F425193

General Info

Members Datasets Scaffolds Average Seq Length
369 255 738 322

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0072450|Ga0501034_0072450_620_1669
Length 349
Sequence MVAPLRRAAFDIRQRHATTSKGQAMVFRALMIALVTGMAALPAQAASYPDHTVKMIVPFAAGGGTDVLARIIAQKLNEKWGQPVVVENQPGASGGIGTRAVANATPDGYTLLMASTGALMAAASALGGDGPFDVNKVLSPITVAAAPPYLLVVNPSVPANSAADLIRISKEKPGSLTFGSSGVGAASHLSGVLFESEAGIKMLHVPYKGTGPGLTDLLGGRIDLMFAPAPVVQSSVQAGKLKAIGTTDTRRSKFYPDVPAISESGLPGYESVGWFGLLAPAKTSPEIVKQINQAVVAIMDTKEFRDQLAILGAEPKPQTPEEFGRYINADIAKWTKLVKDNNIKLPGAK

Samples

Sample ID Description Type Environment
1 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
132 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
133 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
134 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
135 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
136 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
137 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
138 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
139 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
140 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
141 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
142 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
143 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
144 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
145 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
146 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
147 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
148 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
149 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
151 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
152 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
153 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
154 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
155 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
156 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
157 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
158 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
159 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
160 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
161 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
162 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
163 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
164 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
165 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
166 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
167 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
168 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
169 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
170 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
171 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
172 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
173 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
174 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
175 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
176 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
177 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
178 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
179 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
180 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
181 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
182 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
183 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
184 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
185 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
186 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
187 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
188 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
189 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
190 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
191 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
192 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
193 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
194 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
195 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
196 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
