F425234

General Info

Members Datasets Scaffolds Average Seq Length
369 229 361 210

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2842038055|2842041028
Length 241
Sequence IIIAPSILAADFARLGEEVAAIDAAGADWIHCDVMDGHFVPNISFGADIIKAIRPTTKRIFDVHLMIAPVDPYLEAFARCGADVITVHAEAGAHLDRSLQAIRALGKKAGVSLNPATPESAIEYVLDRLDLVLVMTVNPGFGGQSFLESQLEKIRRIRAMIGDRPIRLEVDGGITRDNAAAVAAAGADTLVAGSAVFRGKSVADYAANIQAIRSAAESGRVPKRQDNAVQPMRVGEGARTR

Samples

Sample ID Description Type Environment
1 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
2 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
3 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
4 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
5 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
6 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
7 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
8 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
9 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
10 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
11 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
12 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
13 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
14 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
15 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
16 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
19 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
20 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
21 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
24 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
27 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
30 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
33 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
87 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
125 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
126 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
127 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
128 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
129 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
130 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
131 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
132 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
133 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
134 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
135 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
136 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
137 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
138 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
141 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
142 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
143 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
144 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
145 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
146 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
147 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
148 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
149 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
150 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
151 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
152 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
153 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
154 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
155 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
156 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
157 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
158 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
159 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
160 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
161 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
162 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
163 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
164 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
165 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
166 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
167 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
168 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
169 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
170 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
171 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
172 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
173 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
174 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
175 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
176 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
177 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
178 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
179 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
180 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
181 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
182 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
183 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
184 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
185 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
186 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
187 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
188 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
189 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
190 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
191 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
192 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
193 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
194 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
195 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
203 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
204 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
205 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
206 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
207 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
208 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
