F425167

General Info

Members Datasets Scaffolds Average Seq Length
369 189 738 150

Family's Representative Sequence

Representative Sequence 3300047472|Ga0495686_0233714|Ga0495686_0233714_141_611
Length 156
Sequence MKLGYWKAPTIALAASLLLAGCAAMRAHKGSVIDTQLVSSIQPGVDNQASVEKLLGRPTFVGQFAPADWIYVSRETTQLAFRNPRVTKQATLIVHFDKAGNVTAVEQSGKELAMNLEPTARKTPTMGKQKSFFQELFGNIGTVGSTGASSTADNPQ

Samples

Sample ID Description Type Environment
1 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
5 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
6 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
7 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
68 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
80 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
125 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
126 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
127 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
128 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
129 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
130 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
135 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
136 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
137 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
138 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
139 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
140 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
141 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
142 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
143 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
144 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
145 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
146 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
147 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
148 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
149 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
150 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
151 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
152 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
153 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
154 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
155 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
156 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
157 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
158 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
159 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
160 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
161 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
162 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
163 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
164 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
165 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
166 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
167 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
168 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
169 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
170 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
171 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
172 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
173 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
174 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
175 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
176 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
177 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
178 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
179 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
180 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
181 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
182 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
183 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
184 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber

Type Distribution

Type Percentage (%)
Metagenomes 98.1
Metatranscriptomes 1.63
Isolates 0.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.08
Nodule 0
Rhizoplane 3.79
Rhizosphere 94.85
Stem 0
Stem Tuber 0.27
Unclassified 5.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495686_0233714 3300047472 Bacteria 1040