197 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
198 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
199 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
200 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
201 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
202 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
203 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
204 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
205 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
206 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
207 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
208 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
209 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
210 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
211 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
212 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
213 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
222 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
223 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
224 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
225 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
226 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
227 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
228 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
230 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
231 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
232 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
233 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
234 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
235 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
236 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
237 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
238 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
239 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
240 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
241 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
242 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
243 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
244 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
245 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
246 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
247 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
248 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
249 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
250 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
251 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
252 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
253 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
254 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
255 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.46
Metatranscriptomes 0
Isolates 0.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.76
Nodule 0.27
Rhizoplane 5.15
Rhizosphere 81.57
Stem 0
Stem Tuber 0
Unclassified 3.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501034_0072450 3300049571 Bacteria 3454
2 JGI25159J45721_1000204 3300002987 Bacteria 27544
3 JGI25151J46595_10040089 3300003187 Bacteria 1721
4 JGI25406J46586_10000053 3300003203 Bacteria 53627
5 JGI25404J52841_10002774 3300003659 Bacteria 3372
6 JGI25404J52841_10005519 3300003659 Bacteria 2612
7 Ga0070658_10101740 3300005327 Bacteria 2376
8 Ga0070676_10056227 3300005328 Bacteria 2324
9 Ga0070683_100110542 3300005329 Bacteria 2592
10 Ga0070683_100189557 3300005329 Unclassified 1952
11 Ga0070690_100014746 3300005330 Bacteria 4642
12 Ga0070670_100137794 3300005331 Unclassified 2109
13 Ga0070677_10044771 3300005333 Bacteria 1762
14 Ga0068869_100092989 3300005334 Bacteria 2271
15 Ga0070666_10095302 3300005335 Unclassified 2048
16 Ga0070680_100087385 3300005336 Bacteria 2578
17 Ga0070682_100093981 3300005337 Bacteria 1967
18 Ga0068868_100063196 3300005338 Bacteria 2937
19 Ga0068868_100114883 3300005338 Bacteria 2191
20 Ga0070689_100021461 3300005340 Bacteria 4808
21 Ga0070689_100277562 3300005340 Bacteria 1389
22 Ga0070687_100023901 3300005343 Bacteria 2910
23 Ga0070661_100208374 3300005344 Bacteria 1496
24 Ga0070675_100019276 3300005354 Bacteria 5434
25 Ga0070675_100215003 3300005354 Bacteria 1673
26 Ga0070671_100091110 3300005355 Bacteria 2553
