 1408
60 Ga0070685_10457238 3300005466 Bacteria 895
61 Ga0070698_100024071 3300005471 Bacteria 6355
62 Ga0070679_100263609 3300005530 Bacteria 1678
63 Ga0070679_100280394 3300005530 Bacteria 1619
64 Ga0070684_100284211 3300005535 Bacteria 1516
65 Ga0068853_100363593 3300005539 Bacteria 1348
66 Ga0070672_100010989 3300005543 Bacteria 6300
67 Ga0070686_100034633 3300005544 Bacteria 3113
68 Ga0070686_100106946 3300005544 Bacteria 1899
69 Ga0070686_100201712 3300005544 Bacteria 1426
70 Ga0070695_100016465 3300005545 Bacteria 4476
71 Ga0070695_100154197 3300005545 Bacteria 1606
72 Ga0070695_100743694 3300005545 Unclassified 782
73 Ga0070696_100083978 3300005546 Bacteria 2259
74 Ga0070696_100199935 3300005546 Unclassified 1491
75 Ga0070693_100004711 3300005547 Bacteria 6485
76 Ga0070693_100179208 3300005547 Bacteria 1363
77 Ga0070704_100115956 3300005549 Bacteria 2047
78 Ga0070704_100155387 3300005549 Bacteria 1804
79 Ga0070704_100361646 3300005549 Unclassified 1228
80 Ga0070664_100180994 3300005564 Bacteria 1873
81 Ga0068857_100101941 3300005577 Bacteria 2576
82 Ga0068857_100298887 3300005577 Bacteria 1484
83 Ga0068854_100075022 3300005578 Bacteria 2482
84 Ga0068854_100132353 3300005578 Bacteria 1905
85 Ga0068854_100258561 3300005578 Bacteria 1393
86 Ga0068854_100886541 3300005578 Bacteria 783
87 Ga0070702_100069749 3300005615 Bacteria 2072
88 Ga0070702_100155481 3300005615 Unclassified 1472
89 Ga0070702_100167897 3300005615 Unclassified 1425
90 Ga0070702_100518334 3300005615 Bacteria 879
91 Ga0068852_100187633 3300005616 Bacteria 1948
92 Ga0068852_100328291 3300005616 Bacteria 1488
93 Ga0068859_100020151 3300005617 Bacteria 6696
94 Ga0068859_100032930 3300005617 Bacteria 5206
95 Ga0068859_100110731 3300005617 Bacteria 2807
96 Ga0068859_100149960 3300005617 Bacteria 2407
97 Ga0068859_100989073 3300005617 Bacteria 924
98 Ga0068859_101032032 3300005617 Unclassified 903
99 Ga0068864_100019095 3300005618 Bacteria 5729
100 Ga0068864_100380511 3300005618 Bacteria 1337
101 Ga0068864_100776002 3300005618 Unclassified 941
102 Ga0068866_10027316 3300005718 Bacteria 2705
103 Ga0068861_100660862 3300005719 Bacteria 967
104 Ga0068861_100717676 3300005719 Bacteria 931
105 Ga0068861_100841155 3300005719 Unclassified 864
106 Ga0068851_10008690 3300005834 Bacteria 4705
107 Ga0068851_10208195 3300005834 Unclassified 1094
108 Ga0068863_100147292 3300005841 Bacteria 2252
109 Ga0068863_100297175 3300005841 Bacteria 1566
110 Ga0068863_100526892 3300005841 Bacteria 1165
111 Ga0068863_100627901 3300005841 Bacteria 1065
112 Ga0068858_100066950 3300005842 Bacteria 3326
113 Ga0068858_100140091 3300005842 Bacteria 2270
114 Ga0068858_100160819 3300005842 Bacteria 2114
115 Ga0068858_100166779 3300005842 Unclassified 2075
116 Ga0068858_100176282 3300005842 Bacteria 2017
117 Ga0068858_100407598 3300005842 Unclassified 1307
118 Ga0068858_100750680 3300005842 Unclassified 951
119 Ga0068860_100042050 3300005843 Bacteria 4367
120 Ga0068860_100087381 3300005843 Bacteria 2968
121 Ga0068860_100146351 3300005843 Bacteria 2273
122 Ga0068860_100261666 3300005843 Bacteria 1686
123 Ga0068860_100298195 3300005843 Bacteria 1578
124 Ga0068860_100771913 3300005843 Bacteria 974