209 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
210 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
211 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
212 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
213 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
214 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
215 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
216 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
217 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
218 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
219 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
220 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
221 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
222 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
223 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
224 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
225 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
226 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
227 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
228 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
229 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.83
Metatranscriptomes 0
Isolates 2.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.34
Nodule 0.54
Rhizoplane 2.44
Rhizosphere 88.89
Stem 0
Stem Tuber 0
Unclassified 3.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1003250 3300001915 Bacteria 3929
2 JGI24740J21852_10006848 3300001979 Bacteria 4678
3 JGI24740J21852_10009224 3300001979 Bacteria 3876
4 JGI24740J21852_10040744 3300001979 Bacteria 1405
5 JGI24735J21928_10008706 3300002067 Bacteria 3276
6 JGI24034J26672_10007441 3300002239 Bacteria 1590
7 JGI25159J45721_1000007 3300002987 Bacteria 176362
8 JGI25159J45721_1000029 3300002987 Bacteria 105868
9 JGI25151J46595_10002560 3300003187 Bacteria 10768
10 JGI25160J50197_1000011 3300003354 Bacteria 275577
11 JGI25161J50226_1004333 3300003374 Bacteria 2996
12 Ga0055526_1003648 3300003771 Bacteria 9635
13 Ga0055524_1019465 3300003775 Bacteria 2319
14 Ga0055536_1013676 3300003781 Bacteria 2904
15 Ga0055530_10033895 3300003791 Bacteria 1311
16 Ga0055540_1051330 3300003792 Bacteria 850
17 Ga0055531_10021391 3300003794 Bacteria 2510
18 Ga0055543_1000179 3300004625 Bacteria 52563
19 Ga0065165_1000018 3300005262 Bacteria 275082
20 Ga0070658_10043939 3300005327 Bacteria 3610
21 Ga0070658_10084534 3300005327 Bacteria 2609
22 Ga0070658_10418074 3300005327 Bacteria 1153
23 Ga0070658_10672428 3300005327 Bacteria 898
24 Ga0070676_10164106 3300005328 Bacteria 1432
25 Ga0070683_100081914 3300005329 Bacteria 3022
26 Ga0070683_100178993 3300005329 Bacteria 2013
27 Ga0070670_100020796 3300005331 Bacteria 5643
28 Ga0070670_100895946 3300005331 Bacteria 804
29 Ga0070680_100028629 3300005336 Bacteria 4470
30 Ga0070680_100030733 3300005336 Bacteria 4315
31 Ga0070680_100070423 3300005336 Bacteria 2872
32 Ga0070680_100171719 3300005336 Bacteria 1824
33 Ga0070682_100237598 3300005337 Bacteria 1306
34 Ga0070660_100029502 3300005339 Bacteria 4111
35 Ga0070660_100059528 3300005339 Bacteria 2961
36 Ga0070689_100539296 3300005340 Bacteria 1004
37 Ga0070691_10029259 3300005341 Bacteria 2576
38 Ga0070661_100037993 3300005344 Bacteria 3504
39 Ga0070661_100383363 3300005344 Bacteria 1108
40 Ga0070661_100449147 3300005344 Bacteria 1025
41 Ga0070692_10015912 3300005345 Bacteria 3568
42 Ga0070668_100000011 3300005347 Bacteria 123099
43 Ga0070668_100181641 3300005347 Bacteria 1719
44 Ga0070669_100025647 3300005353 Bacteria 4235
45 Ga0070671_100000707 3300005355 Bacteria 23997
46 Ga0070674_100184346 3300005356 Bacteria 1601
47 Ga0070659_100028736 3300005366 Bacteria 4296
48 Ga0070659_100116533 3300005366 Bacteria 2160
49 Ga0070659_101006978 3300005366 Bacteria 731
50 Ga0070714_100013819 3300005435 Bacteria 6473
51 Ga0070694_100023638 3300005444 Bacteria 3956
52 Ga0070663_100003750 3300005455 Bacteria 8817
53 Ga0070663_100019043 3300005455 Bacteria 4514
54 Ga0070663_100033731 3300005455 Bacteria 3539
55 Ga0070663_100330987 3300005455 Bacteria 1228
56 Ga0070662_100024791 3300005457 Bacteria 4136
57 Ga0070662_100175770 3300005457 Bacteria 1685
58 Ga0070662_100766627 3300005457 Bacteria 819
59 Ga0070681_10096191 3300005458 Bacteria 2910
60 Ga0070681_10179387 3300005458 Bacteria 2039
61 Ga0070681_10961042 3300005458 Bacteria 774
62 Ga0070679_100517914 3300005530 Bacteria 1136
63 Ga0068853_100219229 3300005539 Bacteria 1737
64 Ga0068853_100475535 3300005539 Bacteria 1177
65 Ga0068853_100486819 3300005539 Bacteria 1163
66 Ga0070695_100003677 3300005545 Bacteria 8934
67 Ga0070696_100000325 3300005546 Bacteria 28995
68 Ga0070696_100161456 3300005546 Bacteria 1651
69 Ga0070693_100083730 3300005547 Bacteria 1907
70 Ga0070665_100028136 3300005548 Bacteria 5661
71 Ga0070665_100180651 3300005548 Bacteria 2111
72 Ga0068855_100142212 3300005563 Bacteria 2733
73 Ga0070664_100009793 3300005564 Bacteria 7764
74 Ga0070664_100260821 3300005564 Bacteria 1559
75 Ga0070664_100912441 3300005564 Bacteria 824
76 Ga0070664_100955760 3300005564 Bacteria 804
77 Ga0068857_100188078 3300005577 Bacteria 1880
78 Ga0068854_100006541 3300005578 Bacteria 7416
79 Ga0068854_100015334 3300005578 Bacteria 5073
80 Ga0068854_100106414 3300005578 Bacteria 2110
81 Ga0068856_100074536 3300005614 Bacteria 3360
82 Ga0068856_100161021 3300005614 Bacteria 2254
83 Ga0068856_100268936 3300005614 Bacteria 1720
84 Ga0068852_100049687 3300005616 Bacteria 3589
85 Ga0068852_100074359 3300005616 Bacteria 2992
86 Ga0068852_100268278 3300005616 Bacteria 1641
87 Ga0068852_100285506 3300005616 Bacteria 1592
88 Ga0068852_100909580 3300005616 Bacteria 897
89 Ga0068859_100041981 3300005617 Bacteria 4594
90 Ga0068859_100141084 3300005617 Bacteria 2483
91 Ga0068864_100821554 3300005618 Bacteria 914
92 Ga0068861_100516491 3300005719 Bacteria 1082
93 Ga0068851_10009358 3300005834 Bacteria 4552
94 Ga0068851_10116328 3300005834 Bacteria 1433
95 Ga0068863_100000186 3300005841 Bacteria 65963
96 Ga0068863_100052950 3300005841 Bacteria 3846
97 Ga0068860_100164199 3300005843 Bacteria 2143
98 Ga0068862_100057920 3300005844 Bacteria 3323