2 JGI24752J21851_1011019 3300001976 Bacteria 1181
3 JGI24752J21851_1020805 3300001976 Bacteria 857
4 JGI24746J21847_1003180 3300001977 Bacteria 2583
5 JGI24750J21931_1018156 3300002070 Bacteria 967
6 JGI24748J21848_1015431 3300002074 Bacteria 908
7 JGI24749J21850_1023838 3300002076 Bacteria 870
8 JGI24742J22300_10012441 3300002244 Bacteria 1418
9 Ga0065712_10169366 3300005290 Bacteria 1233
10 Ga0065715_10000291 3300005293 Bacteria 19586
11 Ga0065715_10125960 3300005293 Bacteria 2119
12 Ga0065715_10280589 3300005293 Bacteria 1087
13 Ga0065707_10207801 3300005295 Bacteria 1280
14 Ga0065707_10297905 3300005295 Bacteria 1010
15 Ga0065707_10401845 3300005295 Bacteria 852
16 Ga0070676_10004307 3300005328 Bacteria 7478
17 Ga0070676_10017635 3300005328 Bacteria 3951
18 Ga0070676_10264019 3300005328 Bacteria 1154
19 Ga0070683_101868844 3300005329 Unclassified 577
20 Ga0070690_100413421 3300005330 Bacteria 993
21 Ga0070670_100018070 3300005331 Bacteria 6052
22 Ga0070677_10318606 3300005333 Bacteria 796
23 Ga0070680_100579497 3300005336 Bacteria 962
24 Ga0068868_100353651 3300005338 Bacteria 1259
25 Ga0070660_100063665 3300005339 Bacteria 2867
26 Ga0070660_100296146 3300005339 Bacteria 1326
27 Ga0070689_100676166 3300005340 Bacteria 900
28 Ga0070689_101502159 3300005340 Bacteria 610
29 Ga0070661_101048883 3300005344 Unclassified 678
30 Ga0070692_10136784 3300005345 Bacteria 1383
31 Ga0070668_100022474 3300005347 Bacteria 4769
32 Ga0070668_100121671 3300005347 Bacteria 2087
33 Ga0070669_100006898 3300005353 Bacteria 8163
34 Ga0070669_100075187 3300005353 Bacteria 2505
35 Ga0070669_100089055 3300005353 Bacteria 2311
36 Ga0070675_100004774 3300005354 Bacteria 10338
37 Ga0070671_100010695 3300005355 Bacteria 7367
38 Ga0070671_100161728 3300005355 Bacteria 1892
39 Ga0070671_100718039 3300005355 Bacteria 867
40 Ga0070674_100060897 3300005356 Bacteria 2632
41 Ga0070674_101184155 3300005356 Bacteria 678
42 Ga0070673_100005467 3300005364 Bacteria 8132
43 Ga0070673_100280055 3300005364 Bacteria 1462
44 Ga0070667_100002393 3300005367 Bacteria 16426
45 Ga0070667_100095112 3300005367 Bacteria 2568
46 Ga0070667_100132486 3300005367 Bacteria 2177
47 Ga0070667_100168612 3300005367 Bacteria 1932
48 Ga0070701_10093834 3300005438 Bacteria 1650
49 Ga0070700_100559452 3300005441 Bacteria 890
50 Ga0070663_100048361 3300005455 Bacteria 3016
51 Ga0070663_100107654 3300005455 Bacteria 2090
52 Ga0070662_100002356 3300005457 Bacteria 11616
53 Ga0070681_10200887 3300005458 Bacteria 1912
54 Ga0068867_100016865 3300005459 Bacteria 5191
55 Ga0068867_100289764 3300005459 Bacteria 1346
56 Ga0068867_100446310 3300005459 Bacteria 1101
57 Ga0070685_10277262 3300005466 Bacteria 1121
58 Ga0070679_100490629 3300005530 Unclassified 1172
59 Ga0068853_100309231 3300005539 Bacteria 1463
60 Ga0068853_100487266 3300005539 Bacteria 1163
61 Ga0068853_100782705 3300005539 Bacteria 913
62 Ga0070672_100011726 3300005543 Bacteria 6122
63 Ga0070693_100029636 3300005547 Bacteria 2987
64 Ga0070693_100323594 3300005547 Bacteria 1047
65 Ga0070665_100004875 3300005548 Bacteria 13935
66 Ga0070665_100918601 3300005548 Bacteria 888
67 Ga0068855_100182444 3300005563 Bacteria 2372
68 Ga0070664_100006576 3300005564 Bacteria 9375
69 Ga0070664_100433087 3300005564 Unclassified 1205
70 Ga0068857_100010349 3300005577 Bacteria 8103
71 Ga0068857_100062816 3300005577 Bacteria 3302
72 Ga0068857_100307325 3300005577 Bacteria 1462
73 Ga0068854_100026240 3300005578 Bacteria 4002
74 Ga0068854_100103504 3300005578 Bacteria 2137
75 Ga0068854_100328231 3300005578 Bacteria 1246
76 Ga0068856_100016476 3300005614 Bacteria 7154
77 Ga0068856_100354103 3300005614 Bacteria 1487
78 Ga0068852_100579153 3300005616 Bacteria 1125
79 Ga0068852_100580853 3300005616 Bacteria 1123
80 Ga0068852_102626785 3300005616 Unclassified 523
81 Ga0068859_100003244 3300005617 Bacteria 16555
82 Ga0068859_100176874 3300005617 Bacteria 2216
83 Ga0068859_100176927 3300005617 Bacteria 2215
84 Ga0068859_100831903 3300005617 Bacteria 1010
85 Ga0068864_100012608 3300005618 Bacteria 6988
86 Ga0068864_100482648 3300005618 Bacteria 1190
87 Ga0068861_100003911 3300005719 Bacteria 9962
88 Ga0068851_10013729 3300005834 Bacteria 3835
89 Ga0068851_10066459 3300005834 Bacteria 1858
90 Ga0068863_100079338 3300005841 Bacteria 3109
91 Ga0068863_101377774 3300005841 Bacteria 713
92 Ga0068863_101666643 3300005841 Bacteria 647