125 Ga0068862_100338239 3300005844 Unclassified 1393
126 Ga0068862_101227773 3300005844 Bacteria 749
127 Ga0081539_10003445 3300005985 Bacteria 19432
128 Ga0097621_100015139 3300006237 Bacteria 5795
129 Ga0097621_100030066 3300006237 Bacteria 4297
130 Ga0097621_100066243 3300006237 Bacteria 2974
131 Ga0097621_100116003 3300006237 Bacteria 2267
132 Ga0068871_100021103 3300006358 Bacteria 5001
133 Ga0068871_100027773 3300006358 Bacteria 4429
134 Ga0068871_100051081 3300006358 Bacteria 3346
135 Ga0068871_100081400 3300006358 Bacteria 2682
136 Ga0075428_100495574 3300006844 Bacteria 1307
137 Ga0075429_100053941 3300006880 Bacteria 3497
138 Ga0097620_100016576 3300006931 Bacteria 7398
139 Ga0097620_100020150 3300006931 Bacteria 6696
140 Ga0097620_100032929 3300006931 Bacteria 5206
141 Ga0097620_100110730 3300006931 Bacteria 2807
142 Ga0097620_100149966 3300006931 Bacteria 2407
143 Ga0097620_100989004 3300006931 Bacteria 924
144 Ga0097620_101032072 3300006931 Unclassified 903
145 Ga0097620_101040257 3300006931 Unclassified 900
146 Ga0105240_10059271 3300009093 Bacteria 4778
147 Ga0111539_10123145 3300009094 Bacteria 3039
148 Ga0105245_10055677 3300009098 Bacteria 3553
149 Ga0105245_10241041 3300009098 Unclassified 1752
150 Ga0105245_10570608 3300009098 Bacteria 1155
151 Ga0105245_11849581 3300009098 Unclassified 657
152 Ga0105247_10002754 3300009101 Bacteria 11769
153 Ga0105247_10259621 3300009101 Unclassified 1191
154 Ga0114129_10108049 3300009147 Bacteria 3842
155 Ga0114129_10509860 3300009147 Bacteria 1570
156 Ga0105243_10038296 3300009148 Bacteria 3734
157 Ga0105243_10056078 3300009148 Unclassified 3132
158 Ga0105243_10149696 3300009148 Bacteria 2001
159 Ga0105243_10204557 3300009148 Unclassified 1734
160 Ga0105243_10254160 3300009148 Bacteria 1570
161 Ga0105243_10306085 3300009148 Bacteria 1442
162 Ga0105243_10664156 3300009148 Unclassified 1012
163 Ga0105243_10692177 3300009148 Bacteria 993
164 Ga0105241_10058661 3300009174 Bacteria 2956
165 Ga0105241_10134810 3300009174 Bacteria 2003
166 Ga0105241_10553289 3300009174 Bacteria 1033
167 Ga0105242_10036008 3300009176 Bacteria 3969
168 Ga0105242_10080973 3300009176 Bacteria 2714
169 Ga0105242_10221914 3300009176 Bacteria 1690
170 Ga0105248_10016493 3300009177 Bacteria 8132
171 Ga0105248_10062709 3300009177 Bacteria 4173
172 Ga0105248_10214072 3300009177 Bacteria 2171
173 Ga0105248_10269521 3300009177 Bacteria 1917
174 Ga0105248_10317951 3300009177 Bacteria 1753
175 Ga0105248_10349873 3300009177 Bacteria 1664
176 Ga0105248_10519452 3300009177 Bacteria 1343
177 Ga0105237_10015469 3300009545 Bacteria 7939
178 Ga0105237_10122581 3300009545 Bacteria 2593
179 Ga0105237_10438387 3300009545 Bacteria 1312
180 Ga0105238_10028503 3300009551 Bacteria 5689
181 Ga0105238_10031518 3300009551 Bacteria 5398
182 Ga0105238_10551786 3300009551 Bacteria 1157
183 Ga0105249_10033042 3300009553 Bacteria 4684
184 Ga0105249_10146964 3300009553 Bacteria 2266
185 Ga0105249_10256649 3300009553 Bacteria 1735
186 Ga0105249_10915147 3300009553 Unclassified 944
187 Ga0105239_10192804 3300010375 Bacteria 2281
188 Ga0105239_10456453 3300010375 Bacteria 1450
189 Ga0105239_10555548 3300010375 Bacteria 1308
190 Ga0105239_11698045 3300010375 Unclassified 731