99 Ga0081455_10114871 3300005937 Bacteria 2132
100 Ga0081538_10043634 3300005981 Bacteria 2811
101 Ga0070717_10083038 3300006028 Bacteria 2693
102 Ga0075369_10051805 3300006186 Bacteria 1778
103 Ga0075430_100003646 3300006846 Bacteria 12922
104 Ga0075431_100008804 3300006847 Bacteria 10112
105 Ga0075434_100169457 3300006871 Bacteria 2203
106 Ga0075429_100398783 3300006880 Bacteria 1205
107 Ga0097620_100041982 3300006931 Bacteria 4594
108 Ga0097620_100141060 3300006931 Bacteria 2483
109 Ga0111539_10027472 3300009094 Bacteria 6951
110 Ga0105245_10024733 3300009098 Bacteria 5275
111 Ga0105245_11181494 3300009098 Bacteria 813
112 Ga0105248_10021589 3300009177 Bacteria 7131
113 Ga0105248_10123405 3300009177 Bacteria 2922
114 Ga0105248_10295958 3300009177 Bacteria 1822
115 Ga0105249_10092776 3300009553 Bacteria 2827
116 Ga0105249_10316384 3300009553 Bacteria 1571
117 Ga0105246_10100350 3300011119 Bacteria 2106
118 Ga0157324_1001690 3300012506 Bacteria 1256
119 Ga0157373_10082921 3300013100 Bacteria 2260
120 Ga0157373_10113676 3300013100 Bacteria 1903
121 Ga0157371_10717466 3300013102 Bacteria 749
122 Ga0157369_10318021 3300013105 Bacteria 1618
123 Ga0157374_10527514 3300013296 Bacteria 1187
124 Ga0157372_10875593 3300013307 Bacteria 1042
125 Ga0163161_10076432 3300017792 Bacteria 2458
126 Ga0213876_10004369 3300021384 Bacteria 7917
127 Ga0207697_10082750 3300025315 Bacteria 1354
128 Ga0207656_10061864 3300025321 Bacteria 1644
129 Ga0207647_10003935 3300025904 Bacteria 11093
130 Ga0207647_10013052 3300025904 Bacteria 5773
131 Ga0207647_10048256 3300025904 Bacteria 2645
132 Ga0207705_10005971 3300025909 Bacteria 9059
133 Ga0207705_10027328 3300025909 Bacteria 4069
134 Ga0207705_10359168 3300025909 Bacteria 1123
135 Ga0207705_10407222 3300025909 Bacteria 1052
136 Ga0207684_10085256 3300025910 Bacteria 2691
137 Ga0207707_10008120 3300025912 Bacteria 9114
138 Ga0207707_10139592 3300025912 Bacteria 2119
139 Ga0207707_10297883 3300025912 Bacteria 1395
140 Ga0207707_10698291 3300025912 Bacteria 852
141 Ga0207695_10032718 3300025913 Bacteria 5686
142 Ga0207660_10001739 3300025917 Bacteria 14597
143 Ga0207657_10007717 3300025919 Bacteria 10990
144 Ga0207657_10031319 3300025919 Bacteria 4820
145 Ga0207657_10288661 3300025919 Bacteria 1301
146 Ga0207649_10191207 3300025920 Bacteria 1440
147 Ga0207652_10688605 3300025921 Bacteria 913
148 Ga0207694_10443356 3300025924 Bacteria 1083
149 Ga0207650_10050703 3300025925 Bacteria 3070
150 Ga0207650_10092990 3300025925 Bacteria 2308
151 Ga0207664_10137743 3300025929 Bacteria 2061
152 Ga0207644_10000032 3300025931 Bacteria 133759
153 Ga0207644_10016091 3300025931 Bacteria 5030
154 Ga0207690_10033285 3300025932 Bacteria 3313
155 Ga0207690_10079930 3300025932 Bacteria 2280
156 Ga0207690_10118444 3300025932 Bacteria 1919
157 Ga0207690_10426099 3300025932 Bacteria 1062
158 Ga0207690_10599206 3300025932 Bacteria 899
159 Ga0207706_10010130 3300025933 Bacteria 8626
160 Ga0207706_10100766 3300025933 Bacteria 2541
161 Ga0207706_10424060 3300025933 Bacteria 1152
162 Ga0207669_10171314 3300025937 Bacteria 1545
163 Ga0207711_10013863 3300025941 Bacteria 6695
164 Ga0207711_10065254 3300025941 Bacteria 3147
165 Ga0207711_10563437 3300025941 Bacteria 1063
166 Ga0207661_10100132 3300025944 Bacteria 2432
167 Ga0207661_10669867 3300025944 Bacteria 954
168 Ga0207679_10038462 3300025945 Bacteria 3408
169 Ga0207679_10083576 3300025945 Bacteria 2447
170 Ga0207679_10515948 3300025945 Bacteria 1068
171 Ga0207667_10013205 3300025949 Bacteria 9469
172 Ga0207667_10055166 3300025949 Bacteria 4178
173 Ga0207667_10103602 3300025949 Bacteria 2935
174 Ga0207667_10175459 3300025949 Bacteria 2202
175 Ga0207667_10306238 3300025949 Bacteria 1623
176 Ga0207712_10379136 3300025961 Bacteria 1183
177 Ga0207668_10000034 3300025972 Bacteria 119274
178 Ga0207640_10078495 3300025981 Bacteria 2247
179 Ga0207640_10118695 3300025981 Bacteria 1890
180 Ga0207658_10227393 3300025986 Bacteria 1573
181 Ga0207658_10701356 3300025986 Bacteria 915
182 Ga0207639_10037516 3300026041 Bacteria 3600
183 Ga0207639_10140015 3300026041 Bacteria 2014
184 Ga0207678_10005278 3300026067 Bacteria 11569
185 Ga0207678_10036884 3300026067 Bacteria 4256
186 Ga0207678_10072491 3300026067 Bacteria 2951
187 Ga0207678_10181595 3300026067 Bacteria 1797
188 Ga0207702_10003537 3300026078 Bacteria 14222
189 Ga0207702_10590311 3300026078 Bacteria 1089
190 Ga0207641_10000031 3300026088 Bacteria 224320
191 Ga0207641_10063966 3300026088 Bacteria 3144
192 Ga0207674_10004819 3300026116 Bacteria 16164
193 Ga0207674_10013609 3300026116 Bacteria 9012
194 Ga0207674_10020100 3300026116 Bacteria 7222
195 Ga0207675_100089556 3300026118 Bacteria 2892
196 Ga0207683_10236545 3300026121 Bacteria 1666
197 Ga0207698_10123136 3300026142 Bacteria 2199
198 Ga0207698_10293419 3300026142 Bacteria 1510
199 Ga0207698_10425884 3300026142 Bacteria 1275
200 Ga0268266_10017808 3300028379 Bacteria 6055
201 Ga0268266_10064538 3300028379 Bacteria 3164
202 Ga0268266_10382982 3300028379 Bacteria 1327
203 Ga0268265_10023498 3300028380 Bacteria 4346
204 Ga0268264_10149849 3300028381 Bacteria 2090
205 Ga0268264_10628546 3300028381 Bacteria 1061
206 Ga0265318_10009337 3300028577 Bacteria 4316
207 Ga0265325_10008061 3300031241 Bacteria 6246
208 Ga0265340_10076966 3300031247 Bacteria 1575
209 Ga0265316_10097788 3300031344 Bacteria 2234
210 Ga0307509_10335105 3300031507 Bacteria 1243
211 Ga0307408_100444225 3300031548 Bacteria 1123
212 Ga0307508_10044863 3300031616 Bacteria 3952
213 Ga0265314_10026945 3300031711 Bacteria 4311
214 Ga0265314_10118122 3300031711 Bacteria 1674
215 Ga0265342_10237634 3300031712 Bacteria 976
216 Ga0307405_10071002 3300031731 Bacteria 2239
217 Ga0307405_10409979 3300031731 Bacteria 1063
218 Ga0307413_10221819 3300031824 Bacteria 1381
219 Ga0307410_10065287 3300031852 Bacteria 2503
220 Ga0307407_10003310 3300031903 Bacteria 6578
221 Ga0307407_10047907 3300031903 Bacteria 2429
222 Ga0307407_10525769 3300031903 Bacteria 871
223 Ga0307412_10562322 3300031911 Bacteria 960
224 Ga0307409_100025984 3300031995 Bacteria 4120
225 Ga0307409_100174913 3300031995 Bacteria 1893
226 Ga0307409_100427953 3300031995 Bacteria 1271