93 Ga0068858_100046044 3300005842 Bacteria 4044
94 Ga0068860_100441289 3300005843 Bacteria 1293
95 Ga0068862_100140304 3300005844 Bacteria 2144
96 Ga0075364_10444079 3300006051 Bacteria 886
97 Ga0097621_100016753 3300006237 Bacteria 5550
98 Ga0068871_100408776 3300006358 Bacteria 1210
99 Ga0075429_100638301 3300006880 Bacteria 933
100 Ga0097620_100003244 3300006931 Bacteria 16555
101 Ga0097620_100176877 3300006931 Bacteria 2216
102 Ga0097620_100176932 3300006931 Bacteria 2215
103 Ga0097620_100831856 3300006931 Bacteria 1010
104 Ga0111539_10097665 3300009094 Bacteria 3450
105 Ga0105247_10133027 3300009101 Bacteria 1623
106 Ga0105243_10444117 3300009148 Bacteria 1215
107 Ga0105248_10068070 3300009177 Bacteria 3998
108 Ga0105248_10176661 3300009177 Bacteria 2406
109 Ga0105248_10869009 3300009177 Bacteria 1018
110 Ga0105248_12319186 3300009177 Bacteria 611
111 Ga0105237_10016382 3300009545 Bacteria 7705
112 Ga0105249_10050036 3300009553 Bacteria 3811
113 Ga0105249_10810057 3300009553 Bacteria 1001
114 Ga0105239_13582960 3300010375 Bacteria 505
115 Ga0157316_1003377 3300012510 Bacteria 1149
116 Ga0157327_1003608 3300012512 Bacteria 1151
117 Ga0157373_10031079 3300013100 Bacteria 3843
118 Ga0157373_10041155 3300013100 Bacteria 3305
119 Ga0157371_10094873 3300013102 Bacteria 2114
120 Ga0157371_10148379 3300013102 Bacteria 1672
121 Ga0157378_10644687 3300013297 Bacteria 1074
122 Ga0163162_10223419 3300013306 Bacteria 2013
123 Ga0157375_10888601 3300013308 Bacteria 1036
124 Ga0163163_10158157 3300014325 Bacteria 2311
125 Ga0157380_10001659 3300014326 Bacteria 14672
126 Ga0157380_10008675 3300014326 Bacteria 7266
127 Ga0157380_10116207 3300014326 Unclassified 2258
128 Ga0157380_10890688 3300014326 Bacteria 915
129 Ga0157380_11287629 3300014326 Unclassified 778
130 Ga0157379_10001583 3300014968 Bacteria 18752
131 Ga0163161_10303581 3300017792 Bacteria 1258
132 Ga0206353_11078654 3300020082 Bacteria 2755
133 Ga0207673_1002305 3300025290 Bacteria 2165
134 Ga0207697_10000134 3300025315 Bacteria 35648
135 Ga0207656_10073773 3300025321 Bacteria 1521
136 Ga0207656_10446425 3300025321 Unclassified 653
137 Ga0207688_10479998 3300025901 Bacteria 777
138 Ga0207680_10199864 3300025903 Bacteria 1361
139 Ga0207680_10565264 3300025903 Bacteria 812
140 Ga0207647_10115155 3300025904 Bacteria 1588
141 Ga0207645_10005404 3300025907 Bacteria 9266
142 Ga0207645_10011615 3300025907 Bacteria 6006
143 Ga0207660_10478861 3300025917 Bacteria 1008
144 Ga0207662_10997381 3300025918 Bacteria 594
145 Ga0207657_10082897 3300025919 Bacteria 2691
146 Ga0207657_10405957 3300025919 Bacteria 1071
147 Ga0207649_10421179 3300025920 Bacteria 1003
148 Ga0207652_10312991 3300025921 Unclassified 1417
149 Ga0207681_10006647 3300025923 Bacteria 7100
150 Ga0207681_10174411 3300025923 Bacteria 1632
151 Ga0207681_10250977 3300025923 Bacteria 1381
152 Ga0207650_10006379 3300025925 Bacteria 8029
153 Ga0207650_10055497 3300025925 Bacteria 2941
154 Ga0207659_10020197 3300025926 Bacteria 4398
155 Ga0207644_10030370 3300025931 Bacteria 3757
156 Ga0207644_10065505 3300025931 Bacteria 2642
157 Ga0207706_10003287 3300025933 Bacteria 15471
158 Ga0207669_10005035 3300025937 Bacteria 5881
159 Ga0207669_10882383 3300025937 Bacteria 746
160 Ga0207691_10001870 3300025940 Bacteria 20575
161 Ga0207711_10124664 3300025941 Bacteria 2303
162 Ga0207711_10211248 3300025941 Bacteria 1772
163 Ga0207689_10295228 3300025942 Bacteria 1343
164 Ga0207661_11400218 3300025944 Unclassified 642
165 Ga0207679_10271816 3300025945 Bacteria 1450
166 Ga0207667_10618339 3300025949 Bacteria 1091
167 Ga0207667_10637503 3300025949 Bacteria 1072
168 Ga0207651_10303770 3300025960 Bacteria 1328
169 Ga0207712_10028633 3300025961 Bacteria 3728
170 Ga0207712_10658978 3300025961 Bacteria 910
171 Ga0207712_11577370 3300025961 Bacteria 588
172 Ga0207668_10007923 3300025972 Bacteria 6316
173 Ga0207668_10156269 3300025972 Bacteria 1772
174 Ga0207668_10156987 3300025972 Bacteria 1768
175 Ga0207668_10437701 3300025972 Bacteria 1113
176 Ga0207640_10213236 3300025981 Bacteria 1473
177 Ga0207640_11051531 3300025981 Unclassified 718
178 Ga0207658_10030302 3300025986 Bacteria 3829
179 Ga0207658_10065039 3300025986 Bacteria 2738
180 Ga0207658_10094820 3300025986 Bacteria 2323
181 Ga0207658_10433047 3300025986 Bacteria 1162
182 Ga0207639_10063309 3300026041 Bacteria 2863
