F425065

General Info

Members Datasets Scaffolds Average Seq Length
369 186 738 143

Family's Representative Sequence

Representative Sequence 3300025923|Ga0207681_10916733|Ga0207681_109167331
Length 165
Sequence VSREEAASRSEFRHWRRFTTRWADNDAYGHVNNTVFYQWFDSAVNAWMVEQGMLDIEAGDPIALVVETRCSYFTPLQFPQDVEVGLRAAELGRSSIRYRIGIFGKNDNAAAHGEFVHVVVDRQSRRPVEIPSDCSFIRASRASETSEPVAIRISFGVPPSASART

Samples

Sample ID Description Type Environment
1 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
73 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
120 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
121 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
122 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
123 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
124 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
125 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
128 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
129 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
130 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
131 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
132 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
133 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
134 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
136 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
137 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
138 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
139 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
140 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
141 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
142 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
143 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
144 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
145 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
146 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
147 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
148 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
149 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
150 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
151 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
152 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
153 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
154 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
155 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
156 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
157 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
158 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
159 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
162 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
163 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
164 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
165 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
166 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
167 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
168 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
169 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
170 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
171 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
172 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
173 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
174 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
175 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
176 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
177 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
178 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
179 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
180 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
181 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
182 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
183 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
184 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
185 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
186 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.79
Rhizosphere 95.39
Stem 0
Stem Tuber 0
Unclassified 2.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207681_10916733 3300025923 Unclassified 734
2 JGI24737J22298_10019797 3300001990 Bacteria 2152
3 JGI24738J21930_10041079 3300002075 Bacteria 940
4 JGI24744J21845_10005952 3300002077 Bacteria 2529
5 rootH1_10214486 3300003323 Bacteria 2622
6 Ga0065715_10175360 3300005293 Bacteria 1516
7 Ga0070658_10034584 3300005327 Bacteria 4066
8 Ga0070658_10851535 3300005327 Bacteria 792
9 Ga0070676_10082893 3300005328 Bacteria 1949
10 Ga0070676_10209770 3300005328 Bacteria 1281
11 Ga0070683_100159506 3300005329 Bacteria 2139
12 Ga0070690_100008918 3300005330 Bacteria 5792
13 Ga0070670_100059168 3300005331 Bacteria 3289
14 Ga0070670_100071926 3300005331 Bacteria 2970
15 Ga0070670_100413150 3300005331 Bacteria 1192
16 Ga0070677_10140694 3300005333 Bacteria 1113
17 Ga0068869_100219311 3300005334 Bacteria 1507
18 Ga0068869_100296164 3300005334 Bacteria 1305
19 Ga0068869_100791267 3300005334 Bacteria 814
20 Ga0068869_100871970 3300005334 Bacteria 777
21 Ga0070666_10096928 3300005335 Bacteria 2030
22 Ga0070666_10211098 3300005335 Bacteria 1367
23 Ga0068868_100006268 3300005338 Bacteria 8413
24 Ga0068868_100014141 3300005338 Bacteria 5877
25 Ga0068868_100109801 3300005338 Bacteria 2240
26 Ga0068868_101325208 3300005338 Bacteria 669
27 Ga0068868_101675295 3300005338 Bacteria 599
28 Ga0070660_100119836 3300005339 Bacteria 2099
29 Ga0070660_100191188 3300005339 Bacteria 1658
30 Ga0070660_100228870 3300005339 Bacteria 1512
31 Ga0070660_100366647 3300005339 Bacteria 1188
32 Ga0070660_100622218 3300005339 Bacteria 903
33 Ga0070689_100117779 3300005340 Bacteria 2119
34 Ga0070687_100032639 3300005343 Bacteria 2563
35 Ga0070661_100035502 3300005344 Bacteria 3620
36 Ga0070661_100334298 3300005344 Bacteria 1185
37 Ga0070661_100619868 3300005344 Bacteria 876
38 Ga0070692_10301972 3300005345 Bacteria 978
39 Ga0070668_100633698 3300005347 Bacteria 938
40 Ga0070669_101113578 3300005353 Unclassified 680
41 Ga0070675_100005465 3300005354 Bacteria 9724
42 Ga0070675_100020151 3300005354 Bacteria 5321
43 Ga0070671_100054554 3300005355 Bacteria 3323
44 Ga0070671_100055692 3300005355 Bacteria 3289
45 Ga0070671_100412282 3300005355 Bacteria 1156
46 Ga0070671_100542361 3300005355 Bacteria 1003