191 Ga0105246_10061858 3300011119 Bacteria 2606
192 Ga0105246_10502199 3300011119 Bacteria 1030
193 Ga0105246_10543021 3300011119 Bacteria 995
194 Ga0105246_11058354 3300011119 Unclassified 738
195 Ga0157373_10070521 3300013100 Bacteria 2469
196 Ga0157373_10102191 3300013100 Bacteria 2017
197 Ga0157374_10056814 3300013296 Unclassified 3654
198 Ga0157378_10015186 3300013297 Bacteria 6743
199 Ga0157378_10153458 3300013297 Bacteria 2147
200 Ga0157378_10266752 3300013297 Bacteria 1645
201 Ga0163162_10028900 3300013306 Bacteria 5488
202 Ga0163162_10213521 3300013306 Bacteria 2059
203 Ga0163162_10288901 3300013306 Bacteria 1772
204 Ga0163162_10437956 3300013306 Bacteria 1439
205 Ga0163162_10496050 3300013306 Bacteria 1352
206 Ga0163162_11402940 3300013306 Bacteria 795
207 Ga0157372_10008096 3300013307 Bacteria 11181
208 Ga0157375_10068279 3300013308 Bacteria 3556
209 Ga0157375_10370568 3300013308 Bacteria 1598
210 Ga0163163_10014128 3300014325 Bacteria 7333
211 Ga0163163_10078659 3300014325 Bacteria 3295
212 Ga0163163_10546832 3300014325 Unclassified 1220
213 Ga0157380_10003003 3300014326 Bacteria 11485
214 Ga0157380_10048043 3300014326 Bacteria 3359
215 Ga0157380_10161342 3300014326 Bacteria 1949
216 Ga0157377_10017571 3300014745 Bacteria 3700
217 Ga0157377_10179375 3300014745 Bacteria 1331
218 Ga0157379_10263324 3300014968 Unclassified 1567
219 Ga0157376_10042648 3300014969 Bacteria 3719
220 Ga0163161_10096567 3300017792 Bacteria 2193
221 Ga0207697_10026539 3300025315 Bacteria 2368
222 Ga0207697_10252789 3300025315 Bacteria 780
223 Ga0207656_10004857 3300025321 Bacteria 4718
224 Ga0207653_10038135 3300025885 Bacteria 1569
225 Ga0207710_10001315 3300025900 Bacteria 12550
226 Ga0207647_10011372 3300025904 Bacteria 6244
227 Ga0207647_10177968 3300025904 Bacteria 1237
228 Ga0207684_10168115 3300025910 Unclassified 1890
229 Ga0207654_10253940 3300025911 Unclassified 1180
230 Ga0207654_10325923 3300025911 Bacteria 1051
231 Ga0207707_10054395 3300025912 Bacteria 3484
232 Ga0207695_10231675 3300025913 Bacteria 1751
233 Ga0207671_10016690 3300025914 Bacteria 5699
234 Ga0207662_10325378 3300025918 Unclassified 1027
235 Ga0207652_10237729 3300025921 Bacteria 1642
236 Ga0207681_10003186 3300025923 Bacteria 10297
237 Ga0207681_10036101 3300025923 Unclassified 3259
238 Ga0207694_10020216 3300025924 Bacteria 5035
239 Ga0207694_11136129 3300025924 Unclassified 661
240 Ga0207650_10000022 3300025925 Bacteria 318878
241 Ga0207650_10003038 3300025925 Bacteria 11555
242 Ga0207659_10171742 3300025926 Bacteria 1710
243 Ga0207659_10330155 3300025926 Unclassified 1260
244 Ga0207644_10050704 3300025931 Bacteria 2976
245 Ga0207644_10051575 3300025931 Bacteria 2954
246 Ga0207706_10690328 3300025933 Unclassified 873
247 Ga0207686_10024728 3300025934 Bacteria 3484
248 Ga0207686_10036850 3300025934 Bacteria 2948
249 Ga0207709_10031965 3300025935 Bacteria 3079
250 Ga0207709_10083315 3300025935 Bacteria 2067
251 Ga0207709_10126125 3300025935 Unclassified 1736
252 Ga0207670_10083338 3300025936 Bacteria 2243
253 Ga0207670_10650577 3300025936 Bacteria 869
254 Ga0207669_10084279 3300025937 Bacteria 2048
255 Ga0207691_10035547 3300025940 Bacteria 4623
256 Ga0207691_10474892 3300025940 Unclassified 1063