183 Ga0207639_10404624 3300026041 Bacteria 1230
184 Ga0207639_11057131 3300026041 Bacteria 761
185 Ga0207678_10010463 3300026067 Bacteria 8146
186 Ga0207678_10019784 3300026067 Bacteria 5921
187 Ga0207678_11725824 3300026067 Unclassified 549
188 Ga0207708_10049371 3300026075 Bacteria 3203
189 Ga0207702_10161798 3300026078 Bacteria 2044
190 Ga0207641_10049700 3300026088 Bacteria 3544
191 Ga0207641_10946033 3300026088 Bacteria 857
192 Ga0207648_11023686 3300026089 Unclassified 774
193 Ga0207676_10480781 3300026095 Bacteria 1176
194 Ga0207674_10003022 3300026116 Bacteria 20854
195 Ga0207674_10024700 3300026116 Bacteria 6416
196 Ga0207674_10061618 3300026116 Bacteria 3790
197 Ga0207675_100010474 3300026118 Bacteria 8684
198 Ga0207675_100675300 3300026118 Bacteria 1040
199 Ga0207698_10130597 3300026142 Bacteria 2146
200 Ga0207698_10935142 3300026142 Bacteria 875
201 Ga0209967_1045541 3300027364 Bacteria 670
202 Ga0209970_1025428 3300027614 Bacteria 1015
203 Ga0207428_10225191 3300027907 Bacteria 1404
204 Ga0268266_10015278 3300028379 Bacteria 6590
205 Ga0268266_10176618 3300028379 Bacteria 1942
206 Ga0268266_11213545 3300028379 Bacteria 729
207 Ga0268265_10063006 3300028380 Bacteria 2851
208 Ga0268265_10195686 3300028380 Bacteria 1749
209 Ga0268265_10437447 3300028380 Bacteria 1218
210 Ga0268265_11992568 3300028380 Unclassified 588
211 Ga0268264_10497385 3300028381 Bacteria 1189
212 Ga0316182_1001445 3300030745 Bacteria 880
213 Ga0307408_100003878 3300031548 Bacteria 10181
214 Ga0307408_100019987 3300031548 Bacteria 4513
215 Ga0307408_100450434 3300031548 Bacteria 1116
216 Ga0307408_100505336 3300031548 Bacteria 1059
217 Ga0307408_100548899 3300031548 Bacteria 1019
218 Ga0307408_100563167 3300031548 Bacteria 1007
219 Ga0307408_101728110 3300031548 Bacteria 597
220 Ga0307405_10003570 3300031731 Bacteria 7178
221 Ga0307405_10066515 3300031731 Bacteria 2298
222 Ga0307405_10103189 3300031731 Bacteria 1917
223 Ga0307405_10148855 3300031731 Bacteria 1643
224 Ga0307405_10212824 3300031731 Bacteria 1412
225 Ga0307405_10395616 3300031731 Bacteria 1080
226 Ga0307405_10417482 3300031731 Bacteria 1055
227 Ga0307405_10472353 3300031731 Bacteria 999
228 Ga0307413_10029787 3300031824 Bacteria 3059
229 Ga0307413_10050073 3300031824 Bacteria 2507
230 Ga0307413_10071988 3300031824 Bacteria 2180
231 Ga0307413_10125080 3300031824 Bacteria 1749
232 Ga0307413_10271582 3300031824 Bacteria 1270
233 Ga0307413_10353945 3300031824 Bacteria 1134
234 Ga0307413_11352917 3300031824 Bacteria 625
235 Ga0307410_10018880 3300031852 Bacteria 4179
236 Ga0307410_10035716 3300031852 Bacteria 3230
237 Ga0307410_10071681 3300031852 Bacteria 2403
238 Ga0307406_10003759 3300031901 Bacteria 8254
239 Ga0307406_10017291 3300031901 Bacteria 4199
240 Ga0307406_10110423 3300031901 Bacteria 1892
241 Ga0307406_10113026 3300031901 Bacteria 1873
242 Ga0307406_10423767 3300031901 Bacteria 1061
243 Ga0307406_10709224 3300031901 Bacteria 841
244 Ga0307406_10869525 3300031901 Bacteria 765
245 Ga0307407_10002642 3300031903 Bacteria 7086
246 Ga0307407_10078566 3300031903 Bacteria 1988
247 Ga0307407_10497726 3300031903 Bacteria 893
248 Ga0307412_10005165 3300031911 Bacteria 7312
249 Ga0307412_10005206 3300031911 Bacteria 7290
250 Ga0307412_10010602 3300031911 Bacteria 5312
251 Ga0307412_10167287 3300031911 Bacteria 1640
252 Ga0307412_10186464 3300031911 Bacteria 1565
253 Ga0307412_10417050 3300031911 Bacteria 1097
254 Ga0307412_11476714 3300031911 Bacteria 617
255 Ga0307409_100054725 3300031995 Bacteria 3075
256 Ga0307409_100193097 3300031995 Bacteria 1814
257 Ga0307409_100273830 3300031995 Bacteria 1556
258 Ga0307409_100381884 3300031995 Bacteria 1339
259 Ga0307409_101264261 3300031995 Bacteria 762
260 Ga0307416_100010954 3300032002 Bacteria 6017
261 Ga0307416_100041711 3300032002 Bacteria 3576
262 Ga0307416_100068321 3300032002 Bacteria 2936
263 Ga0307416_100082731 3300032002 Bacteria 2720
264 Ga0307416_100179381 3300032002 Bacteria 1983
265 Ga0307416_100530986 3300032002 Bacteria 1247
266 Ga0307416_100942220 3300032002 Bacteria 965
267 Ga0307416_101092190 3300032002 Bacteria 902
268 Ga0307416_101853048 3300032002 Bacteria 707
269 Ga0307414_10003906 3300032004 Bacteria 8032
270 Ga0307414_10024327 3300032004 Bacteria 3861
271 Ga0307414_10025961 3300032004 Bacteria 3762
272 Ga0307414_10041185 3300032004 Bacteria 3126
273 Ga0307414_10201965 3300032004 Bacteria 1617