227 Ga0307409_100523451 3300031995 Bacteria 1159
228 Ga0307409_100569963 3300031995 Bacteria 1114
229 Ga0307409_100898991 3300031995 Bacteria 899
230 Ga0307416_100000426 3300032002 Bacteria 21506
231 Ga0307416_100025308 3300032002 Bacteria 4348
232 Ga0307414_10027575 3300032004 Bacteria 3673
233 Ga0307414_10350923 3300032004 Bacteria 1266
234 Ga0307411_10129993 3300032005 Bacteria 1839
235 Ga0307411_10142476 3300032005 Bacteria 1769
236 Ga0307411_10597447 3300032005 Bacteria 948
237 Ga0307415_100042777 3300032126 Bacteria 3017
238 Ga0307415_100358524 3300032126 Bacteria 1230
239 Ga0373934_0130230 3300035086 Bacteria 1026
240 Ga0373943_0029150 3300035170 Bacteria 2607
241 Ga0373946_0021906 3300035171 Bacteria 2482
242 Ga0373961_0052780 3300035241 Bacteria 1211
243 Ga0373931_0192276 3300035691 Bacteria 1215
244 Ga0373935_0218756 3300035692 Bacteria 1322
245 Ga0373935_0241670 3300035692 Bacteria 1261
246 Ga0373927_0151855 3300035695 Bacteria 1517
247 Ga0373933_0044312 3300035724 Bacteria 2635
248 Ga0373947_0298160 3300035725 Bacteria 1074
249 Ga0373937_0001771 3300036401 Bacteria 18149
250 Ga0373925_0023249 3300037068 Bacteria 4523
251 Ga0395899_0000157 3300037312 Bacteria 103574
252 Ga0395899_0020046 3300037312 Bacteria 5073
253 Ga0395900_0000296 3300037418 Bacteria 74995
254 Ga0395900_0044988 3300037418 Bacteria 4546
255 Ga0395900_0054500 3300037418 Bacteria 4117
256 Ga0395900_0064169 3300037418 Bacteria 3775
257 Ga0395898_0000054 3300037466 Bacteria 279561
258 Ga0395898_0059419 3300037466 Bacteria 3719
259 Ga0395898_0061993 3300037466 Bacteria 3632
260 Ga0395898_0093949 3300037466 Bacteria 2882
261 Ga0395905_0000046 3300037471 Bacteria 240463
262 Ga0395905_0001856 3300037471 Bacteria 24336
263 Ga0395905_0130009 3300037471 Bacteria 2368
264 Ga0395905_0344563 3300037471 Bacteria 1381
265 Ga0395905_0425892 3300037471 Bacteria 1224
266 Ga0395901_0001633 3300038443 Bacteria 23187
267 Ga0395901_0076173 3300038443 Bacteria 3499
268 Ga0395901_0097161 3300038443 Bacteria 3087
269 Ga0395901_0359077 3300038443 Bacteria 1502
270 Ga0395901_0552587 3300038443 Bacteria 1167
271 Ga0436365_1152153 3300039437 Bacteria 1219
272 Ga0436360_0708765 3300039438 Bacteria 1871
273 Ga0451843_0798008 3300041509 Bacteria 1104
274 Ga0439443_004207 3300042003 Bacteria 1860
275 Ga0439432_037970 3300042006 Bacteria 1535
276 Ga0439449_0019012 3300042007 Bacteria 2576
277 Ga0450890_003367 3300042127 Bacteria 2130
278 Ga0450905_000214 3300042142 Bacteria 6654
279 Ga0450889_000014 3300042144 Bacteria 15176
280 Ga0439458_0000175 3300042157 Bacteria 14526
281 Ga0466969_0202544 3300044656 Bacteria 905
282 Ga0466969_0244607 3300044656 Bacteria 814
283 Ga0466965_0219768 3300044683 Bacteria 1012
284 Ga0466966_0064006 3300044684 Bacteria 2316
285 Ga0466966_0317480 3300044684 Bacteria 936
286 Ga0466961_0102415 3300044693 Bacteria 1803
287 Ga0466961_0385950 3300044693 Bacteria 850
288 Ga0466963_0006491 3300044694 Bacteria 6922
289 Ga0466963_0020426 3300044694 Bacteria 4164
290 Ga0466964_0009195 3300044706 Bacteria 3717
291 Ga0466964_0066628 3300044706 Bacteria 1511
292 Ga0466971_0030083 3300044719 Bacteria 2430
293 Ga0466971_0060321 3300044719 Bacteria 1714
294 Ga0466971_0061287 3300044719 Bacteria 1701
295 Ga0466968_0024943 3300044735 Bacteria 2446
296 Ga0466970_0051245 3300044765 Bacteria 2202
297 Ga0466957_0041019 3300044842 Bacteria 2798
298 Ga0466957_0574466 3300044842 Bacteria 787
299 Ga0466959_0025962 3300045049 Bacteria 4344
300 Ga0466959_0038520 3300045049 Bacteria 3533
301 Ga0466958_0019217 3300045836 Bacteria 3975
302 Ga0466958_0462370 3300045836 Bacteria 822
303 Ga0466967_0026627 3300045976 Bacteria 4793
304 Ga0466967_0038638 3300045976 Bacteria 4095
305 Ga0466967_0044929 3300045976 Bacteria 3836
306 Ga0466967_0395109 3300045976 Bacteria 1344
307 Ga0495667_0174926 3300046559 Bacteria 1379
308 Ga0496101_0089356 3300048904 Bacteria 2289
309 Ga0496106_0039594 3300048909 Bacteria 3530
310 Ga0496106_0660798 3300048909 Bacteria 835
311 Ga0496109_0185687 3300048912 Bacteria 1953
312 Ga0496112_0001362 3300048915 Bacteria 18602
313 Ga0496112_0059034 3300048915 Bacteria 3779
314 Ga0496113_0003680 3300048916 Bacteria 9230
315 Ga0496114_0021992 3300048917 Bacteria 5192
316 Ga0496115_0033709 3300048918 Bacteria 4044
317 Ga0496118_0069620 3300048921 Bacteria 2547
318 Ga0496121_0003234 3300048924 Bacteria 23426
319 Ga0496122_0000176 3300048925 Bacteria 152190
320 Ga0496123_0000220 3300048926 Bacteria 115824
321 Ga0496125_0064218 3300048928 Bacteria 2919
322 Ga0501031_0149998 3300049568 Bacteria 1523
323 Ga0501033_0042219 3300049570 Bacteria 3401
324 Ga0501034_0170871 3300049571 Bacteria 2141
325 Ga0501034_0254202 3300049571 Bacteria 1701
326 Ga0501036_0165941 3300049572 Bacteria 1861
327 Ga0501038_0067595 3300049574 Bacteria 3040
328 Ga0501038_0440884 3300049574 Bacteria 1003
329 Ga0501040_0010730 3300049576 Bacteria 5990
330 Ga0501042_0034453 3300049578 Bacteria 3591
331 Ga0501070_0617386 3300049586 Bacteria 863
332 Ga0501071_0015432 3300049587 Bacteria 5244
333 Ga0501072_0181967 3300049588 Bacteria 1676
334 Ga0501075_0003838 3300049591 Bacteria 10118
335 Ga0501076_0080752 3300049592 Bacteria 2610
336 Ga0501077_0232669 3300049593 Bacteria 1171
337 Ga0501217_063839 3300049661 Bacteria 989
338 Ga0501249_020244 3300049679 Bacteria 1447
339 Ga0501257_000096 3300049686 Bacteria 21473
340 Ga0501257_031263 3300049686 Bacteria 1284
341 Ga0501258_007777 3300049687 Bacteria 1090
342 Ga0501221_011271 3300049704 Bacteria 1606
343 Ga0501225_0043310 3300049705 Bacteria 1244
344 Ga0501079_0024982 3300049741 Bacteria 4583
345 Ga0501080_0011579 3300049742 Bacteria 8078
346 Ga0501081_0011022 3300049743 Bacteria 5911
347 Ga0501081_0130096 3300049743 Bacteria 1798
348 Ga0501267_006543 3300049764 Bacteria 1121
349 Ga0501268_002054 3300049765 Bacteria 2602
350 nmdc:mga06z11_127752_c1 3300050494 Bacteria 1424
351 nmdc:mga09592_113516_c1 3300050508 Bacteria 2325
352 nmdc:mga0qj67_342196_c1 3300050509 Bacteria 1210
353 nmdc:mga06r32_43369_c1 3300050510 Bacteria 4280
354 nmdc:mga08y16_17073_c1 3300050511 Bacteria 7642
355 Ga0500643_013034 3300053087 Bacteria 2952
356 Ga0501084_0002063 3300054114 Bacteria 16034