257 Ga0207711_10011141 3300025941 Bacteria 7473
258 Ga0207711_10025122 3300025941 Bacteria 4999
259 Ga0207711_10046033 3300025941 Bacteria 3727
260 Ga0207711_10075959 3300025941 Bacteria 2925
261 Ga0207711_10162957 3300025941 Bacteria 2020
262 Ga0207689_10003891 3300025942 Bacteria 13603
263 Ga0207689_10058879 3300025942 Bacteria 3160
264 Ga0207689_10120249 3300025942 Bacteria 2161
265 Ga0207689_10235591 3300025942 Bacteria 1513
266 Ga0207689_10274712 3300025942 Bacteria 1395
267 Ga0207689_10281095 3300025942 Bacteria 1378
268 Ga0207651_10151377 3300025960 Bacteria 1806
269 Ga0207640_10089730 3300025981 Bacteria 2125
270 Ga0207640_10160080 3300025981 Bacteria 1664
271 Ga0207640_10223706 3300025981 Bacteria 1443
272 Ga0207640_10820987 3300025981 Bacteria 807
273 Ga0207658_10032451 3300025986 Bacteria 3717
274 Ga0207677_10029007 3300026023 Bacteria 3510
275 Ga0207677_11123883 3300026023 Unclassified 717
276 Ga0207703_10042265 3300026035 Bacteria 3656
277 Ga0207703_10287139 3300026035 Unclassified 1496
278 Ga0207703_10302321 3300026035 Bacteria 1459
279 Ga0207703_10345533 3300026035 Bacteria 1368
280 Ga0207703_10784444 3300026035 Unclassified 909
281 Ga0207639_10156726 3300026041 Bacteria 1914
282 Ga0207639_10498958 3300026041 Unclassified 1112
283 Ga0207639_11058108 3300026041 Bacteria 760
284 Ga0207708_10000475 3300026075 Bacteria 31007
285 Ga0207708_10056115 3300026075 Bacteria 3004
286 Ga0207708_10062874 3300026075 Bacteria 2836
287 Ga0207708_10349121 3300026075 Bacteria 1213
288 Ga0207708_10423515 3300026075 Bacteria 1104
289 Ga0207641_10106492 3300026088 Bacteria 2478
290 Ga0207641_10174458 3300026088 Bacteria 1965
291 Ga0207641_10367064 3300026088 Bacteria 1376
292 Ga0207641_10369977 3300026088 Bacteria 1370
293 Ga0207641_10658391 3300026088 Unclassified 1029
294 Ga0207648_10255825 3300026089 Bacteria 1562
295 Ga0207676_10018508 3300026095 Bacteria 5064
296 Ga0207676_10359480 3300026095 Bacteria 1349
297 Ga0207676_10360271 3300026095 Bacteria 1347
298 Ga0207674_10123868 3300026116 Bacteria 2551
299 Ga0207674_10245597 3300026116 Bacteria 1737
300 Ga0207674_10501611 3300026116 Bacteria 1173
301 Ga0207675_100037749 3300026118 Bacteria 4506
302 Ga0207675_100424993 3300026118 Bacteria 1313
303 Ga0207698_10026260 3300026142 Bacteria 4117
304 Ga0207698_10171139 3300026142 Bacteria 1913
305 Ga0207698_10798103 3300026142 Unclassified 946
306 Ga0207428_10063644 3300027907 Bacteria 2913
307 Ga0268265_10095898 3300028380 Bacteria 2383
308 Ga0268265_10236568 3300028380 Bacteria 1609
309 Ga0268265_10653565 3300028380 Bacteria 1011
310 Ga0268264_10081165 3300028381 Bacteria 2771
311 Ga0268264_10083047 3300028381 Bacteria 2743
312 Ga0268264_10115126 3300028381 Bacteria 2362
313 Ga0268264_10144503 3300028381 Bacteria 2125
314 Ga0268264_10156953 3300028381 Bacteria 2046
315 Ga0268264_10247781 3300028381 Unclassified 1653
316 Ga0268264_11006966 3300028381 Unclassified 840
317 Ga0307408_100100734 3300031548 Bacteria 2201
318 Ga0307408_100224374 3300031548 Bacteria 1535
319 Ga0307408_100236382 3300031548 Bacteria 1499
320 Ga0307405_10262361 3300031731 Unclassified 1291
321 Ga0307407_10307944 3300031903 Bacteria 1107