274 Ga0307414_10371072 3300032004 Bacteria 1234
275 Ga0307414_10925775 3300032004 Bacteria 800
276 Ga0307414_11123585 3300032004 Bacteria 726
277 Ga0307414_11250187 3300032004 Bacteria 688
278 Ga0307414_11587956 3300032004 Bacteria 609
279 Ga0307411_10029962 3300032005 Bacteria 3330
280 Ga0307411_10033022 3300032005 Bacteria 3205
281 Ga0307411_10085341 3300032005 Bacteria 2187
282 Ga0307411_10231670 3300032005 Bacteria 1440
283 Ga0307411_10306876 3300032005 Bacteria 1275
284 Ga0307411_10865612 3300032005 Bacteria 800
285 Ga0307411_11139385 3300032005 Bacteria 705
286 Ga0307415_100021595 3300032126 Bacteria 3960
287 Ga0307415_100071587 3300032126 Bacteria 2439
288 Ga0307415_100210473 3300032126 Bacteria 1551
289 Ga0307415_100276938 3300032126 Bacteria 1377
290 Ga0307415_100374034 3300032126 Bacteria 1207
291 Ga0307415_101140514 3300032126 Bacteria 732
292 Ga0307415_101718893 3300032126 Bacteria 605
293 Ga0395905_0055906 3300037471 Bacteria 3694
294 Ga0395905_0128546 3300037471 Bacteria 2383
295 Ga0395905_0580053 3300037471 Bacteria 1023
296 Ga0395901_0156698 3300038443 Bacteria 2392
297 Ga0439453_0030153 3300041408 Bacteria 1024
298 Ga0439461_0118559 3300041410 Bacteria 660
299 Ga0439445_0000342 3300042004 Bacteria 9189
300 Ga0439448_0097354 3300042005 Bacteria 998
301 Ga0439432_216701 3300042006 Bacteria 553
302 Ga0439452_130742 3300042010 Bacteria 532
303 Ga0450920_130256 3300042122 Unclassified 530
304 Ga0450898_008184 3300042134 Bacteria 1643
305 Ga0439434_0113483 3300042435 Bacteria 879
306 Ga0439435_0052090 3300042436 Bacteria 1174
307 Ga0450916_028195 3300042530 Bacteria 806
308 Ga0466971_0106670 3300044719 Bacteria 1291
309 Ga0495605_0277558 3300046474 Bacteria 713
310 Ga0495606_0384394 3300046507 Bacteria 735
311 Ga0495620_0232243 3300046515 Bacteria 705
312 Ga0495663_0020445 3300046525 Bacteria 1900
313 Ga0495663_0037314 3300046525 Bacteria 1465
314 Ga0495663_0095364 3300046525 Bacteria 974
315 Ga0495663_0137129 3300046525 Bacteria 828
316 Ga0495663_0152377 3300046525 Bacteria 789
317 Ga0495642_0145799 3300046528 Bacteria 1023
318 Ga0495642_0176634 3300046528 Bacteria 929
319 Ga0495598_0032378 3300046537 Bacteria 1477
320 Ga0495621_0012785 3300046539 Bacteria 2623
321 Ga0495621_0017293 3300046539 Bacteria 2328
322 Ga0495621_0078501 3300046539 Bacteria 1227
323 Ga0495633_0209333 3300046558 Bacteria 894
324 Ga0495668_0126748 3300046616 Bacteria 1397
325 Ga0495625_0266575 3300046660 Bacteria 1107
326 Ga0495659_0016165 3300046664 Bacteria 2460
327 Ga0495669_0000256 3300046684 Bacteria 30798
328 Ga0495669_0007126 3300046684 Bacteria 4684
329 Ga0495669_0011605 3300046684 Bacteria 3744
330 Ga0495669_0013417 3300046684 Bacteria 3490
331 Ga0495669_0115030 3300046684 Bacteria 1258
332 Ga0495669_0216038 3300046684 Bacteria 918
333 Ga0495670_0022026 3300046691 Bacteria 3146
334 Ga0495670_0069615 3300046691 Bacteria 1779
335 Ga0495670_0340676 3300046691 Bacteria 806
336 Ga0495670_0415619 3300046691 Bacteria 727
337 Ga0495671_0183015 3300046692 Bacteria 1018
338 Ga0495677_0034084 3300047445 Bacteria 1857
339 Ga0495677_0034263 3300047445 Bacteria 1852
340 Ga0495677_0180428 3300047445 Bacteria 818
341 Ga0495685_036518 3300047447 Bacteria 1687
342 Ga0495681_0124886 3300047470 Bacteria 1101
343 Ga0495686_0183841 3300047472 Bacteria 1209
344 Ga0496101_0187572 3300048904 Bacteria 1595
345 Ga0496102_0012425 3300048905 Bacteria 7368
346 Ga0496102_0974664 3300048905 Bacteria 769
347 Ga0496105_0235866 3300048908 Bacteria 1485
348 Ga0496106_0055305 3300048909 Bacteria 2999
349 Ga0496106_0536821 3300048909 Bacteria 939
350 Ga0496107_0072207 3300048910 Bacteria 2509
351 Ga0496107_0124737 3300048910 Bacteria 1898
352 Ga0496108_0017954 3300048911 Bacteria 5788
353 Ga0496109_0040440 3300048912 Bacteria 4223
354 Ga0496110_0006018 3300048913 Bacteria 9554
355 Ga0496111_0003677 3300048914 Bacteria 9525
356 Ga0496112_0081682 3300048915 Bacteria 3196
357 Ga0496113_0055817 3300048916 Bacteria 2962
358 Ga0501036_1284698 3300049572 Bacteria 595
359 nmdc:mga00v17_252630_c1 3300050491 Bacteria 1143
360 nmdc:mga08y16_79842_c1 3300050511 Bacteria 3410
361 nmdc:mga0n895_480997_c1 3300050512 Bacteria 1252
362 Ga0500643_003098 3300053087 Bacteria 8162
363 Ga0500643_007515 3300053087 Bacteria 4379
364 Ga0587080_104097 3300059503 Unclassified 611
365 Ga0587090_067325 3300059510 Bacteria 692