357 Ga0501084_0079248 3300054114 Bacteria 2753
358 Ga0590075_069410 3300059424 Bacteria 910
359 Ga0501082_0012280 3300060353 Bacteria 7360
360 Ga0466962_0020630 3300061719 Bacteria 3165
361 Ga0530510_0042477 3300061734 Bacteria 3285

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049574 Ga0501038_0067595 Ga0501038_0067595_1522_2118 167
2 3300021384 Ga0213876_10004369 Ga0213876_100043692 171
3 3300012506 Ga0157324_1001690 Ga0157324_10016902 178
4 3300049571 Ga0501034_0170871 Ga0501034_0170871_194_856 180
5 3300031241 Ga0265325_10008061 Ga0265325_100080616 184
6 3300059424 Ga0590075_069410 Ga0590075_069410_55_717 185
7 3300002239 JGI24034J26672_10007441 JGI24034J26672_100074412 186
8 3300005331 Ga0070670_100020796 Ga0070670_1000207962 186
9 3300005347 Ga0070668_100000011 Ga0070668_10000001112 186
10 3300005355 Ga0070671_100000707 Ga0070671_1000007078 186
11 3300005548 Ga0070665_100028136 Ga0070665_1000281363 186
12 3300005617 Ga0068859_100041981 Ga0068859_1000419815 186
13 3300005841 Ga0068863_100000186 Ga0068863_10000018613 186
14 3300005844 Ga0068862_100057920 Ga0068862_1000579202 186
15 3300006931 Ga0097620_100041982 Ga0097620_1000419825 186
16 3300009553 Ga0105249_10092776 Ga0105249_100927762 186
17 3300017792 Ga0163161_10076432 Ga0163161_100764321 186
18 3300025925 Ga0207650_10092990 Ga0207650_100929902 186
19 3300025931 Ga0207644_10000032 Ga0207644_1000003216 186
20 3300025972 Ga0207668_10000034 Ga0207668_1000003413 186
21 3300026088 Ga0207641_10000031 Ga0207641_10000031216 186
22 3300026121 Ga0207683_10236545 Ga0207683_102365451 186
23 3300028379 Ga0268266_10017808 Ga0268266_100178083 186
24 3300028380 Ga0268265_10023498 Ga0268265_100234984 186
25 3300028381 Ga0268264_10149849 Ga0268264_101498492 186
26 3300042003 Ga0439443_004207 Ga0439443_004207_38_697 186
27 3300048909 Ga0496106_0660798 Ga0496106_0660798_91_774 186
28 3300042006 Ga0439432_037970 Ga0439432_037970_250_882 187
29 3300031731 Ga0307405_10071002 Ga0307405_100710022 188
30 3300031903 Ga0307407_10047907 Ga0307407_100479072 188
31 3300031995 Ga0307409_100025984 Ga0307409_1000259843 188
32 3300032002 Ga0307416_100025308 Ga0307416_1000253083 188
33 3300032004 Ga0307414_10027575 Ga0307414_100275752 188
34 3300032005 Ga0307411_10597447 Ga0307411_105974472 188
35 3300032126 Ga0307415_100042777 Ga0307415_1000427772 188
36 3300042007 Ga0439449_0019012 Ga0439449_0019012_1084_1746 188
37 3300049679 Ga0501249_020244 Ga0501249_020244_756_1409 188
38 3300049764 Ga0501267_006543 Ga0501267_006543_253_906 188
39 3300049765 Ga0501268_002054 Ga0501268_002054_1221_1874 188
40 3300038443 Ga0395901_0552587 Ga0395901_0552587_36_692 189
41 3300005336 Ga0070680_100028629 Ga0070680_1000286292 190
42 3300005341 Ga0070691_10029259 Ga0070691_100292592 190
43 3300005455 Ga0070663_100033731 Ga0070663_1000337314 190
44 3300005578 Ga0068854_100006541 Ga0068854_1000065414 190
45 3300005614 Ga0068856_100074536 Ga0068856_1000745362 190
46 3300009177 Ga0105248_10295958 Ga0105248_102959581 190
47 3300025904 Ga0207647_10003935 Ga0207647_1000393512 190
48 3300025913 Ga0207695_10032718 Ga0207695_100327184 190
49 3300025941 Ga0207711_10563437 Ga0207711_105634372 190
50 3300025945 Ga0207679_10038462 Ga0207679_100384623 190
51 3300025949 Ga0207667_10013205 Ga0207667_100132057 190
52 3300026067 Ga0207678_10181595 Ga0207678_101815952 190
53 3300026078 Ga0207702_10003537 Ga0207702_100035372 190
54 3300026116 Ga0207674_10004819 Ga0207674_100048195 190
55 3300005329 Ga0070683_100081914 Ga0070683_1000819144 191
56 3300005458 Ga0070681_10096191 Ga0070681_100961912 191
57 3300035241 Ga0373961_0052780 Ga0373961_0052780_224_907 191
58 3300035692 Ga0373935_0241670 Ga0373935_0241670_263_946 191
59 3300035695 Ga0373927_0151855 Ga0373927_0151855_598_1281 191
60 3300044683 Ga0466965_0219768 Ga0466965_0219768_126_782 191
61 3300044684 Ga0466966_0317480 Ga0466966_0317480_192_848 191
62 3300044693 Ga0466961_0102415 Ga0466961_0102415_800_1456 191
63 3300044706 Ga0466964_0009195 Ga0466964_0009195_2324_2980 191
64 3300044719 Ga0466971_0061287 Ga0466971_0061287_855_1511 191
65 3300044735 Ga0466968_0024943 Ga0466968_0024943_336_992 191
66 3300044765 Ga0466970_0051245 Ga0466970_0051245_921_1577 191
67 3300045049 Ga0466959_0038520 Ga0466959_0038520_1260_1916 191
68 3300045836 Ga0466958_0019217 Ga0466958_0019217_1676_2332 191
69 3300045976 Ga0466967_0044929 Ga0466967_0044929_2108_2764 191
70 3300049571 Ga0501034_0254202 Ga0501034_0254202_226_909 191
71 3300002987 JGI25159J45721_1000007 JGI25159J45721_1000007117 192
72 3300002987 JGI25159J45721_1000029 JGI25159J45721_100002996 192
73 3300003187 JGI25151J46595_10002560 JGI25151J46595_1000256013 192
74 3300003354 JGI25160J50197_1000011 JGI25160J50197_1000011162 192
75 3300003374 JGI25161J50226_1004333 JGI25161J50226_10043333 192
76 3300003771 Ga0055526_1003648 Ga0055526_10036485 192
77 3300003775 Ga0055524_1019465 Ga0055524_10194651 192
78 3300003781 Ga0055536_1013676 Ga0055536_10136763 192
79 3300003791 Ga0055530_10033895 Ga0055530_100338951 192
80 3300003792 Ga0055540_1051330 Ga0055540_10513301 192
81 3300003794 Ga0055531_10021391 Ga0055531_100213912 192
82 3300004625 Ga0055543_1000179 Ga0055543_100017924 192
83 3300005262 Ga0065165_1000018 Ga0065165_1000018162 192
84 3300005327 Ga0070658_10418074 Ga0070658_104180742 192
85 3300045836 Ga0466958_0462370 Ga0466958_0462370_73_729 192
86 3300049593 Ga0501077_0232669 Ga0501077_0232669_150_824 192
87 iso_pu_bacteria 2842038055 2842041028 192
88 iso_pu_bacteria 2842045827 2842046027 192
89 iso_pu_bacteria 2989776772 2989778978 192
90 3300005331 Ga0070670_100895946 Ga0070670_1008959461 193
91 3300005340 Ga0070689_100539296 Ga0070689_1005392961 193
92 3300005347 Ga0070668_100181641 Ga0070668_1001816412 193
93 3300005353 Ga0070669_100025647 Ga0070669_1000256472 193
94 3300005455 Ga0070663_100003750 Ga0070663_1000037502 193
95 3300005577 Ga0068857_100188078 Ga0068857_1001880782 193
96 3300005616 Ga0068852_100909580 Ga0068852_1009095801 193
97 3300005617 Ga0068859_100141084 Ga0068859_1001410841 193
98 3300005618 Ga0068864_100821554 Ga0068864_1008215541 193
99 3300006931 Ga0097620_100141060 Ga0097620_1001410601 193