47 Ga0070674_100030016 3300005356 Bacteria 3590
48 Ga0070674_100900600 3300005356 Bacteria 770
49 Ga0070673_100001556 3300005364 Bacteria 13518
50 Ga0070673_100016507 3300005364 Bacteria 5223
51 Ga0070673_100204797 3300005364 Bacteria 1701
52 Ga0070659_100134273 3300005366 Bacteria 2012
53 Ga0070659_100151263 3300005366 Bacteria 1893
54 Ga0070659_100658956 3300005366 Bacteria 903
55 Ga0070659_101119018 3300005366 Bacteria 694
56 Ga0070667_100008190 3300005367 Bacteria 8664
57 Ga0070713_100380906 3300005436 Bacteria 1314
58 Ga0070663_100434584 3300005455 Bacteria 1079
59 Ga0070678_100145961 3300005456 Bacteria 1899
60 Ga0070662_100020139 3300005457 Bacteria 4539
61 Ga0070662_100045561 3300005457 Bacteria 3148
62 Ga0070662_100067946 3300005457 Bacteria 2618
63 Ga0070662_100903499 3300005457 Bacteria 753
64 Ga0070662_101908879 3300005457 Bacteria 513
65 Ga0068867_100272082 3300005459 Bacteria 1385
66 Ga0070685_10098950 3300005466 Bacteria 1778
67 Ga0070679_100163430 3300005530 Bacteria 2200
68 Ga0068853_100058741 3300005539 Bacteria 3321
69 Ga0068853_100290415 3300005539 Bacteria 1509
70 Ga0070672_100106051 3300005543 Bacteria 2285
71 Ga0070693_100128018 3300005547 Bacteria 1583
72 Ga0070665_100024564 3300005548 Bacteria 6072
73 Ga0068855_101234477 3300005563 Bacteria 776
74 Ga0068855_101384435 3300005563 Bacteria 725
75 Ga0070664_100008081 3300005564 Bacteria 8503
76 Ga0070664_100297227 3300005564 Bacteria 1458
77 Ga0070664_100426706 3300005564 Bacteria 1215
78 Ga0070664_100598577 3300005564 Bacteria 1022
79 Ga0068854_100044447 3300005578 Bacteria 3153
80 Ga0068852_100131388 3300005616 Bacteria 2306
81 Ga0068852_100325606 3300005616 Bacteria 1494
82 Ga0068852_101175209 3300005616 Bacteria 788
83 Ga0068859_100172336 3300005617 Bacteria 2245
84 Ga0068859_100198612 3300005617 Bacteria 2090
85 Ga0068864_100001115 3300005618 Bacteria 22458
86 Ga0068864_101734318 3300005618 Bacteria 629
87 Ga0068866_10073690 3300005718 Bacteria 1813
88 Ga0068851_10118806 3300005834 Bacteria 1419
89 Ga0068851_10233469 3300005834 Bacteria 1038
90 Ga0068870_10355688 3300005840 Bacteria 941
91 Ga0068863_100328434 3300005841 Unclassified 1487
92 Ga0068863_101602831 3300005841 Unclassified 660
93 Ga0068858_100037977 3300005842 Bacteria 4466
94 Ga0070712_100011803 3300006175 Bacteria 5552
95 Ga0097621_100432368 3300006237 Bacteria 1183
96 Ga0068871_100593456 3300006358 Bacteria 1007
97 Ga0068865_100550277 3300006881 Bacteria 969
98 Ga0097620_100172338 3300006931 Bacteria 2245
99 Ga0097620_100198606 3300006931 Bacteria 2090
100 Ga0105245_10044198 3300009098 Bacteria 3975
101 Ga0105245_10363192 3300009098 Bacteria 1437
102 Ga0105242_10621312 3300009176 Bacteria 1047
103 Ga0105248_10015208 3300009177 Bacteria 8480
104 Ga0105248_10029128 3300009177 Bacteria 6157
105 Ga0105248_10080139 3300009177 Bacteria 3669
106 Ga0105248_10187569 3300009177 Bacteria 2330
107 Ga0105248_10226487 3300009177 Bacteria 2104
108 Ga0105238_11115410 3300009551 Bacteria 812
109 Ga0105238_12743886 3300009551 Unclassified 529
110 Ga0157327_1015216 3300012512 Bacteria 797
111 Ga0157371_10067015 3300013102 Bacteria 2542
112 Ga0157369_10120900 3300013105 Bacteria 2779
113 Ga0157369_10715615 3300013105 Bacteria 1031