322 Ga0307416_100219353 3300032002 Bacteria 1822
323 Ga0307416_100461709 3300032002 Unclassified 1325
324 Ga0307411_10302629 3300032005 Bacteria 1283
325 Ga0373942_0051559 3300035207 Unclassified 1155
326 Ga0373961_0226580 3300035241 Bacteria 668
327 Ga0242420_000438 3300038996 Bacteria 4698
328 Ga0439448_0034207 3300042005 Bacteria 1623
329 Ga0439455_0018563 3300042012 Bacteria 1632
330 Ga0439462_0006973 3300042015 Bacteria 2821
331 Ga0439458_0015590 3300042157 Bacteria 1723
332 Ga0439464_0047050 3300042439 Bacteria 1241
333 Ga0495663_0002257 3300046525 Bacteria 5856
334 Ga0495598_0001077 3300046537 Bacteria 5241
335 Ga0495621_0011434 3300046539 Bacteria 2745
336 Ga0495668_0134683 3300046616 Unclassified 1352
337 Ga0496106_0143998 3300048909 Bacteria 1876
338 Ga0496108_0192494 3300048911 Bacteria 1768
339 Ga0496110_0601165 3300048913 Bacteria 998
340 Ga0496112_0203689 3300048915 Bacteria 1937
341 Ga0496112_0478510 3300048915 Unclassified 1182
342 Ga0496113_0200605 3300048916 Bacteria 1586
343 Ga0501291_009625 3300049514 Unclassified 1359
344 Ga0501292_014060 3300049515 Unclassified 1237
345 Ga0501198_059383 3300049649 Unclassified 698
346 Ga0501206_013044 3300049653 Unclassified 1133
347 Ga0501216_034650 3300049660 Unclassified 946
348 Ga0501217_031810 3300049661 Bacteria 1302
349 Ga0501223_025921 3300049663 Unclassified 1141
350 Ga0501224_011592 3300049664 Unclassified 1296
351 Ga0501227_001394 3300049665 Bacteria 5405
352 Ga0501230_057177 3300049667 Bacteria 784
353 Ga0501233_029821 3300049668 Unclassified 1226
354 Ga0501235_014613 3300049669 Bacteria 1730
355 Ga0501247_009804 3300049677 Unclassified 1135
356 Ga0501249_056442 3300049679 Unclassified 906
357 Ga0501221_055915 3300049704 Unclassified 901
358 Ga0501225_0029330 3300049705 Bacteria 1511
359 Ga0501225_0050051 3300049705 Unclassified 1162
360 Ga0501229_010657 3300049706 Bacteria 1163
361 Ga0501234_003314 3300049707 Bacteria 2530
362 Ga0501273_025007 3300049770 Unclassified 826
363 nmdc:mga05p37_515495_c1 3300050507 Unclassified 1369
364 nmdc:mga05p37_52150_c1 3300050507 Bacteria 5031
365 nmdc:mga09592_394816_c1 3300050508 Unclassified 1196
366 nmdc:mga0qj67_223410_c1 3300050509 Unclassified 1529
367 nmdc:mga08y16_125530_c1 3300050511 Bacteria 2670
368 nmdc:mga08y16_27781_c1 3300050511 Bacteria 5963
369 nmdc:mga0n895_337083_c1 3300050512 Bacteria 1528
370 nmdc:mga0a205_121931_c1 3300050515 Bacteria 2506
371 Ga0070700_100419401
372 MBSR1b_contig_372111
373 JGI24751J29686_10000124
374 rootH2_10176230
375 Ga0065704_10012703
376 Ga0065704_10200313
377 Ga0065712_10006655
378 Ga0065712_10161405
379 Ga0065712_10187738
380 Ga0065715_10004159
381 Ga0065715_10019429
382 Ga0065707_10160661
383 Ga0070690_100174583
384 Ga0070670_100002011
385 Ga0070670_100527331
386 Ga0068869_100040052
387 Ga0068869_100052326
388 Ga0068869_100164344
389 Ga0070666_10049652
390 Ga0070682_100000247
391 Ga0070682_100016927
392 Ga0070682_100051226
393 Ga0068868_100085711
394 Ga0070689_100158736
395 Ga0070687_100186333
396 Ga0070687_100328974
397 Ga0070687_100449048
398 Ga0070661_100247990
399 Ga0070692_10034204
400 Ga0070692_10168717
401 Ga0070669_100069106
402 Ga0070669_100204179
403 Ga0070675_100888466
404 Ga0070671_100008634