100 3300009553 Ga0105249_10316384 Ga0105249_103163842 193
101 3300011119 Ga0105246_10100350 Ga0105246_101003502 193
102 3300025961 Ga0207712_10379136 Ga0207712_103791362 193
103 3300044656 Ga0466969_0202544 Ga0466969_0202544_181_843 193
104 3300045049 Ga0466959_0025962 Ga0466959_0025962_2955_3617 193
105 3300046559 Ga0495667_0174926 Ga0495667_0174926_345_989 193
106 iso_pu_bacteria 2739367664 2739650853 193
107 iso_pu_bacteria 2739367865 2740029326 193
108 iso_pu_bacteria 2818991438 2819554914 193
109 iso_pu_bacteria 2896429255 2896431768 193
110 3300031548 Ga0307408_100444225 Ga0307408_1004442252 194
111 3300031824 Ga0307413_10221819 Ga0307413_102218191 194
112 3300031903 Ga0307407_10003310 Ga0307407_100033104 194
113 3300031995 Ga0307409_100174913 Ga0307409_1001749132 194
114 3300044656 Ga0466969_0244607 Ga0466969_0244607_103_759 194
115 3300049661 Ga0501217_063839 Ga0501217_063839_243_899 194
116 3300049686 Ga0501257_031263 Ga0501257_031263_507_1163 194
117 3300049687 Ga0501258_007777 Ga0501258_007777_168_824 194
118 3300049704 Ga0501221_011271 Ga0501221_011271_521_1177 194
119 3300049705 Ga0501225_0043310 Ga0501225_0043310_193_849 194
120 3300050494 nmdc:mga06z11_127752_c1 nmdc:mga06z11_127752_c1_530_1204 194
121 3300053087 Ga0500643_013034 Ga0500643_013034_410_1066 194
122 iso_pu_bacteria 2582581305 2585264084 194
123 3300001979 JGI24740J21852_10006848 JGI24740J21852_100068482 195
124 3300001979 JGI24740J21852_10040744 JGI24740J21852_100407442 195
125 3300002067 JGI24735J21928_10008706 JGI24735J21928_100087063 195
126 3300005327 Ga0070658_10043939 Ga0070658_100439392 195
127 3300005327 Ga0070658_10084534 Ga0070658_100845343 195
128 3300005327 Ga0070658_10672428 Ga0070658_106724282 195
129 3300005328 Ga0070676_10164106 Ga0070676_101641062 195
130 3300005336 Ga0070680_100171719 Ga0070680_1001717192 195
131 3300005339 Ga0070660_100059528 Ga0070660_1000595283 195
132 3300005344 Ga0070661_100037993 Ga0070661_1000379933 195
133 3300005344 Ga0070661_100383363 Ga0070661_1003833631 195
134 3300005344 Ga0070661_100449147 Ga0070661_1004491472 195
135 3300005356 Ga0070674_100184346 Ga0070674_1001843462 195
136 3300005366 Ga0070659_100028736 Ga0070659_1000287363 195
137 3300005366 Ga0070659_101006978 Ga0070659_1010069781 195
138 3300005455 Ga0070663_100330987 Ga0070663_1003309872 195
139 3300005457 Ga0070662_100175770 Ga0070662_1001757702 195
140 3300005458 Ga0070681_10179387 Ga0070681_101793871 195
141 3300005539 Ga0068853_100475535 Ga0068853_1004755351 195
142 3300005548 Ga0070665_100180651 Ga0070665_1001806513 195
143 3300005564 Ga0070664_100009793 Ga0070664_1000097933 195
144 3300005564 Ga0070664_100912441 Ga0070664_1009124412 195
145 3300005614 Ga0068856_100161021 Ga0068856_1001610212 195
146 3300005614 Ga0068856_100268936 Ga0068856_1002689362 195
147 3300005616 Ga0068852_100049687 Ga0068852_1000496873 195
148 3300005616 Ga0068852_100074359 Ga0068852_1000743592 195
149 3300005616 Ga0068852_100268278 Ga0068852_1002682782 195
150 3300005616 Ga0068852_100285506 Ga0068852_1002855062 195
151 3300005834 Ga0068851_10009358 Ga0068851_100093584 195
152 3300005834 Ga0068851_10116328 Ga0068851_101163282 195
153 3300005937 Ga0081455_10114871 Ga0081455_101148712 195
154 3300005981 Ga0081538_10043634 Ga0081538_100436341 195
155 3300006186 Ga0075369_10051805 Ga0075369_100518052 195
156 3300006846 Ga0075430_100003646 Ga0075430_10000364610 195
157 3300006847 Ga0075431_100008804 Ga0075431_10000880410 195
158 3300006871 Ga0075434_100169457 Ga0075434_1001694573 195
159 3300006880 Ga0075429_100398783 Ga0075429_1003987832 195
160 3300009098 Ga0105245_10024733 Ga0105245_100247333 195
161 3300009098 Ga0105245_11181494 Ga0105245_111814941 195
162 3300009177 Ga0105248_10021589 Ga0105248_100215895 195
163 3300013100 Ga0157373_10113676 Ga0157373_101136762 195
164 3300013102 Ga0157371_10717466 Ga0157371_107174661 195
165 3300013105 Ga0157369_10318021 Ga0157369_103180212 195
166 3300013296 Ga0157374_10527514 Ga0157374_105275142 195
167 3300025315 Ga0207697_10082750 Ga0207697_100827502 195
168 3300025321 Ga0207656_10061864 Ga0207656_100618642 195
169 3300025904 Ga0207647_10013052 Ga0207647_100130523 195
170 3300025904 Ga0207647_10048256 Ga0207647_100482562 195
171 3300025909 Ga0207705_10005971 Ga0207705_100059714 195
172 3300025909 Ga0207705_10027328 Ga0207705_100273282 195
173 3300025909 Ga0207705_10359168 Ga0207705_103591682 195
174 3300025909 Ga0207705_10407222 Ga0207705_104072222 195
175 3300025912 Ga0207707_10297883 Ga0207707_102978832 195
176 3300025919 Ga0207657_10007717 Ga0207657_100077177 195
177 3300025919 Ga0207657_10288661 Ga0207657_102886612 195
178 3300025920 Ga0207649_10191207 Ga0207649_101912072 195
179 3300025924 Ga0207694_10443356 Ga0207694_104433562 195
180 3300025925 Ga0207650_10050703 Ga0207650_100507033 195
181 3300025931 Ga0207644_10016091 Ga0207644_100160915 195
182 3300025932 Ga0207690_10426099 Ga0207690_104260992 195
183 3300025932 Ga0207690_10599206 Ga0207690_105992062 195
184 3300025933 Ga0207706_10100766 Ga0207706_101007662 195
185 3300025937 Ga0207669_10171314 Ga0207669_101713142 195
186 3300025941 Ga0207711_10013863 Ga0207711_100138633 195
187 3300025944 Ga0207661_10669867 Ga0207661_106698671 195
188 3300025945 Ga0207679_10083576 Ga0207679_100835762 195
189 3300025945 Ga0207679_10515948 Ga0207679_105159482 195
190 3300025949 Ga0207667_10055166 Ga0207667_100551663 195
191 3300025986 Ga0207658_10227393 Ga0207658_102273932 195
192 3300025986 Ga0207658_10701356 Ga0207658_107013562 195
193 3300026041 Ga0207639_10140015 Ga0207639_101400152 195
194 3300026067 Ga0207678_10005278 Ga0207678_100052783 195
195 3300026067 Ga0207678_10072491 Ga0207678_100724911 195
196 3300026078 Ga0207702_10590311 Ga0207702_105903112 195
197 3300026116 Ga0207674_10013609 Ga0207674_100136093 195
198 3300026142 Ga0207698_10123136 Ga0207698_101231362 195
199 3300026142 Ga0207698_10293419 Ga0207698_102934192 195
200 3300026142 Ga0207698_10425884 Ga0207698_104258842 195
201 3300028379 Ga0268266_10064538 Ga0268266_100645382 195
202 3300028379 Ga0268266_10382982 Ga0268266_103829822 195
203 3300028381 Ga0268264_10628546 Ga0268264_106285462 195
204 3300028577 Ga0265318_10009337 Ga0265318_100093372 195