114 Ga0157374_10002080 3300013296 Bacteria 16850
115 Ga0157374_10352899 3300013296 Bacteria 1462
116 Ga0157374_10622226 3300013296 Bacteria 1090
117 Ga0157374_10699263 3300013296 Bacteria 1027
118 Ga0157378_10261331 3300013297 Bacteria 1661
119 Ga0157378_10311255 3300013297 Bacteria 1527
120 Ga0157378_10466617 3300013297 Bacteria 1256
121 Ga0163162_10068635 3300013306 Bacteria 3597
122 Ga0157372_10031190 3300013307 Bacteria 5836
123 Ga0157375_10004032 3300013308 Bacteria 12740
124 Ga0157375_10073288 3300013308 Bacteria 3443
125 Ga0157375_10784622 3300013308 Bacteria 1102
126 Ga0157375_13270783 3300013308 Unclassified 540
127 Ga0157380_10774627 3300014326 Bacteria 973
128 Ga0157377_10155845 3300014745 Bacteria 1416
129 Ga0157379_10020585 3300014968 Bacteria 5836
130 Ga0157376_10926794 3300014969 Bacteria 890
131 Ga0213876_10014519 3300021384 Bacteria 4173
132 Ga0207697_10007965 3300025315 Bacteria 4680
133 Ga0207697_10094986 3300025315 Bacteria 1266
134 Ga0207682_10110231 3300025893 Bacteria 1211
135 Ga0207642_10054397 3300025899 Bacteria 1826
136 Ga0207642_10074126 3300025899 Bacteria 1630
137 Ga0207688_10000929 3300025901 Bacteria 14801
138 Ga0207680_10056295 3300025903 Bacteria 2374
139 Ga0207680_10062236 3300025903 Bacteria 2279
140 Ga0207680_10424352 3300025903 Bacteria 942
141 Ga0207647_10015127 3300025904 Bacteria 5300
142 Ga0207647_10018323 3300025904 Bacteria 4738
143 Ga0207647_10040343 3300025904 Bacteria 2941
144 Ga0207645_10051825 3300025907 Bacteria 2622
145 Ga0207705_10121160 3300025909 Bacteria 1941
146 Ga0207705_10289532 3300025909 Bacteria 1255
147 Ga0207654_10972575 3300025911 Bacteria 617
148 Ga0207693_10353425 3300025915 Bacteria 1150
149 Ga0207660_10127343 3300025917 Bacteria 1935
150 Ga0207662_10026295 3300025918 Bacteria 3356
151 Ga0207662_10118901 3300025918 Bacteria 1655
152 Ga0207657_10047304 3300025919 Bacteria 3763
153 Ga0207657_10158027 3300025919 Bacteria 1842
154 Ga0207657_10297137 3300025919 Bacteria 1280
155 Ga0207657_10516674 3300025919 Bacteria 935
156 Ga0207657_10773566 3300025919 Bacteria 743
157 Ga0207657_10820916 3300025919 Bacteria 718
158 Ga0207657_10824918 3300025919 Bacteria 716
159 Ga0207649_10067306 3300025920 Bacteria 2273
160 Ga0207649_10410628 3300025920 Bacteria 1015
161 Ga0207652_10970125 3300025921 Bacteria 748
162 Ga0207652_11365104 3300025921 Bacteria 612
163 Ga0207681_10504689 3300025923 Bacteria 991
164 Ga0207650_10031562 3300025925 Bacteria 3827
165 Ga0207650_10149065 3300025925 Bacteria 1845
166 Ga0207650_10257869 3300025925 Bacteria 1413
167 Ga0207650_10513848 3300025925 Bacteria 1002
168 Ga0207659_10016559 3300025926 Bacteria 4799
169 Ga0207659_10144343 3300025926 Bacteria 1851
170 Ga0207687_10065993 3300025927 Bacteria 2571
171 Ga0207687_11418527 3300025927 Bacteria 597
172 Ga0207700_10822111 3300025928 Bacteria 831
173 Ga0207644_10015901 3300025931 Bacteria 5059
174 Ga0207644_10056500 3300025931 Bacteria 2832
175 Ga0207644_10969976 3300025931 Bacteria 713
176 Ga0207690_10215898 3300025932 Bacteria 1465
177 Ga0207690_10922767 3300025932 Bacteria 725
178 Ga0207690_11073994 3300025932 Bacteria 671
179 Ga0207690_11516588 3300025932 Bacteria 560
180 Ga0207706_10017444 3300025933 Bacteria 6468