405 Ga0070671_100218912
406 Ga0070673_100046153
407 Ga0070673_100067240
408 Ga0070673_100071453
409 Ga0070688_100078139
410 Ga0070688_100207024
411 Ga0070667_100027380
412 Ga0070701_10592659
413 Ga0070705_100007011
414 Ga0070705_100134890
415 Ga0070705_100413632
416 Ga0070700_100000173
417 Ga0070700_100038294
418 Ga0070700_100264558
419 Ga0070694_100010128
420 Ga0070694_100024860
421 Ga0070694_100323610
422 Ga0070694_100532162
423 Ga0070694_100550744
424 Ga0070678_100208455
425 Ga0070681_10008664
426 Ga0068867_100022612
427 Ga0068867_100105279
428 Ga0070685_10031321
429 Ga0070685_10166763
430 Ga0070685_10457238
431 Ga0070698_100024071
432 Ga0070679_100263609
433 Ga0070679_100280394
434 Ga0070684_100284211
435 Ga0068853_100363593
436 Ga0070672_100010989
437 Ga0070686_100034633
438 Ga0070686_100106946
439 Ga0070686_100201712
440 Ga0070695_100016465
441 Ga0070695_100154197
442 Ga0070695_100743694
443 Ga0070696_100083978
444 Ga0070696_100199935
445 Ga0070693_100004711
446 Ga0070693_100179208
447 Ga0070704_100115956
448 Ga0070704_100155387
449 Ga0070704_100361646
450 Ga0070664_100180994
451 Ga0068857_100101941
452 Ga0068857_100298887
453 Ga0068854_100075022
454 Ga0068854_100132353
455 Ga0068854_100258561
456 Ga0068854_100886541
457 Ga0070702_100069749
458 Ga0070702_100155481
459 Ga0070702_100167897
460 Ga0070702_100518334
461 Ga0068852_100187633
462 Ga0068852_100328291
463 Ga0068859_100020151
464 Ga0068859_100032930
465 Ga0068859_100110731
466 Ga0068859_100149960
467 Ga0068859_100989073
468 Ga0068859_101032032
469 Ga0068864_100019095
470 Ga0068864_100380511
471 Ga0068864_100776002
472 Ga0068866_10027316
473 Ga0068861_100660862
474 Ga0068861_100717676
475 Ga0068861_100841155
476 Ga0068851_10008690
477 Ga0068851_10208195
478 Ga0068863_100147292
479 Ga0068863_100297175
480 Ga0068863_100526892
481 Ga0068863_100627901
482 Ga0068858_100066950
483 Ga0068858_100140091
484 Ga0068858_100160819
485 Ga0068858_100166779
486 Ga0068858_100176282
487 Ga0068858_100407598
488 Ga0068858_100750680
489 Ga0068860_100042050
490 Ga0068860_100087381
491 Ga0068860_100146351
492 Ga0068860_100261666
493 Ga0068860_100298195
494 Ga0068860_100771913
495 Ga0068862_100338239
496 Ga0068862_101227773
497 Ga0081539_10003445
498 Ga0097621_100015139
499 Ga0097621_100030066
500 Ga0097621_100066243
501 Ga0097621_100116003
502 Ga0068871_100021103
503 Ga0068871_100027773
504 Ga0068871_100051081
505 Ga0068871_100081400
506 Ga0075428_100495574
507 Ga0075429_100053941
508 Ga0097620_100016576
509 Ga0097620_100020150
510 Ga0097620_100032929
511 Ga0097620_100110730
512 Ga0097620_100149966
513 Ga0097620_100989004
514 Ga0097620_101032072
515 Ga0097620_101040257
516 Ga0105240_10059271
517 Ga0111539_10123145
518 Ga0105245_10055677
519 Ga0105245_10241041
520 Ga0105245_10570608
521 Ga0105245_11849581
522 Ga0105247_10002754
523 Ga0105247_10259621
524 Ga0114129_10108049
525 Ga0114129_10509860
526 Ga0105243_10038296
527 Ga0105243_10056078
528 Ga0105243_10149696
529 Ga0105243_10204557
530 Ga0105243_10254160
531 Ga0105243_10306085
532 Ga0105243_10664156
533 Ga0105243_10692177
534 Ga0105241_10058661
535 Ga0105241_10134810
536 Ga0105241_10553289
537 Ga0105242_10036008
538 Ga0105242_10080973
539 Ga0105242_10221914