366 Ga0587091_189952 3300059511 Unclassified 545
367 Ga0587094_122829 3300059513 Unclassified 522
368 Ga0587098_077679 3300059604 Unclassified 548
369 2885429353 2885427238 Bacteria 2291351
370 Ga0495686_0233714
371 JGI24752J21851_1011019
372 JGI24752J21851_1020805
373 JGI24746J21847_1003180
374 JGI24750J21931_1018156
375 JGI24748J21848_1015431
376 JGI24749J21850_1023838
377 JGI24742J22300_10012441
378 Ga0065712_10169366
379 Ga0065715_10000291
380 Ga0065715_10125960
381 Ga0065715_10280589
382 Ga0065707_10207801
383 Ga0065707_10297905
384 Ga0065707_10401845
385 Ga0070676_10004307
386 Ga0070676_10017635
387 Ga0070676_10264019
388 Ga0070683_101868844
389 Ga0070690_100413421
390 Ga0070670_100018070
391 Ga0070677_10318606
392 Ga0070680_100579497
393 Ga0068868_100353651
394 Ga0070660_100063665
395 Ga0070660_100296146
396 Ga0070689_100676166
397 Ga0070689_101502159
398 Ga0070661_101048883
399 Ga0070692_10136784
400 Ga0070668_100022474
401 Ga0070668_100121671
402 Ga0070669_100006898
403 Ga0070669_100075187
404 Ga0070669_100089055
405 Ga0070675_100004774
406 Ga0070671_100010695
407 Ga0070671_100161728
408 Ga0070671_100718039
409 Ga0070674_100060897
410 Ga0070674_101184155
411 Ga0070673_100005467
412 Ga0070673_100280055
413 Ga0070667_100002393
414 Ga0070667_100095112
415 Ga0070667_100132486
416 Ga0070667_100168612
417 Ga0070701_10093834
418 Ga0070700_100559452
419 Ga0070663_100048361
420 Ga0070663_100107654
421 Ga0070662_100002356
422 Ga0070681_10200887
423 Ga0068867_100016865
424 Ga0068867_100289764
425 Ga0068867_100446310
426 Ga0070685_10277262
427 Ga0070679_100490629
428 Ga0068853_100309231
429 Ga0068853_100487266
430 Ga0068853_100782705
431 Ga0070672_100011726
432 Ga0070693_100029636
433 Ga0070693_100323594
434 Ga0070665_100004875
435 Ga0070665_100918601
436 Ga0068855_100182444
437 Ga0070664_100006576
438 Ga0070664_100433087
439 Ga0068857_100010349
440 Ga0068857_100062816
441 Ga0068857_100307325
442 Ga0068854_100026240
443 Ga0068854_100103504
444 Ga0068854_100328231
445 Ga0068856_100016476
446 Ga0068856_100354103
447 Ga0068852_100579153
448 Ga0068852_100580853
449 Ga0068852_102626785
450 Ga0068859_100003244
451 Ga0068859_100176874
452 Ga0068859_100176927
453 Ga0068859_100831903
454 Ga0068864_100012608
455 Ga0068864_100482648
456 Ga0068861_100003911
457 Ga0068851_10013729
458 Ga0068851_10066459
459 Ga0068863_100079338
460 Ga0068863_101377774
461 Ga0068863_101666643
462 Ga0068858_100046044
463 Ga0068860_100441289
464 Ga0068862_100140304
465 Ga0075364_10444079
466 Ga0097621_100016753
467 Ga0068871_100408776
468 Ga0075429_100638301
469 Ga0097620_100003244
470 Ga0097620_100176877
471 Ga0097620_100176932
472 Ga0097620_100831856
473 Ga0111539_10097665
474 Ga0105247_10133027
475 Ga0105243_10444117
476 Ga0105248_10068070
477 Ga0105248_10176661
478 Ga0105248_10869009
479 Ga0105248_12319186
480 Ga0105237_10016382
481 Ga0105249_10050036
482 Ga0105249_10810057
483 Ga0105239_13582960
484 Ga0157316_1003377
485 Ga0157327_1003608
486 Ga0157373_10031079
487 Ga0157373_10041155
488 Ga0157371_10094873
489 Ga0157371_10148379
490 Ga0157378_10644687
491 Ga0163162_10223419
492 Ga0157375_10888601
493 Ga0163163_10158157
494 Ga0157380_10001659
495 Ga0157380_10008675
496 Ga0157380_10116207
497 Ga0157380_10890688
498 Ga0157380_11287629
499 Ga0157379_10001583
500 Ga0163161_10303581
501 Ga0206353_11078654
502 Ga0207673_1002305
503 Ga0207697_10000134
504 Ga0207656_10073773
505 Ga0207656_10446425
506 Ga0207688_10479998
507 Ga0207680_10199864
508 Ga0207680_10565264
509 Ga0207647_10115155
510 Ga0207645_10005404
511 Ga0207645_10011615
512 Ga0207660_10478861
513 Ga0207662_10997381
514 Ga0207657_10082897
515 Ga0207657_10405957
516 Ga0207649_10421179
517 Ga0207652_10312991
518 Ga0207681_10006647
519 Ga0207681_10174411
520 Ga0207681_10250977
521 Ga0207650_10006379
522 Ga0207650_10055497
523 Ga0207659_10020197
524 Ga0207644_10030370
525 Ga0207644_10065505
526 Ga0207706_10003287
527 Ga0207669_10005035
528 Ga0207669_10882383
529 Ga0207691_10001870
530 Ga0207711_10124664
531 Ga0207711_10211248
532 Ga0207689_10295228
533 Ga0207661_11400218
534 Ga0207679_10271816
535 Ga0207667_10618339
536 Ga0207667_10637503
537 Ga0207651_10303770
538 Ga0207712_10028633
539 Ga0207712_10658978
540 Ga0207712_11577370
541 Ga0207668_10007923
542 Ga0207668_10156269
543 Ga0207668_10156987
544 Ga0207668_10437701
545 Ga0207640_10213236
546 Ga0207640_11051531