181 Ga0207706_10032357 3300025933 Bacteria 4658
182 Ga0207706_10057190 3300025933 Bacteria 3437
183 Ga0207706_10137865 3300025933 Bacteria 2146
184 Ga0207706_10326974 3300025933 Bacteria 1334
185 Ga0207686_10804753 3300025934 Bacteria 753
186 Ga0207670_10129054 3300025936 Bacteria 1849
187 Ga0207669_10027672 3300025937 Bacteria 3108
188 Ga0207669_10175216 3300025937 Bacteria 1531
189 Ga0207704_10520666 3300025938 Bacteria 962
190 Ga0207691_10085899 3300025940 Bacteria 2824
191 Ga0207691_10452909 3300025940 Bacteria 1092
192 Ga0207711_10065147 3300025941 Bacteria 3149
193 Ga0207711_10072309 3300025941 Bacteria 2996
194 Ga0207711_10075468 3300025941 Bacteria 2934
195 Ga0207711_10131265 3300025941 Bacteria 2246
196 Ga0207689_10336138 3300025942 Bacteria 1254
197 Ga0207689_10839465 3300025942 Bacteria 775
198 Ga0207679_10004438 3300025945 Bacteria 8740
199 Ga0207679_10338376 3300025945 Bacteria 1308
200 Ga0207679_10866493 3300025945 Bacteria 825
201 Ga0207667_10508314 3300025949 Bacteria 1221
202 Ga0207651_10146572 3300025960 Bacteria 1831
203 Ga0207651_10210215 3300025960 Bacteria 1565
204 Ga0207668_10055982 3300025972 Bacteria 2745
205 Ga0207668_10553088 3300025972 Bacteria 997
206 Ga0207640_10050010 3300025981 Bacteria 2710
207 Ga0207640_10067163 3300025981 Bacteria 2398
208 Ga0207640_10691180 3300025981 Bacteria 873
209 Ga0207658_10006321 3300025986 Bacteria 8091
210 Ga0207658_10114126 3300025986 Bacteria 2141
211 Ga0207658_10592024 3300025986 Bacteria 996
212 Ga0207658_11388162 3300025986 Bacteria 643
213 Ga0207677_10000918 3300026023 Bacteria 16459
214 Ga0207677_10004159 3300026023 Bacteria 7745
215 Ga0207677_10015041 3300026023 Bacteria 4537
216 Ga0207677_10363600 3300026023 Bacteria 1216
217 Ga0207703_10149486 3300026035 Bacteria 2035
218 Ga0207703_11248488 3300026035 Bacteria 714
219 Ga0207678_10008367 3300026067 Bacteria 9124
220 Ga0207678_10040856 3300026067 Bacteria 4021
221 Ga0207678_10056073 3300026067 Bacteria 3394
222 Ga0207702_10722702 3300026078 Bacteria 982
223 Ga0207641_10647468 3300026088 Unclassified 1038
224 Ga0207648_10026549 3300026089 Bacteria 5145
225 Ga0207676_10196125 3300026095 Bacteria 1781
226 Ga0207674_10015977 3300026116 Bacteria 8223
227 Ga0207674_11121235 3300026116 Bacteria 756
228 Ga0207683_10103308 3300026121 Bacteria 2545
229 Ga0207698_10034638 3300026142 Bacteria 3683
230 Ga0207698_10206432 3300026142 Bacteria 1764
231 Ga0207698_10931522 3300026142 Bacteria 877
232 Ga0207698_10991744 3300026142 Bacteria 850
233 Ga0207698_10996817 3300026142 Bacteria 848
234 Ga0207698_11885418 3300026142 Unclassified 613
235 Ga0268266_10140717 3300028379 Bacteria 2165
236 Ga0307408_100031371 3300031548 Bacteria 3700
237 Ga0307405_10400269 3300031731 Bacteria 1074
238 Ga0307405_10787983 3300031731 Bacteria 795
239 Ga0307413_10006754 3300031824 Bacteria 5270
240 Ga0307413_10074096 3300031824 Bacteria 2154
241 Ga0307413_10104722 3300031824 Bacteria 1879
242 Ga0307410_10000955 3300031852 Bacteria 12399
243 Ga0307410_10021570 3300031852 Bacteria 3964
244 Ga0307410_10026028 3300031852 Bacteria 3677
245 Ga0307410_10037420 3300031852 Bacteria 3169
246 Ga0307410_10447436 3300031852 Bacteria 1053
247 Ga0307410_10752117 3300031852 Bacteria 825