27 Ga0070671_100181788 3300005355 Bacteria 1780
28 Ga0070709_10005205 3300005434 Bacteria 7035
29 Ga0070713_100004628 3300005436 Bacteria 9276
30 Ga0070711_100021473 3300005439 Bacteria 4175
31 Ga0070663_100003233 3300005455 Bacteria 9369
32 Ga0070678_100036219 3300005456 Bacteria 3452
33 Ga0070678_100187924 3300005456 Bacteria 1696
34 Ga0070662_100320815 3300005457 Unclassified 1263
35 Ga0070681_10221887 3300005458 Bacteria 1805
36 Ga0068867_100117526 3300005459 Bacteria 2050
37 Ga0070706_100056300 3300005467 Bacteria 3629
38 Ga0070679_100010451 3300005530 Bacteria 8803
39 Ga0070684_100121636 3300005535 Bacteria 2348
40 Ga0070684_100158578 3300005535 Unclassified 2052
41 Ga0070697_100037652 3300005536 Bacteria 3908
42 Ga0070697_100145470 3300005536 Bacteria 1995
43 Ga0070665_100023863 3300005548 Bacteria 6162
44 Ga0070665_100070557 3300005548 Bacteria 3501
45 Ga0070665_100238197 3300005548 Bacteria 1820
46 Ga0068855_100058101 3300005563 Bacteria 4532
47 Ga0068855_100173823 3300005563 Bacteria 2438
48 Ga0068855_100196919 3300005563 Bacteria 2270
49 Ga0070664_100351625 3300005564 Bacteria 1341
50 Ga0068857_100135758 3300005577 Bacteria 2221
51 Ga0068854_100016160 3300005578 Bacteria 4967
52 Ga0068854_100112131 3300005578 Unclassified 2059
53 Ga0068856_100000255 3300005614 Bacteria 58233
54 Ga0068852_100501534 3300005616 Bacteria 1208
55 Ga0068864_100020704 3300005618 Bacteria 5505
56 Ga0068861_100470828 3300005719 Bacteria 1130
57 Ga0068851_10004143 3300005834 Bacteria 6526
58 Ga0068863_100057559 3300005841 Bacteria 3679
59 Ga0068858_100135473 3300005842 Bacteria 2311
60 Ga0081455_10026772 3300005937 Bacteria 5295
61 Ga0081540_1006058 3300005983 Bacteria 8893
62 Ga0081540_1028637 3300005983 Bacteria 3123
63 Ga0081539_10000471 3300005985 Bacteria 85272
64 Ga0075365_10100427 3300006038 Bacteria 1981
65 Ga0075363_100017660 3300006048 Bacteria 3542
66 Ga0070716_100112293 3300006173 Bacteria 1691
67 Ga0070712_100135698 3300006175 Bacteria 1871
68 Ga0075367_10008920 3300006178 Bacteria 5218
69 Ga0097621_100010122 3300006237 Bacteria 6882
70 Ga0097621_100100040 3300006237 Bacteria 2438
71 Ga0097621_100126602 3300006237 Bacteria 2170
72 Ga0075370_10089827 3300006353 Bacteria 1772
73 Ga0068871_100022366 3300006358 Bacteria 4872
74 Ga0068871_100037966 3300006358 Bacteria 3843
75 Ga0075428_100032963 3300006844 Bacteria 5719
76 Ga0068865_100341162 3300006881 Unclassified 1211
77 Ga0099794_10009618 3300007265 Bacteria 4075
78 Ga0099794_10019028 3300007265 Bacteria 3088
79 Ga0111539_10041526 3300009094 Bacteria 5530
80 Ga0111539_10137912 3300009094 Unclassified 2857
81 Ga0111539_10233519 3300009094 Bacteria 2141
82 Ga0105245_10014147 3300009098 Bacteria 6954
83 Ga0105245_10042699 3300009098 Bacteria 4045
84 Ga0105245_10297658 3300009098 Unclassified 1582
85 Ga0105245_10436811 3300009098 Bacteria 1315
86 Ga0105247_10073292 3300009101 Bacteria 2145
87 Ga0105243_10246686 3300009148 Bacteria 1592
88 Ga0105242_10033868 3300009176 Bacteria 4093
89 Ga0105248_10043444 3300009177 Bacteria 5039
90 Ga0105248_10068763 3300009177 Bacteria 3976
91 Ga0105248_10297258 3300009177 Bacteria 1818
92 Ga0105248_10681052 3300009177 Bacteria 1160
93 Ga0105237_10032335 3300009545 Bacteria 5297
94 Ga0105237_10081881 3300009545 Bacteria 3219
95 Ga0105238_10014644 3300009551 Bacteria 7931
96 Ga0099796_10005183 3300010159 Bacteria 3231
97 Ga0105239_10027556 3300010375 Bacteria 6253
98 Ga0105239_10044633 3300010375 Bacteria 4858
99 Ga0105239_10604518 3300010375 Bacteria 1251
100 Ga0105246_10096002 3300011119 Bacteria 2147
101 Ga0157370_10040732 3300013104 Bacteria 4485
102 Ga0157369_10088385 3300013105 Bacteria 3307
103 Ga0157374_10026246 3300013296 Bacteria 5240
104 Ga0157374_10159688 3300013296 Bacteria 2195
105 Ga0157378_10028059 3300013297 Bacteria 4964
106 Ga0157378_10122877 3300013297 Bacteria 2395
107 Ga0163162_10072181 3300013306 Bacteria 3506
108 Ga0163162_10393012 3300013306 Bacteria 1519
109 Ga0157375_10005904 3300013308 Bacteria 10671
110 Ga0157375_10077613 3300013308 Bacteria 3352
111 Ga0157375_10095450 3300013308 Bacteria 3045
112 Ga0157375_10309846 3300013308 Bacteria 1743
113 Ga0163163_10049822 3300014325 Bacteria 4122
114 Ga0163163_10247985 3300014325 Bacteria 1831
115 Ga0157380_10354346 3300014326 Bacteria 1374
116 Ga0157379_10055440 3300014968 Bacteria 3541
117 Ga0157376_10048387 3300014969 Bacteria 3515