547 Ga0207658_10030302
548 Ga0207658_10065039
549 Ga0207658_10094820
550 Ga0207658_10433047
551 Ga0207639_10063309
552 Ga0207639_10404624
553 Ga0207639_11057131
554 Ga0207678_10010463
555 Ga0207678_10019784
556 Ga0207678_11725824
557 Ga0207708_10049371
558 Ga0207702_10161798
559 Ga0207641_10049700
560 Ga0207641_10946033
561 Ga0207648_11023686
562 Ga0207676_10480781
563 Ga0207674_10003022
564 Ga0207674_10024700
565 Ga0207674_10061618
566 Ga0207675_100010474
567 Ga0207675_100675300
568 Ga0207698_10130597
569 Ga0207698_10935142
570 Ga0209967_1045541
571 Ga0209970_1025428
572 Ga0207428_10225191
573 Ga0268266_10015278
574 Ga0268266_10176618
575 Ga0268266_11213545
576 Ga0268265_10063006
577 Ga0268265_10195686
578 Ga0268265_10437447
579 Ga0268265_11992568
580 Ga0268264_10497385
581 Ga0316182_1001445
582 Ga0307408_100003878
583 Ga0307408_100019987
584 Ga0307408_100450434
585 Ga0307408_100505336
586 Ga0307408_100548899
587 Ga0307408_100563167
588 Ga0307408_101728110
589 Ga0307405_10003570
590 Ga0307405_10066515
591 Ga0307405_10103189
592 Ga0307405_10148855
593 Ga0307405_10212824
594 Ga0307405_10395616
595 Ga0307405_10417482
596 Ga0307405_10472353
597 Ga0307413_10029787
598 Ga0307413_10050073
599 Ga0307413_10071988
600 Ga0307413_10125080
601 Ga0307413_10271582
602 Ga0307413_10353945
603 Ga0307413_11352917
604 Ga0307410_10018880
605 Ga0307410_10035716
606 Ga0307410_10071681
607 Ga0307406_10003759
608 Ga0307406_10017291
609 Ga0307406_10110423
610 Ga0307406_10113026
611 Ga0307406_10423767
612 Ga0307406_10709224
613 Ga0307406_10869525
614 Ga0307407_10002642
615 Ga0307407_10078566
616 Ga0307407_10497726
617 Ga0307412_10005165
618 Ga0307412_10005206
619 Ga0307412_10010602
620 Ga0307412_10167287
621 Ga0307412_10186464
622 Ga0307412_10417050
623 Ga0307412_11476714
624 Ga0307409_100054725
625 Ga0307409_100193097
626 Ga0307409_100273830
627 Ga0307409_100381884
628 Ga0307409_101264261
629 Ga0307416_100010954
630 Ga0307416_100041711
631 Ga0307416_100068321
632 Ga0307416_100082731
633 Ga0307416_100179381
634 Ga0307416_100530986
635 Ga0307416_100942220
636 Ga0307416_101092190
637 Ga0307416_101853048
638 Ga0307414_10003906
639 Ga0307414_10024327
640 Ga0307414_10025961
641 Ga0307414_10041185
642 Ga0307414_10201965
643 Ga0307414_10371072
644 Ga0307414_10925775
645 Ga0307414_11123585
646 Ga0307414_11250187
647 Ga0307414_11587956
648 Ga0307411_10029962
649 Ga0307411_10033022
650 Ga0307411_10085341
651 Ga0307411_10231670
652 Ga0307411_10306876
653 Ga0307411_10865612
654 Ga0307411_11139385
655 Ga0307415_100021595
656 Ga0307415_100071587
657 Ga0307415_100210473
658 Ga0307415_100276938
659 Ga0307415_100374034
660 Ga0307415_101140514
661 Ga0307415_101718893
662 Ga0395905_0055906
663 Ga0395905_0128546
664 Ga0395905_0580053
665 Ga0395901_0156698
666 Ga0439453_0030153
667 Ga0439461_0118559
668 Ga0439445_0000342
669 Ga0439448_0097354
670 Ga0439432_216701
671 Ga0439452_130742
672 Ga0450920_130256
673 Ga0450898_008184
674 Ga0439434_0113483
675 Ga0439435_0052090
676 Ga0450916_028195
677 Ga0466971_0106670
678 Ga0495605_0277558
679 Ga0495606_0384394
680 Ga0495620_0232243
681 Ga0495663_0020445
682 Ga0495663_0037314
683 Ga0495663_0095364
684 Ga0495663_0137129
685 Ga0495663_0152377
686 Ga0495642_0145799
687 Ga0495642_0176634
688 Ga0495598_0032378
689 Ga0495621_0012785
690 Ga0495621_0017293
691 Ga0495621_0078501
692 Ga0495633_0209333
693 Ga0495668_0126748
694 Ga0495625_0266575
695 Ga0495659_0016165
696 Ga0495669_0000256
697 Ga0495669_0007126
698 Ga0495669_0011605
699 Ga0495669_0013417
700 Ga0495669_0115030
701 Ga0495669_0216038
702 Ga0495670_0022026
703 Ga0495670_0069615
704 Ga0495670_0340676
705 Ga0495670_0415619
706 Ga0495671_0183015
707 Ga0495677_0034084
708 Ga0495677_0034263
709 Ga0495677_0180428
710 Ga0495685_036518
711 Ga0495681_0124886
712 Ga0495686_0183841
713 Ga0496101_0187572
714 Ga0496102_0012425
715 Ga0496102_0974664
716 Ga0496105_0235866
717 Ga0496106_0055305
718 Ga0496106_0536821
719 Ga0496107_0072207
720 Ga0496107_0124737
721 Ga0496108_0017954
722 Ga0496109_0040440
723 Ga0496110_0006018
724 Ga0496111_0003677
725 Ga0496112_0081682
726 Ga0496113_0055817
727 Ga0501036_1284698
728 nmdc:mga00v17_252630_c1
729 nmdc:mga08y16_79842_c1
730 nmdc:mga0n895_480997_c1
731 Ga0500643_003098
732 Ga0500643_007515
733 Ga0587080_104097
734 Ga0587090_067325
735 Ga0587091_189952
736 Ga0587094_122829
737 Ga0587098_077679
738 2885429353