248 Ga0307407_10022660 3300031903 Bacteria 3264
249 Ga0307407_10038304 3300031903 Bacteria 2656
250 Ga0307407_10106663 3300031903 Bacteria 1750
251 Ga0307407_10367990 3300031903 Bacteria 1023
252 Ga0307412_10021795 3300031911 Bacteria 3919
253 Ga0307412_10154422 3300031911 Bacteria 1697
254 Ga0307412_10158102 3300031911 Bacteria 1680
255 Ga0307412_10224198 3300031911 Bacteria 1443
256 Ga0307409_100000527 3300031995 Bacteria 16577
257 Ga0307409_100088901 3300031995 Bacteria 2523
258 Ga0307409_100165600 3300031995 Bacteria 1939
259 Ga0307416_100005012 3300032002 Bacteria 8074
260 Ga0307416_100018674 3300032002 Bacteria 4893
261 Ga0307416_100081789 3300032002 Bacteria 2732
262 Ga0307416_100295608 3300032002 Bacteria 1606
263 Ga0307416_100522582 3300032002 Bacteria 1255
264 Ga0307414_10102697 3300032004 Bacteria 2155
265 Ga0307414_10270763 3300032004 Bacteria 1422
266 Ga0307414_10344121 3300032004 Bacteria 1277
267 Ga0307414_10421484 3300032004 Bacteria 1164
268 Ga0307414_10591117 3300032004 Bacteria 994
269 Ga0307414_10621754 3300032004 Bacteria 971
270 Ga0307414_11171329 3300032004 Bacteria 711
271 Ga0307411_10000789 3300032005 Bacteria 11762
272 Ga0307411_10186767 3300032005 Bacteria 1578
273 Ga0307411_10205738 3300032005 Bacteria 1515
274 Ga0307411_10330671 3300032005 Bacteria 1234
275 Ga0307411_11510655 3300032005 Bacteria 617
276 Ga0307415_100018792 3300032126 Bacteria 4183
277 Ga0307415_100182614 3300032126 Bacteria 1647
278 Ga0307415_100242249 3300032126 Bacteria 1459
279 Ga0307415_100355747 3300032126 Bacteria 1234
280 Ga0307415_101054744 3300032126 Bacteria 758
281 Ga0373943_0006277 3300035170 Bacteria 5338
282 Ga0373946_0017448 3300035171 Bacteria 2747
283 Ga0373935_0046295 3300035692 Bacteria 2747
284 Ga0373935_0079089 3300035692 Bacteria 2134
285 Ga0373935_0519612 3300035692 Bacteria 866
286 Ga0373927_0732799 3300035695 Bacteria 653
287 Ga0373937_0686764 3300036401 Bacteria 970
288 Ga0395899_0094913 3300037312 Bacteria 2158
289 Ga0395899_0133520 3300037312 Bacteria 1771
290 Ga0395900_0012013 3300037418 Bacteria 8852
291 Ga0395900_0146376 3300037418 Bacteria 2415
292 Ga0395905_0022735 3300037471 Bacteria 5929
293 Ga0395905_0449124 3300037471 Bacteria 1187
294 Ga0395901_0080303 3300038443 Bacteria 3405
295 Ga0436365_0258191 3300039437 Bacteria 5188
296 Ga0439465_0022251 3300041413 Bacteria 1991
297 Ga0439432_012890 3300042006 Bacteria 2847
298 Ga0439449_0008523 3300042007 Bacteria 3895
299 Ga0466972_0041769 3300044658 Bacteria 2232
300 Ga0466972_0182024 3300044658 Bacteria 985
301 Ga0466972_0438472 3300044658 Bacteria 613
302 Ga0466965_0549279 3300044683 Bacteria 652
303 Ga0466966_0062522 3300044684 Bacteria 2347
304 Ga0466966_0121777 3300044684 Bacteria 1602
305 Ga0466966_0217716 3300044684 Bacteria 1153
306 Ga0466966_0366953 3300044684 Bacteria 865
307 Ga0466966_0441902 3300044684 Bacteria 782
308 Ga0466963_0012768 3300044694 Bacteria 5145
309 Ga0466963_0030739 3300044694 Bacteria 3467
310 Ga0466963_0100907 3300044694 Bacteria 1975
311 Ga0466964_0061655 3300044706 Bacteria 1562
312 Ga0466970_0288595 3300044765 Bacteria 924
313 Ga0466957_0024129 3300044842 Bacteria 3598
314 Ga0466957_0145198 3300044842 Bacteria 1531