118 Ga0157376_10198622 3300014969 Bacteria 1844
119 Ga0163161_10026582 3300017792 Bacteria 4099
120 Ga0163161_10274595 3300017792 Bacteria 1320
121 Ga0209676_1004779 3300025292 Bacteria 7375
122 Ga0207697_10026412 3300025315 Bacteria 2374
123 Ga0207682_10002784 3300025893 Bacteria 7735
124 Ga0207710_10078167 3300025900 Bacteria 1530
125 Ga0207680_10108036 3300025903 Bacteria 1799
126 Ga0207699_10188510 3300025906 Bacteria 1390
127 Ga0207643_10019522 3300025908 Bacteria 3715
128 Ga0207705_10090362 3300025909 Bacteria 2242
129 Ga0207705_10119456 3300025909 Bacteria 1955
130 Ga0207684_10314837 3300025910 Bacteria 1349
131 Ga0207707_10005503 3300025912 Bacteria 11068
132 Ga0207707_10465542 3300025912 Bacteria 1081
133 Ga0207671_10033884 3300025914 Bacteria 3797
134 Ga0207693_10015625 3300025915 Bacteria 6087
135 Ga0207663_10011186 3300025916 Bacteria 4809
136 Ga0207660_10075432 3300025917 Bacteria 2464
137 Ga0207662_10026782 3300025918 Bacteria 3327
138 Ga0207652_10002565 3300025921 Bacteria 15245
139 Ga0207652_10050137 3300025921 Bacteria 3576
140 Ga0207652_10123773 3300025921 Bacteria 2302
141 Ga0207694_10011753 3300025924 Bacteria 6606
142 Ga0207650_10032199 3300025925 Bacteria 3792
143 Ga0207659_10016503 3300025926 Bacteria 4807
144 Ga0207687_10074333 3300025927 Bacteria 2436
145 Ga0207687_10111081 3300025927 Bacteria 2034
146 Ga0207687_10393351 3300025927 Bacteria 1138
147 Ga0207700_10073453 3300025928 Bacteria 2641
148 Ga0207700_10116189 3300025928 Bacteria 2162
149 Ga0207644_10019258 3300025931 Bacteria 4627
150 Ga0207644_10034489 3300025931 Bacteria 3541
151 Ga0207706_10035933 3300025933 Bacteria 4402
152 Ga0207686_10099598 3300025934 Bacteria 1938
153 Ga0207704_10061863 3300025938 Bacteria 2325
154 Ga0207704_10267258 3300025938 Unclassified 1293
155 Ga0207665_10110814 3300025939 Bacteria 1928
156 Ga0207691_10158563 3300025940 Bacteria 1986
157 Ga0207691_10180710 3300025940 Bacteria 1843
158 Ga0207711_10031600 3300025941 Bacteria 4470
159 Ga0207711_10122021 3300025941 Unclassified 2327
160 Ga0207689_10051824 3300025942 Bacteria 3383
161 Ga0207689_10133225 3300025942 Bacteria 2046
162 Ga0207661_10062843 3300025944 Bacteria 3005
163 Ga0207661_10113751 3300025944 Bacteria 2293
164 Ga0207667_10313660 3300025949 Bacteria 1602
165 Ga0207667_10414960 3300025949 Bacteria 1370
166 Ga0207651_10003682 3300025960 Bacteria 7574
167 Ga0207712_10192487 3300025961 Bacteria 1611
168 Ga0207640_10017614 3300025981 Bacteria 4183
169 Ga0207640_10087523 3300025981 Bacteria 2147
170 Ga0207677_10029117 3300026023 Bacteria 3505
171 Ga0207677_10153666 3300026023 Bacteria 1779
172 Ga0207639_10065422 3300026041 Bacteria 2822
173 Ga0207678_10002626 3300026067 Bacteria 16370
174 Ga0207708_10049999 3300026075 Bacteria 3183
175 Ga0207702_10000390 3300026078 Bacteria 50020
176 Ga0207641_10035491 3300026088 Bacteria 4154
177 Ga0207648_10038723 3300026089 Bacteria 4194
178 Ga0207648_10234572 3300026089 Bacteria 1633
179 Ga0207676_10011350 3300026095 Bacteria 6369
180 Ga0207676_10099453 3300026095 Bacteria 2407
181 Ga0207674_10029712 3300026116 Bacteria 5752
182 Ga0207674_10247128 3300026116 Bacteria 1731
183 Ga0207674_10262237 3300026116 Bacteria 1675
184 Ga0207675_100170511 3300026118 Bacteria 2080
185 Ga0207683_10003929 3300026121 Bacteria 12893
186 Ga0207683_10005875 3300026121 Bacteria 10527
187 Ga0207683_10023916 3300026121 Bacteria 5257
188 Ga0207683_10454831 3300026121 Bacteria 1180
189 Ga0207698_10010313 3300026142 Bacteria 5993
190 Ga0207698_10038208 3300026142 Bacteria 3544
191 Ga0209179_1000796 3300027512 Bacteria 3448
192 Ga0207428_10059264 3300027907 Bacteria 3036
193 Ga0268266_10003290 3300028379 Bacteria 16240
194 Ga0268266_10092360 3300028379 Bacteria 2655
195 Ga0268266_10254730 3300028379 Bacteria 1624
196 Ga0268266_10472150 3300028379 Bacteria 1195
197 Ga0307517_10083264 3300028786 Bacteria 2706
198 Ga0265314_10013870 3300031711 Bacteria 6486
199 Ga0265314_10015037 3300031711 Bacteria 6158
200 Ga0265314_10022069 3300031711 Bacteria 4881
201 Ga0265342_10031602 3300031712 Bacteria 3272
202 Ga0307406_10307492 3300031901 Bacteria 1221
203 Ga0307415_100038006 3300032126 Bacteria 3169
204 Ga0307510_10094096 3300033180 Bacteria 2824
205 Ga0373923_0001959 3300035111 Bacteria 6173
206 Ga0373923_0011540 3300035111 Bacteria 3244
207 Ga0373936_0016773 3300035113 Bacteria 2819