540 Ga0105248_10016493
541 Ga0105248_10062709
542 Ga0105248_10214072
543 Ga0105248_10269521
544 Ga0105248_10317951
545 Ga0105248_10349873
546 Ga0105248_10519452
547 Ga0105237_10015469
548 Ga0105237_10122581
549 Ga0105237_10438387
550 Ga0105238_10028503
551 Ga0105238_10031518
552 Ga0105238_10551786
553 Ga0105249_10033042
554 Ga0105249_10146964
555 Ga0105249_10256649
556 Ga0105249_10915147
557 Ga0105239_10192804
558 Ga0105239_10456453
559 Ga0105239_10555548
560 Ga0105239_11698045
561 Ga0105246_10061858
562 Ga0105246_10502199
563 Ga0105246_10543021
564 Ga0105246_11058354
565 Ga0157373_10070521
566 Ga0157373_10102191
567 Ga0157374_10056814
568 Ga0157378_10015186
569 Ga0157378_10153458
570 Ga0157378_10266752
571 Ga0163162_10028900
572 Ga0163162_10213521
573 Ga0163162_10288901
574 Ga0163162_10437956
575 Ga0163162_10496050
576 Ga0163162_11402940
577 Ga0157372_10008096
578 Ga0157375_10068279
579 Ga0157375_10370568
580 Ga0163163_10014128
581 Ga0163163_10078659
582 Ga0163163_10546832
583 Ga0157380_10003003
584 Ga0157380_10048043
585 Ga0157380_10161342
586 Ga0157377_10017571
587 Ga0157377_10179375
588 Ga0157379_10263324
589 Ga0157376_10042648
590 Ga0163161_10096567
591 Ga0207697_10026539
592 Ga0207697_10252789
593 Ga0207656_10004857
594 Ga0207653_10038135
595 Ga0207710_10001315
596 Ga0207647_10011372
597 Ga0207647_10177968
598 Ga0207684_10168115
599 Ga0207654_10253940
600 Ga0207654_10325923
601 Ga0207707_10054395
602 Ga0207695_10231675
603 Ga0207671_10016690
604 Ga0207662_10325378
605 Ga0207652_10237729
606 Ga0207681_10003186
607 Ga0207681_10036101
608 Ga0207694_10020216
609 Ga0207694_11136129
610 Ga0207650_10000022
611 Ga0207650_10003038
612 Ga0207659_10171742
613 Ga0207659_10330155
614 Ga0207644_10050704
615 Ga0207644_10051575
616 Ga0207706_10690328
617 Ga0207686_10024728
618 Ga0207686_10036850
619 Ga0207709_10031965
620 Ga0207709_10083315
621 Ga0207709_10126125
622 Ga0207670_10083338
623 Ga0207670_10650577
624 Ga0207669_10084279
625 Ga0207691_10035547
626 Ga0207691_10474892
627 Ga0207711_10011141
628 Ga0207711_10025122
629 Ga0207711_10046033
630 Ga0207711_10075959
631 Ga0207711_10162957
632 Ga0207689_10003891
633 Ga0207689_10058879
634 Ga0207689_10120249
635 Ga0207689_10235591
636 Ga0207689_10274712
637 Ga0207689_10281095
638 Ga0207651_10151377
639 Ga0207640_10089730
640 Ga0207640_10160080
641 Ga0207640_10223706
642 Ga0207640_10820987
643 Ga0207658_10032451
644 Ga0207677_10029007
645 Ga0207677_11123883
646 Ga0207703_10042265
647 Ga0207703_10287139
648 Ga0207703_10302321
649 Ga0207703_10345533
650 Ga0207703_10784444
651 Ga0207639_10156726
652 Ga0207639_10498958
653 Ga0207639_11058108
654 Ga0207708_10000475
655 Ga0207708_10056115
656 Ga0207708_10062874
657 Ga0207708_10349121
658 Ga0207708_10423515
659 Ga0207641_10106492
660 Ga0207641_10174458
661 Ga0207641_10367064
662 Ga0207641_10369977
663 Ga0207641_10658391
664 Ga0207648_10255825
665 Ga0207676_10018508
666 Ga0207676_10359480
667 Ga0207676_10360271
668 Ga0207674_10123868
669 Ga0207674_10245597
670 Ga0207674_10501611
671 Ga0207675_100037749
672 Ga0207675_100424993
673 Ga0207698_10026260
674 Ga0207698_10171139
675 Ga0207698_10798103
676 Ga0207428_10063644
677 Ga0268265_10095898
678 Ga0268265_10236568