205 3300031247 Ga0265340_10076966 Ga0265340_100769662 195
206 3300031344 Ga0265316_10097788 Ga0265316_100977882 195
207 3300031507 Ga0307509_10335105 Ga0307509_103351052 195
208 3300031616 Ga0307508_10044863 Ga0307508_100448633 195
209 3300031711 Ga0265314_10026945 Ga0265314_100269451 195
210 3300031711 Ga0265314_10118122 Ga0265314_101181222 195
211 3300031712 Ga0265342_10237634 Ga0265342_102376342 195
212 3300031852 Ga0307410_10065287 Ga0307410_100652873 195
213 3300031911 Ga0307412_10562322 Ga0307412_105623222 195
214 3300031995 Ga0307409_100523451 Ga0307409_1005234512 195
215 3300032002 Ga0307416_100000426 Ga0307416_10000042618 195
216 3300032004 Ga0307414_10350923 Ga0307414_103509232 195
217 3300032005 Ga0307411_10129993 Ga0307411_101299932 195
218 3300032126 Ga0307415_100358524 Ga0307415_1003585242 195
219 3300035170 Ga0373943_0029150 Ga0373943_0029150_1083_1739 195
220 3300035171 Ga0373946_0021906 Ga0373946_0021906_463_1119 195
221 3300035691 Ga0373931_0192276 Ga0373931_0192276_521_1201 195
222 3300035692 Ga0373935_0218756 Ga0373935_0218756_449_1105 195
223 3300035725 Ga0373947_0298160 Ga0373947_0298160_304_960 195
224 3300037068 Ga0373925_0023249 Ga0373925_0023249_1637_2293 195
225 3300037312 Ga0395899_0000157 Ga0395899_0000157_36113_36769 195
226 3300037312 Ga0395899_0020046 Ga0395899_0020046_3704_4360 195
227 3300037418 Ga0395900_0000296 Ga0395900_0000296_54898_55554 195
228 3300037466 Ga0395898_0000054 Ga0395898_0000054_143945_144601 195
229 3300037466 Ga0395898_0059419 Ga0395898_0059419_2547_3203 195
230 3300037466 Ga0395898_0093949 Ga0395898_0093949_1665_2321 195
231 3300037471 Ga0395905_0000046 Ga0395905_0000046_104951_105607 195
232 3300037471 Ga0395905_0001856 Ga0395905_0001856_7050_7706 195
233 3300037471 Ga0395905_0130009 Ga0395905_0130009_1126_1782 195
234 3300037471 Ga0395905_0425892 Ga0395905_0425892_83_739 195
235 3300038443 Ga0395901_0001633 Ga0395901_0001633_3026_3682 195
236 3300038443 Ga0395901_0076173 Ga0395901_0076173_715_1371 195
237 3300038443 Ga0395901_0097161 Ga0395901_0097161_1130_1786 195
238 3300041509 Ga0451843_0798008 Ga0451843_0798008_307_996 195
239 3300042157 Ga0439458_0000175 Ga0439458_0000175_5694_6350 195
240 3300044693 Ga0466961_0385950 Ga0466961_0385950_71_727 195
241 3300044694 Ga0466963_0020426 Ga0466963_0020426_3263_3919 195
242 3300044719 Ga0466971_0030083 Ga0466971_0030083_776_1432 195
243 3300044719 Ga0466971_0060321 Ga0466971_0060321_460_1116 195
244 3300044842 Ga0466957_0041019 Ga0466957_0041019_1820_2476 195
245 3300044842 Ga0466957_0574466 Ga0466957_0574466_31_687 195
246 3300045976 Ga0466967_0395109 Ga0466967_0395109_457_1113 195
247 3300048904 Ga0496101_0089356 Ga0496101_0089356_743_1399 195
248 3300048909 Ga0496106_0039594 Ga0496106_0039594_533_1189 195
249 3300048915 Ga0496112_0001362 Ga0496112_0001362_5322_5978 195
250 3300048915 Ga0496112_0059034 Ga0496112_0059034_998_1654 195
251 3300048916 Ga0496113_0003680 Ga0496113_0003680_6081_6737 195
252 3300048917 Ga0496114_0021992 Ga0496114_0021992_3414_4070 195
253 3300048918 Ga0496115_0033709 Ga0496115_0033709_160_816 195
254 3300049568 Ga0501031_0149998 Ga0501031_0149998_125_805 195
255 3300049570 Ga0501033_0042219 Ga0501033_0042219_563_1243 195
256 3300049572 Ga0501036_0165941 Ga0501036_0165941_755_1435 195
257 3300049574 Ga0501038_0440884 Ga0501038_0440884_85_768 195
258 3300049576 Ga0501040_0010730 Ga0501040_0010730_4230_4910 195
259 3300049578 Ga0501042_0034453 Ga0501042_0034453_454_1134 195
260 3300049586 Ga0501070_0617386 Ga0501070_0617386_165_845 195
261 3300049587 Ga0501071_0015432 Ga0501071_0015432_1396_2079 195
262 3300049588 Ga0501072_0181967 Ga0501072_0181967_743_1423 195
263 3300049591 Ga0501075_0003838 Ga0501075_0003838_6323_7003 195
264 3300049592 Ga0501076_0080752 Ga0501076_0080752_1820_2500 195
265 3300049741 Ga0501079_0024982 Ga0501079_0024982_165_845 195
266 3300049743 Ga0501081_0011022 Ga0501081_0011022_5165_5845 195
267 3300049743 Ga0501081_0130096 Ga0501081_0130096_162_845 195
268 3300050508 nmdc:mga09592_113516_c1 nmdc:mga09592_113516_c1_163_843 195
269 3300050509 nmdc:mga0qj67_342196_c1 nmdc:mga0qj67_342196_c1_518_1198 195
270 3300050510 nmdc:mga06r32_43369_c1 nmdc:mga06r32_43369_c1_647_1327 195
271 3300054114 Ga0501084_0002063 Ga0501084_0002063_3571_4251 195
272 3300054114 Ga0501084_0079248 Ga0501084_0079248_2046_2729 195
273 3300060353 Ga0501082_0012280 Ga0501082_0012280_6662_7342 195
274 3300061719 Ga0466962_0020630 Ga0466962_0020630_1878_2534 195
275 3300061734 Ga0530510_0042477 Ga0530510_0042477_1096_1779 195
276 3300005546 Ga0070696_100161456 Ga0070696_1001614562 196
277 3300005578 Ga0068854_100015334 Ga0068854_1000153342 196
278 3300005719 Ga0068861_100516491 Ga0068861_1005164912 196
279 3300005841 Ga0068863_100052950 Ga0068863_1000529502 196
280 3300005843 Ga0068860_100164199 Ga0068860_1001641992 196
281 3300009177 Ga0105248_10123405 Ga0105248_101234052 196
282 3300013100 Ga0157373_10082921 Ga0157373_100829212 196
283 3300025921 Ga0207652_10688605 Ga0207652_106886052 196
284 3300025941 Ga0207711_10065254 Ga0207711_100652544 196
285 3300025981 Ga0207640_10078495 Ga0207640_100784952 196
286 3300026088 Ga0207641_10063966 Ga0207641_100639664 196
287 3300026118 Ga0207675_100089556 Ga0207675_1000895563 196
288 3300031903 Ga0307407_10525769 Ga0307407_105257691 196
289 3300031995 Ga0307409_100898991 Ga0307409_1008989912 196
290 3300039437 Ga0436365_1152153 Ga0436365_1152153_413_1075 196
291 3300039438 Ga0436360_0708765 Ga0436360_0708765_698_1375 196
292 3300048912 Ga0496109_0185687 Ga0496109_0185687_1046_1681 196
293 3300048925 Ga0496122_0000176 Ga0496122_0000176_12023_12685 196
294 3300048926 Ga0496123_0000220 Ga0496123_0000220_46285_46947 196
295 3300049686 Ga0501257_000096 Ga0501257_000096_16809_17471 196
296 3300001915 JGI24741J21665_1003250 JGI24741J21665_10032503 197
297 3300001979 JGI24740J21852_10009224 JGI24740J21852_100092243 197
298 3300005329 Ga0070683_100178993 Ga0070683_1001789932 197
299 3300005336 Ga0070680_100030733 Ga0070680_1000307334 197
300 3300005336 Ga0070680_100070423 Ga0070680_1000704233 197
301 3300005337 Ga0070682_100237598 Ga0070682_1002375982 197