208 Ga0373956_0102769 3300035119 Bacteria 1327
209 Ga0373957_0023444 3300035120 Bacteria 2208
210 Ga0373943_0008421 3300035170 Bacteria 4626
211 Ga0373946_0090148 3300035171 Bacteria 1357
212 Ga0373955_0040252 3300035172 Bacteria 2498
213 Ga0373931_0050830 3300035691 Bacteria 2206
214 Ga0373935_0000120 3300035692 Bacteria 35369
215 Ga0373927_0001032 3300035695 Bacteria 21199
216 Ga0373927_0072724 3300035695 Bacteria 2226
217 Ga0373933_0169849 3300035724 Bacteria 1387
218 Ga0373947_0022605 3300035725 Bacteria 3648
219 Ga0373947_0022661 3300035725 Bacteria 3644
220 Ga0373925_0066545 3300037068 Bacteria 2716
221 Ga0395905_0229315 3300037471 Bacteria 1737
222 Ga0395901_0039892 3300038443 Bacteria 4861
223 Ga0436365_1789993 3300039437 Bacteria 1444
224 Ga0436360_1014863 3300039438 Bacteria 1658
225 Ga0451577_0086021 3300042876 Bacteria 2805
226 Ga0495603_0000209 3300046455 Bacteria 30220
227 Ga0495603_0013260 3300046455 Bacteria 4983
228 Ga0495603_0179938 3300046455 Bacteria 1223
229 Ga0495629_0007036 3300046459 Bacteria 8290
230 Ga0495629_0027391 3300046459 Bacteria 4045
231 Ga0495638_0078687 3300046460 Bacteria 2006
232 Ga0495641_0007941 3300046461 Bacteria 6549
233 Ga0495651_0372745 3300046462 Bacteria 938
234 Ga0495580_0011705 3300046472 Bacteria 6779
235 Ga0495582_0000152 3300046473 Bacteria 37542
236 Ga0495605_0073366 3300046474 Bacteria 1612
237 Ga0495639_0000087 3300046475 Bacteria 44546
238 Ga0495662_0001427 3300046476 Bacteria 11825
239 Ga0495662_0146903 3300046476 Bacteria 1161
240 Ga0495664_0027052 3300046477 Bacteria 3343
241 Ga0495594_0000129 3300046499 Bacteria 35623
242 Ga0495606_0001391 3300046507 Bacteria 32703
243 Ga0495618_0091602 3300046514 Bacteria 1943
244 Ga0495628_0103669 3300046516 Bacteria 2193
245 Ga0495632_0115116 3300046519 Bacteria 1260
246 Ga0495666_0065885 3300046526 Bacteria 1727
247 Ga0495652_0037882 3300046529 Bacteria 4181
248 Ga0495665_0000124 3300046531 Bacteria 36916
249 Ga0495640_0003370 3300046533 Bacteria 12865
250 Ga0495621_0048559 3300046539 Bacteria 1512
251 Ga0495622_0004439 3300046557 Bacteria 6513
252 Ga0495667_0052291 3300046559 Bacteria 2692
253 Ga0495656_0165914 3300046615 Bacteria 1076
254 Ga0495634_0000599 3300046642 Bacteria 34949
255 Ga0495625_0186181 3300046660 Bacteria 1378
256 Ga0495635_0006718 3300046663 Bacteria 8035
257 Ga0495588_0002398 3300046674 Bacteria 8015
258 Ga0495646_0011987 3300046680 Bacteria 5514
259 Ga0495647_0002161 3300046681 Bacteria 6145
260 Ga0495647_0032911 3300046681 Bacteria 1935
261 Ga0495669_0044822 3300046684 Bacteria 1971
262 Ga0495613_0040424 3300046689 Bacteria 3455
263 Ga0495624_0001738 3300046690 Bacteria 16643
264 Ga0495624_0022985 3300046690 Bacteria 4114
265 Ga0495624_0166987 3300046690 Bacteria 1343
266 Ga0495600_0041560 3300046809 Bacteria 2997
267 Ga0495581_0015405 3300047315 Bacteria 4438
268 Ga0495604_0110724 3300047317 Bacteria 2003
269 Ga0495674_0002170 3300047319 Bacteria 19272
270 Ga0495674_0198811 3300047319 Bacteria 1664
271 Ga0495672_0009230 3300047320 Bacteria 7175
272 Ga0495672_0015202 3300047320 Bacteria 5236
273 Ga0495672_0071112 3300047320 Bacteria 1970
274 Ga0495676_0020872 3300047321 Bacteria 5736
275 Ga0495680_0070355 3300047322 Bacteria 2668
276 Ga0495673_0041958 3300047469 Bacteria 2056
277 Ga0495684_0005961 3300047471 Bacteria 9468
278 Ga0495684_0011222 3300047471 Bacteria 6926
279 Ga0495686_0073037 3300047472 Bacteria 2108
280 Ga0495593_0000022 3300047673 Bacteria 69741
281 Ga0495593_0067401 3300047673 Bacteria 1863
282 Ga0495614_0032533 3300048089 Bacteria 2245
283 Ga0496102_0012871 3300048905 Bacteria 7242
284 Ga0496102_0224966 3300048905 Bacteria 1769
285 Ga0496102_0350244 3300048905 Bacteria 1390
286 Ga0496104_0088833 3300048907 Bacteria 2952
287 Ga0496104_0115910 3300048907 Bacteria 2571
288 Ga0496106_0112508 3300048909 Bacteria 2121
289 Ga0496106_0133816 3300048909 Bacteria 1946
290 Ga0496108_0030901 3300048911 Bacteria 4439
291 Ga0496108_0097974 3300048911 Bacteria 2499
292 Ga0496109_0314647 3300048912 Unclassified 1477
293 Ga0496109_0417914 3300048912 Bacteria 1267
294 Ga0496110_0004360 3300048913 Bacteria 10953
295 Ga0496110_0210062 3300048913 Unclassified 1769
296 Ga0496112_0041447 3300048915 Bacteria 4505
297 Ga0496112_0090679 3300048915 Bacteria 3025
298 Ga0496114_0051491 3300048917 Bacteria 3428
299 Ga0496114_0167137 3300048917 Bacteria 1916
300 Ga0496115_0006984 3300048918 Bacteria 8292