679 Ga0268265_10653565
680 Ga0268264_10081165
681 Ga0268264_10083047
682 Ga0268264_10115126
683 Ga0268264_10144503
684 Ga0268264_10156953
685 Ga0268264_10247781
686 Ga0268264_11006966
687 Ga0307408_100100734
688 Ga0307408_100224374
689 Ga0307408_100236382
690 Ga0307405_10262361
691 Ga0307407_10307944
692 Ga0307416_100219353
693 Ga0307416_100461709
694 Ga0307411_10302629
695 Ga0373942_0051559
696 Ga0373961_0226580
697 Ga0242420_000438
698 Ga0439448_0034207
699 Ga0439455_0018563
700 Ga0439462_0006973
701 Ga0439458_0015590
702 Ga0439464_0047050
703 Ga0495663_0002257
704 Ga0495598_0001077
705 Ga0495621_0011434
706 Ga0495668_0134683
707 Ga0496106_0143998
708 Ga0496108_0192494
709 Ga0496110_0601165
710 Ga0496112_0203689
711 Ga0496112_0478510
712 Ga0496113_0200605
713 Ga0501291_009625
714 Ga0501292_014060
715 Ga0501198_059383
716 Ga0501206_013044
717 Ga0501216_034650
718 Ga0501217_031810
719 Ga0501223_025921
720 Ga0501224_011592
721 Ga0501227_001394
722 Ga0501230_057177
723 Ga0501233_029821
724 Ga0501235_014613
725 Ga0501247_009804
726 Ga0501249_056442
727 Ga0501221_055915
728 Ga0501225_0029330
729 Ga0501225_0050051
730 Ga0501229_010657
731 Ga0501234_003314
732 Ga0501273_025007
733 nmdc:mga05p37_515495_c1
734 nmdc:mga05p37_52150_c1
735 nmdc:mga09592_394816_c1
736 nmdc:mga0qj67_223410_c1
737 nmdc:mga08y16_125530_c1
738 nmdc:mga08y16_27781_c1
739 nmdc:mga0n895_337083_c1
740 nmdc:mga0a205_121931_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4itm-assembly1.cif.gz_A "crystal structure of ""apo"" form lpxk from aquifex aeolicus in complex with atp at 2.2 angstrom resolution" 0.6019 5 159
4lps-assembly2.cif.gz_B crystal structure of hypb from helicobacter pylori in complex with nickel 0.5974 3 205
4lps-assembly2.cif.gz_B crystal structure of hypb from helicobacter pylori in complex with nickel 0.5569 3 205
4xc7-assembly1.cif.gz_B isobutyryl-coa mutase fused with bound butyryl-coa and without cobalamin or gdp (apo-icmf) 0.5363 2 187
5cjw-assembly1.cif.gz_B isobutyryl-coa mutase fused with bound adenosylcobalamin, gdp, mg (holo-icmf/gdp), and substrate pivalyl-coenzyme a 0.5333 2 187
ID Description Score Start End Superfamily
af_P0AAN3_68_289_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6238 2 202 3.40.50.300
4lpsB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.5913 3 205 3.40.50.300
af_P33030_2_193_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.5882 7 187 3.40.50.300
af_P0AAN3_68_289_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.5692 2 202 3.40.50.300
af_E7EM25_1_225_3.80.10.10 Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor 0.5635 123 188 3.80.10.10
ID Description Score Start End GO Terms
AF-A0A2V8PJG9-F1-model_v4 Molybdopterin-guanine dinucleotide biosynthesis protein B 0.9653 1 113
AF-A0A2V8PJG9-F1-model_v4 Molybdopterin-guanine dinucleotide biosynthesis protein B 0.957 1 113
AF-Q7X317-F1-model_v4 Selenium-dependent hydroxylase accessory protein YqeC 0.9354 4 207
AF-A0A2V8QS41-F1-model_v4 Molybdopterin-guanine dinucleotide biosynthesis protein B (MobB) domain-containing protein 0.933 4 206
AF-A0A7C2EKG2-F1-model_v4 Molybdopterin-guanine dinucleotide biosynthesis protein B (MobB) domain-containing protein 0.9272 4 205

Map