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04355

SmpA_OmlA

SmpA / OmlA family

30

106

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ttc-assembly1.cif.gz_E bamabcde bound to substrate espp 0.841 23 105
5ayw-assembly1.cif.gz_E structure of a membrane complex 0.8208 24 105
7ri9-assembly1.cif.gz_E the structure of bam in msp1e3d1 at 6.9 angstrom resolution 0.8195 21 105
6sn5-assembly1.cif.gz_E bamabcde in msp1d1 nanodisc ensemble 0-5 0.8173 23 106
7rj5-assembly1.cif.gz_E the structure of bam in complex with espp at 7 angstrom resolution 0.7899 26 105
ID Description Score Start End Superfamily
af_A0A0R0GAI4_122_194_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8612 85 106 3.30.420.10
af_A0A0R0JRC5_62_140_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8488 85 106 3.30.420.10
af_A0A0R0FFF4_166_290_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8405 85 107 3.30.420.10
af_Q9SF52_332_460_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8282 84 106 3.30.420.10
af_A0A0R0JI29_34_159_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8205 85 107 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A7Z9VFU2-F1-model_v4 Outer membrane protein assembly factor BamE 0.9379 16 101 GO:0030674
GO:0043165
GO:0051205
GO:1990063
AF-A0A2S6RH43-F1-model_v4 Outer membrane protein assembly factor BamE domain-containing protein 0.9297 18 107 GO:0019867
AF-A0A4Q3BQF9-F1-model_v4 Outer membrane protein assembly factor BamE 0.9277 17 115 GO:0009279
AF-A0A257JAT6-F1-model_v4 Cell envelope protein SmpA 0.9191 16 113 GO:0019867
AF-A0A2E3P4C5-F1-model_v4 Outer membrane protein assembly factor BamE domain-containing protein 0.9095 16 110 GO:0030674
GO:0043165
GO:0051205
GO:1990063

Map