301 Ga0496115_0098014 3300048918 Bacteria 2401
302 Ga0496121_0001041 3300048924 Bacteria 49426
303 Ga0496122_0023155 3300048925 Bacteria 5488
304 Ga0496123_0072344 3300048926 Bacteria 2146
305 Ga0496126_0001870 3300048929 Bacteria 30630
306 Ga0496126_0010540 3300048929 Bacteria 9678
307 Ga0496126_0076070 3300048929 Bacteria 2979
308 Ga0496126_0164112 3300048929 Bacteria 1897
309 Ga0496126_0239900 3300048929 Bacteria 1515
310 Ga0496126_0427176 3300048929 Bacteria 1070
311 Ga0501032_0011386 3300049569 Bacteria 6390
312 Ga0501034_0102985 3300049571 Bacteria 2848
313 Ga0501034_0217219 3300049571 Bacteria 1865
314 Ga0501036_0053910 3300049572 Bacteria 3404
315 Ga0501038_0089542 3300049574 Bacteria 2581
316 Ga0501039_0037404 3300049575 Bacteria 3746
317 Ga0501042_0019094 3300049578 Bacteria 4757
318 Ga0501043_0115931 3300049579 Bacteria 2102
319 Ga0501043_0263109 3300049579 Bacteria 1326
320 Ga0501047_0028185 3300049581 Bacteria 5412
321 Ga0501047_0305143 3300049581 Bacteria 1433
322 Ga0501048_0144668 3300049582 Bacteria 1681
323 Ga0501068_0028936 3300049584 Bacteria 3280
324 Ga0501069_0045048 3300049585 Bacteria 2443
325 Ga0501069_0078446 3300049585 Bacteria 1857
326 Ga0501070_0093293 3300049586 Bacteria 2490
327 Ga0501071_0049298 3300049587 Bacteria 3031
328 Ga0501073_0033561 3300049589 Bacteria 3654
329 Ga0501074_0172752 3300049590 Bacteria 1542
330 Ga0501076_0147703 3300049592 Bacteria 1912
331 Ga0501044_0000782 3300049823 Bacteria 38567
332 Ga0501044_0099898 3300049823 Bacteria 2920
333 Ga0501044_0211657 3300049823 Bacteria 1892
334 Ga0501045_0109764 3300049824 Bacteria 2045
335 nmdc:mga03n38_33499_c1 3300050490 Bacteria 2186
336 nmdc:mga0yw44_47430_c1 3300050492 Bacteria 2586
337 nmdc:mga06z11_41581_c1 3300050494 Bacteria 2301
338 nmdc:mga07m45_7786_c1 3300050496 Bacteria 5483
339 nmdc:mga05p37_224724_c1 3300050507 Bacteria 2264
340 nmdc:mga09592_402929_c1 3300050508 Bacteria 1182
341 nmdc:mga08y16_59090_c1 3300050511 Bacteria 4006
342 nmdc:mga0sz30_116378_c1 3300050516 Bacteria 1173
343 Ga0500635_0003822 3300053080 Bacteria 3819
344 Ga0500635_0064718 3300053080 Bacteria 1284
345 Ga0500643_019366 3300053087 Bacteria 2241
346 Ga0500644_0000657 3300053088 Bacteria 12711
347 Ga0500651_0009740 3300053093 Bacteria 5728
348 Ga0500651_0061104 3300053093 Bacteria 2354
349 Ga0500566_0017718 3300053094 Bacteria 4183
350 Ga0500554_018766 3300053102 Bacteria 1873
351 Ga0500595_000006 3300053119 Bacteria 300857
352 Ga0500595_001396 3300053119 Bacteria 12949
353 Ga0500595_004460 3300053119 Bacteria 6276
354 Ga0500642_0113360 3300053130 Bacteria 1267
355 Ga0500568_0079273 3300053139 Bacteria 1248
356 Ga0500603_000672 3300053150 Bacteria 8327
357 Ga0500616_0000001 3300053153 Bacteria 1986011
358 Ga0500616_0028978 3300053153 Bacteria 3048
359 Ga0500616_0055737 3300053153 Bacteria 2066
360 Ga0500638_000119 3300053162 Bacteria 15195
361 Ga0500637_0002312 3300053178 Bacteria 8437
362 Ga0500637_0005710 3300053178 Bacteria 6053
363 Ga0500637_0017233 3300053178 Bacteria 3863
364 Ga0500645_001371 3300053730 Bacteria 12503
365 Ga0500645_014090 3300053730 Bacteria 2554
366 Ga0500661_002123 3300055283 Bacteria 3740
367 Ga0501082_0007071 3300060353 Bacteria 9685
368 2524469264 2524023210 Bacteria 9029266
369 8055227824 8055225921 Bacteria 3341787
370 Ga0501034_0072450
371 JGI25159J45721_1000204
372 JGI25151J46595_10040089
373 JGI25406J46586_10000053
374 JGI25404J52841_10002774
375 JGI25404J52841_10005519
376 Ga0070658_10101740
377 Ga0070676_10056227
378 Ga0070683_100110542
379 Ga0070683_100189557
380 Ga0070690_100014746
381 Ga0070670_100137794
382 Ga0070677_10044771
383 Ga0068869_100092989
384 Ga0070666_10095302
385 Ga0070680_100087385
386 Ga0070682_100093981
387 Ga0068868_100063196
388 Ga0068868_100114883
389 Ga0070689_100021461
390 Ga0070689_100277562
391 Ga0070687_100023901
392 Ga0070661_100208374
393 Ga0070675_100019276
394 Ga0070675_100215003
395 Ga0070671_100091110
396 Ga0070671_100181788
397 Ga0070709_10005205
398 Ga0070713_100004628
399 Ga0070711_100021473
400 Ga0070663_100003233
401 Ga0070678_100036219
402 Ga0070678_100187924
403 Ga0070662_100320815
404 Ga0070681_10221887
405 Ga0068867_100117526
406 Ga0070706_100056300
407 Ga0070679_100010451
408 Ga0070684_100121636
409 Ga0070684_100158578
410 Ga0070697_100037652
411 Ga0070697_100145470
412 Ga0070665_100023863
413 Ga0070665_100070557