302 3300005339 Ga0070660_100029502 Ga0070660_1000295023 197
303 3300005345 Ga0070692_10015912 Ga0070692_100159124 197
304 3300005366 Ga0070659_100116533 Ga0070659_1001165332 197
305 3300005435 Ga0070714_100013819 Ga0070714_1000138193 197
306 3300005444 Ga0070694_100023638 Ga0070694_1000236383 197
307 3300005455 Ga0070663_100019043 Ga0070663_1000190435 197
308 3300005457 Ga0070662_100024791 Ga0070662_1000247913 197
309 3300005457 Ga0070662_100766627 Ga0070662_1007666271 197
310 3300005458 Ga0070681_10961042 Ga0070681_109610421 197
311 3300005530 Ga0070679_100517914 Ga0070679_1005179141 197
312 3300005539 Ga0068853_100219229 Ga0068853_1002192292 197
313 3300005539 Ga0068853_100486819 Ga0068853_1004868191 197
314 3300005545 Ga0070695_100003677 Ga0070695_1000036775 197
315 3300005546 Ga0070696_100000325 Ga0070696_1000003257 197
316 3300005547 Ga0070693_100083730 Ga0070693_1000837302 197
317 3300005563 Ga0068855_100142212 Ga0068855_1001422122 197
318 3300005564 Ga0070664_100260821 Ga0070664_1002608211 197
319 3300005564 Ga0070664_100955760 Ga0070664_1009557601 197
320 3300005578 Ga0068854_100106414 Ga0068854_1001064141 197
321 3300006028 Ga0070717_10083038 Ga0070717_100830382 197
322 3300009094 Ga0111539_10027472 Ga0111539_100274723 197
323 3300013307 Ga0157372_10875593 Ga0157372_108755931 197
324 3300025910 Ga0207684_10085256 Ga0207684_100852562 197
325 3300025912 Ga0207707_10008120 Ga0207707_100081203 197
326 3300025912 Ga0207707_10139592 Ga0207707_101395923 197
327 3300025912 Ga0207707_10698291 Ga0207707_106982911 197
328 3300025917 Ga0207660_10001739 Ga0207660_1000173913 197
329 3300025919 Ga0207657_10031319 Ga0207657_100313193 197
330 3300025929 Ga0207664_10137743 Ga0207664_101377432 197
331 3300025932 Ga0207690_10033285 Ga0207690_100332852 197
332 3300025932 Ga0207690_10079930 Ga0207690_100799302 197
333 3300025932 Ga0207690_10118444 Ga0207690_101184442 197
334 3300025933 Ga0207706_10010130 Ga0207706_100101303 197
335 3300025933 Ga0207706_10424060 Ga0207706_104240602 197
336 3300025944 Ga0207661_10100132 Ga0207661_101001322 197
337 3300025949 Ga0207667_10103602 Ga0207667_101036022 197
338 3300025949 Ga0207667_10175459 Ga0207667_101754592 197
339 3300025949 Ga0207667_10306238 Ga0207667_103062382 197
340 3300025981 Ga0207640_10118695 Ga0207640_101186952 197
341 3300026041 Ga0207639_10037516 Ga0207639_100375165 197
342 3300026067 Ga0207678_10036884 Ga0207678_100368845 197
343 3300026116 Ga0207674_10020100 Ga0207674_100201003 197
344 3300031731 Ga0307405_10409979 Ga0307405_104099792 197
345 3300031995 Ga0307409_100427953 Ga0307409_1004279532 197
346 3300031995 Ga0307409_100569963 Ga0307409_1005699632 197
347 3300032005 Ga0307411_10142476 Ga0307411_101424762 197
348 3300035086 Ga0373934_0130230 Ga0373934_0130230_180_878 197
349 3300035724 Ga0373933_0044312 Ga0373933_0044312_1374_2072 197
350 3300036401 Ga0373937_0001771 Ga0373937_0001771_16191_16889 197
351 3300037418 Ga0395900_0044988 Ga0395900_0044988_363_1037 197
352 3300037418 Ga0395900_0054500 Ga0395900_0054500_1314_1982 197
353 3300037418 Ga0395900_0064169 Ga0395900_0064169_2766_3428 197
354 3300037466 Ga0395898_0061993 Ga0395898_0061993_904_1572 197
355 3300037471 Ga0395905_0344563 Ga0395905_0344563_604_1272 197
356 3300038443 Ga0395901_0359077 Ga0395901_0359077_110_778 197
357 3300042127 Ga0450890_003367 Ga0450890_003367_321_983 197
358 3300042142 Ga0450905_000214 Ga0450905_000214_5945_6607 197
359 3300042144 Ga0450889_000014 Ga0450889_000014_12638_13300 197
360 3300044684 Ga0466966_0064006 Ga0466966_0064006_766_1434 197
361 3300044694 Ga0466963_0006491 Ga0466963_0006491_4277_4939 197
362 3300044706 Ga0466964_0066628 Ga0466964_0066628_311_973 197
363 3300045976 Ga0466967_0026627 Ga0466967_0026627_2544_3206 197
364 3300045976 Ga0466967_0038638 Ga0466967_0038638_1489_2151 197
365 3300048921 Ga0496118_0069620 Ga0496118_0069620_1285_1947 197
366 3300048924 Ga0496121_0003234 Ga0496121_0003234_12879_13541 197
367 3300048928 Ga0496125_0064218 Ga0496125_0064218_539_1213 197
368 3300049742 Ga0501080_0011579 Ga0501080_0011579_3215_3877 197
369 3300050511 nmdc:mga08y16_17073_c1 nmdc:mga08y16_17073_c1_5747_6409 197

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00834

Ribul_P_3_epim

Ribulose-phosphate 3 epimerase family

2

197

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fli-assembly1.cif.gz_E the crystal structure of d-ribulose 5-phosphate 3-epimerase from streptococus pyogenes complexed with d-xylitol 5-phosphate 0.9506 7 192
7sbj-assembly1.cif.gz_C crystal structure of ribulose-phosphate 3-epimerase from stenotrophomonas maltophilia k279a 0.9431 5 193
1tqj-assembly1.cif.gz_B crystal structure of d-ribulose 5-phosphate 3-epimerase from synechocystis to 1.6 angstrom resolution 0.9324 3 192
1tqj-assembly1.cif.gz_E crystal structure of d-ribulose 5-phosphate 3-epimerase from synechocystis to 1.6 angstrom resolution 0.9319 3 192
3inp-assembly1.cif.gz_A 2.05 angstrom resolution crystal structure of d-ribulose-phosphate 3-epimerase from francisella tularensis. 0.9309 7 192
ID Description Score Start End Superfamily
2fliC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9494 3 192 3.20.20.70
af_P0AG07_1_223_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.939 1 192 3.20.20.70
af_Q58093_1_217_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9321 4 192 3.20.20.70
1tqjD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9292 3 192 3.20.20.70
af_P9WI51_4_223_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9255 2 192 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A1D7NHS1-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.9662 23 192 GO:0004750
GO:0006098
GO:0019323
GO:0046872
AF-A0A382RK94-F1-model_v4 ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.9588 37 193 GO:0004750
GO:0005975
GO:0006098
AF-A0A3D0RU88-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.9569 36 192 GO:0004750
GO:0005975
GO:0006098
GO:0046872
AF-A0A6I6AK56-F1-model_v4 deleted 0.9564 4 192
AF-A0A661NUS9-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.9558 3 192 GO:0004750
GO:0006098
GO:0019323
GO:0046872

Feature Viewer

pLDDT pTM Quality
89.78 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map