414 Ga0070665_100238197
415 Ga0068855_100058101
416 Ga0068855_100173823
417 Ga0068855_100196919
418 Ga0070664_100351625
419 Ga0068857_100135758
420 Ga0068854_100016160
421 Ga0068854_100112131
422 Ga0068856_100000255
423 Ga0068852_100501534
424 Ga0068864_100020704
425 Ga0068861_100470828
426 Ga0068851_10004143
427 Ga0068863_100057559
428 Ga0068858_100135473
429 Ga0081455_10026772
430 Ga0081540_1006058
431 Ga0081540_1028637
432 Ga0081539_10000471
433 Ga0075365_10100427
434 Ga0075363_100017660
435 Ga0070716_100112293
436 Ga0070712_100135698
437 Ga0075367_10008920
438 Ga0097621_100010122
439 Ga0097621_100100040
440 Ga0097621_100126602
441 Ga0075370_10089827
442 Ga0068871_100022366
443 Ga0068871_100037966
444 Ga0075428_100032963
445 Ga0068865_100341162
446 Ga0099794_10009618
447 Ga0099794_10019028
448 Ga0111539_10041526
449 Ga0111539_10137912
450 Ga0111539_10233519
451 Ga0105245_10014147
452 Ga0105245_10042699
453 Ga0105245_10297658
454 Ga0105245_10436811
455 Ga0105247_10073292
456 Ga0105243_10246686
457 Ga0105242_10033868
458 Ga0105248_10043444
459 Ga0105248_10068763
460 Ga0105248_10297258
461 Ga0105248_10681052
462 Ga0105237_10032335
463 Ga0105237_10081881
464 Ga0105238_10014644
465 Ga0099796_10005183
466 Ga0105239_10027556
467 Ga0105239_10044633
468 Ga0105239_10604518
469 Ga0105246_10096002
470 Ga0157370_10040732
471 Ga0157369_10088385
472 Ga0157374_10026246
473 Ga0157374_10159688
474 Ga0157378_10028059
475 Ga0157378_10122877
476 Ga0163162_10072181
477 Ga0163162_10393012
478 Ga0157375_10005904
479 Ga0157375_10077613
480 Ga0157375_10095450
481 Ga0157375_10309846
482 Ga0163163_10049822
483 Ga0163163_10247985
484 Ga0157380_10354346
485 Ga0157379_10055440
486 Ga0157376_10048387
487 Ga0157376_10198622
488 Ga0163161_10026582
489 Ga0163161_10274595
490 Ga0209676_1004779
491 Ga0207697_10026412
492 Ga0207682_10002784
493 Ga0207710_10078167
494 Ga0207680_10108036
495 Ga0207699_10188510
496 Ga0207643_10019522
497 Ga0207705_10090362
498 Ga0207705_10119456
499 Ga0207684_10314837
500 Ga0207707_10005503
501 Ga0207707_10465542
502 Ga0207671_10033884
503 Ga0207693_10015625
504 Ga0207663_10011186
505 Ga0207660_10075432
506 Ga0207662_10026782
507 Ga0207652_10002565
508 Ga0207652_10050137
509 Ga0207652_10123773
510 Ga0207694_10011753
511 Ga0207650_10032199
512 Ga0207659_10016503
513 Ga0207687_10074333
514 Ga0207687_10111081
515 Ga0207687_10393351
516 Ga0207700_10073453
517 Ga0207700_10116189
518 Ga0207644_10019258
519 Ga0207644_10034489
520 Ga0207706_10035933
521 Ga0207686_10099598
522 Ga0207704_10061863
523 Ga0207704_10267258
524 Ga0207665_10110814
525 Ga0207691_10158563
526 Ga0207691_10180710
527 Ga0207711_10031600
528 Ga0207711_10122021
529 Ga0207689_10051824
530 Ga0207689_10133225
531 Ga0207661_10062843
532 Ga0207661_10113751
533 Ga0207667_10313660
534 Ga0207667_10414960
535 Ga0207651_10003682
536 Ga0207712_10192487
537 Ga0207640_10017614
538 Ga0207640_10087523
539 Ga0207677_10029117
540 Ga0207677_10153666
541 Ga0207639_10065422
542 Ga0207678_10002626
543 Ga0207708_10049999
544 Ga0207702_10000390
545 Ga0207641_10035491
546 Ga0207648_10038723
547 Ga0207648_10234572
548 Ga0207676_10011350
549 Ga0207676_10099453
550 Ga0207674_10029712
551 Ga0207674_10247128
552 Ga0207674_10262237
553 Ga0207675_100170511
554 Ga0207683_10003929
555 Ga0207683_10005875
556 Ga0207683_10023916
557 Ga0207683_10454831
558 Ga0207698_10010313
559 Ga0207698_10038208
560 Ga0209179_1000796
561 Ga0207428_10059264
562 Ga0268266_10003290
563 Ga0268266_10092360
564 Ga0268266_10254730
565 Ga0268266_10472150
566 Ga0307517_10083264
567 Ga0265314_10013870
568 Ga0265314_10015037
569 Ga0265314_10022069
570 Ga0265342_10031602
571 Ga0307406_10307492
572 Ga0307415_100038006
573 Ga0307510_10094096
574 Ga0373923_0001959
575 Ga0373923_0011540
576 Ga0373936_0016773
577 Ga0373956_0102769
578 Ga0373957_0023444
579 Ga0373943_0008421
580 Ga0373946_0090148
581 Ga0373955_0040252
582 Ga0373931_0050830
583 Ga0373935_0000120
584 Ga0373927_0001032
585 Ga0373927_0072724
586 Ga0373933_0169849
587 Ga0373947_0022605
588 Ga0373947_0022661
589 Ga0373925_0066545
590 Ga0395905_0229315
591 Ga0395901_0039892
592 Ga0436365_1789993
593 Ga0436360_1014863
594 Ga0451577_0086021
595 Ga0495603_0000209
596 Ga0495603_0013260
597 Ga0495603_0179938
598 Ga0495629_0007036
599 Ga0495629_0027391
600 Ga0495638_0078687
601 Ga0495641_0007941
602 Ga0495651_0372745
603 Ga0495580_0011705
604 Ga0495582_0000152
605 Ga0495605_0073366
606 Ga0495639_0000087
607 Ga0495662_0001427
608 Ga0495662_0146903
609 Ga0495664_0027052
610 Ga0495594_0000129
611 Ga0495606_0001391
612 Ga0495618_0091602
613 Ga0495628_0103669
614 Ga0495632_0115116
615 Ga0495666_0065885
616 Ga0495652_0037882
617 Ga0495665_0000124
618 Ga0495640_0003370
619 Ga0495621_0048559
620 Ga0495622_0004439
621 Ga0495667_0052291
622 Ga0495656_0165914
623 Ga0495634_0000599
624 Ga0495625_0186181
625 Ga0495635_0006718
626 Ga0495588_0002398
627 Ga0495646_0011987
628 Ga0495647_0002161
629 Ga0495647_0032911
630 Ga0495669_0044822
631 Ga0495613_0040424
632 Ga0495624_0001738
633 Ga0495624_0022985
634 Ga0495624_0166987
635 Ga0495600_0041560
636 Ga0495581_0015405
637 Ga0495604_0110724
638 Ga0495674_0002170
639 Ga0495674_0198811
640 Ga0495672_0009230
641 Ga0495672_0015202
642 Ga0495672_0071112
643 Ga0495676_0020872
644 Ga0495680_0070355
645 Ga0495673_0041958
646 Ga0495684_0005961
647 Ga0495684_0011222
648 Ga0495686_0073037
649 Ga0495593_0000022
650 Ga0495593_0067401
651 Ga0495614_0032533
652 Ga0496102_0012871
653 Ga0496102_0224966
654 Ga0496102_0350244
655 Ga0496104_0088833
656 Ga0496104_0115910
657 Ga0496106_0112508
658 Ga0496106_0133816
659 Ga0496108_0030901
660 Ga0496108_0097974
661 Ga0496109_0314647
662 Ga0496109_0417914
663 Ga0496110_0004360
664 Ga0496110_0210062
665 Ga0496112_0041447
666 Ga0496112_0090679
667 Ga0496114_0051491
668 Ga0496114_0167137
669 Ga0496115_0006984
670 Ga0496115_0098014
671 Ga0496121_0001041
672 Ga0496122_0023155
673 Ga0496123_0072344
674 Ga0496126_0001870
675 Ga0496126_0010540
676 Ga0496126_0076070
677 Ga0496126_0164112
678 Ga0496126_0239900
679 Ga0496126_0427176
680 Ga0501032_0011386
681 Ga0501034_0102985
682 Ga0501034_0217219
683 Ga0501036_0053910
684 Ga0501038_0089542
685 Ga0501039_0037404
686 Ga0501042_0019094
687 Ga0501043_0115931
688 Ga0501043_0263109
689 Ga0501047_0028185
690 Ga0501047_0305143
691 Ga0501048_0144668
692 Ga0501068_0028936
693 Ga0501069_0045048
694 Ga0501069_0078446
695 Ga0501070_0093293
696 Ga0501071_0049298
697 Ga0501073_0033561
698 Ga0501074_0172752
699 Ga0501076_0147703
700 Ga0501044_0000782
701 Ga0501044_0099898
702 Ga0501044_0211657
703 Ga0501045_0109764
704 nmdc:mga03n38_33499_c1
705 nmdc:mga0yw44_47430_c1
706 nmdc:mga06z11_41581_c1
707 nmdc:mga07m45_7786_c1
708 nmdc:mga05p37_224724_c1
709 nmdc:mga09592_402929_c1
710 nmdc:mga08y16_59090_c1
711 nmdc:mga0sz30_116378_c1
712 Ga0500635_0003822
713 Ga0500635_0064718
714 Ga0500643_019366
715 Ga0500644_0000657
716 Ga0500651_0009740
717 Ga0500651_0061104
718 Ga0500566_0017718
719 Ga0500554_018766
720 Ga0500595_000006
721 Ga0500595_001396
722 Ga0500595_004460
723 Ga0500642_0113360
724 Ga0500568_0079273
725 Ga0500603_000672
726 Ga0500616_0000001
727 Ga0500616_0028978
728 Ga0500616_0055737
729 Ga0500638_000119
730 Ga0500637_0002312
731 Ga0500637_0005710
732 Ga0500637_0017233
733 Ga0500645_001371
734 Ga0500645_014090
735 Ga0500661_002123
736 Ga0501082_0007071
737 2524469264
738 8055227824

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

68

343

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5oku-assembly1.cif.gz_A r. palustris rpa4515 with adipate 0.9452 32 328
5oku-assembly1.cif.gz_A r. palustris rpa4515 with adipate 0.9361 32 328
8hkb-assembly1.cif.gz_A tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d 0.9326 36 328
2dvz-assembly1.cif.gz_A structure of a periplasmic transporter 0.925 31 328
6hke-assembly1.cif.gz_A matc (rpa3494) from rhodopseudomonas palustris with bound malate 0.9169 32 320
ID Description Score Start End Superfamily
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9336 132 251 3.40.190.10
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9329 132 254 3.40.190.10
2qpqC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9292 132 254 3.40.190.10
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9188 132 254 3.40.190.10
2qpqC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9151 132 254 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A6P2E0C5-F1-model_v4 Argininosuccinate lyase 0.9633 23 328 GO:0016829
AF-A0A4Q2L567-F1-model_v4 deleted 0.9631 69 223
AF-A0A7J4VHT1-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9596 23 320
AF-A0A1Q7BEZ9-F1-model_v4 LacI family transcriptional regulator 0.9594 22 325
AF-A0A1F4AHA8-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9582 57 325

Map