315 Ga0466957_0393912 3300044842 Bacteria 946
316 Ga0466957_0644303 3300044842 Bacteria 744
317 Ga0466959_0070982 3300045049 Bacteria 2523
318 Ga0466959_0136900 3300045049 Bacteria 1733
319 Ga0466959_1083809 3300045049 Bacteria 533
320 Ga0466958_0041905 3300045836 Bacteria 2755
321 Ga0466958_0068300 3300045836 Bacteria 2172
322 Ga0466967_0027353 3300045976 Bacteria 4743
323 Ga0466967_0044267 3300045976 Bacteria 3860
324 Ga0466967_0057272 3300045976 Bacteria 3440
325 Ga0466967_0238911 3300045976 Bacteria 1732
326 Ga0466967_0251587 3300045976 Bacteria 1688
327 Ga0466967_0995790 3300045976 Bacteria 834
328 Ga0466967_2021192 3300045976 Bacteria 573
329 Ga0495663_0096040 3300046525 Bacteria 971
330 Ga0495621_0078287 3300046539 Bacteria 1229
331 Ga0495633_0049358 3300046558 Bacteria 1986
332 Ga0495669_0013362 3300046684 Bacteria 3497
333 Ga0495669_0017913 3300046684 Bacteria 3041
334 Ga0495670_0000238 3300046691 Bacteria 25286
335 Ga0495677_0004947 3300047445 Bacteria 5082
336 Ga0496101_0086340 3300048904 Bacteria 2327
337 Ga0496102_0313548 3300048905 Bacteria 1478
338 Ga0496103_0074678 3300048906 Bacteria 2126
339 Ga0496103_0261415 3300048906 Bacteria 1114
340 Ga0496107_1367747 3300048910 Bacteria 505
341 Ga0496108_0508832 3300048911 Bacteria 1051
342 Ga0496108_1096646 3300048911 Bacteria 677
343 Ga0496109_0203707 3300048912 Bacteria 1860
344 Ga0496110_0973149 3300048913 Bacteria 756
345 Ga0496111_0433197 3300048914 Unclassified 971
346 Ga0496112_0007583 3300048915 Bacteria 9641
347 Ga0496112_0880741 3300048915 Bacteria 818
348 Ga0496113_0022523 3300048916 Bacteria 4458
349 Ga0496113_0190912 3300048916 Bacteria 1626
350 Ga0501067_0076864 3300049583 Bacteria 1850
351 Ga0501207_015315 3300049654 Bacteria 1179
352 Ga0501223_005869 3300049663 Bacteria 2563
353 Ga0501227_128655 3300049665 Bacteria 688
354 Ga0501230_096015 3300049667 Bacteria 635
355 Ga0501235_014387 3300049669 Bacteria 1744
356 Ga0501236_021391 3300049670 Bacteria 959
357 Ga0501242_058418 3300049674 Bacteria 582
358 Ga0501243_026206 3300049675 Bacteria 981
359 Ga0501249_005776 3300049679 Bacteria 2529
360 Ga0501257_029160 3300049686 Bacteria 1326
361 Ga0501221_032905 3300049704 Bacteria 1092
362 Ga0501234_006093 3300049707 Bacteria 1889
363 Ga0501268_020034 3300049765 Bacteria 1136
364 Ga0501270_004171 3300049767 Bacteria 1607
365 Ga0501272_006221 3300049769 Bacteria 1273
366 Ga0501283_048137 3300049779 Bacteria 750
367 Ga0466962_0046652 3300061719 Bacteria 2070
368 Ga0466962_0330695 3300061719 Unclassified 757
369 Ga0466962_0375218 3300061719 Unclassified 710
370 Ga0207681_10916733
371 JGI24737J22298_10019797
372 JGI24738J21930_10041079
373 JGI24744J21845_10005952
374 rootH1_10214486
375 Ga0065715_10175360
376 Ga0070658_10034584
377 Ga0070658_10851535
378 Ga0070676_10082893
379 Ga0070676_10209770
380 Ga0070683_100159506
381 Ga0070690_100008918
382 Ga0070670_100059168
383 Ga0070670_100071926
384 Ga0070670_100413150
385 Ga0070677_10140694
386 Ga0068869_100219311
387 Ga0068869_100296164
388 Ga0068869_100791267
389 Ga0068869_100871970
390 Ga0070666_10096928
391 Ga0070666_10211098
392 Ga0068868_100006268
393 Ga0068868_100014141
394 Ga0068868_100109801
395 Ga0068868_101325208
396 Ga0068868_101675295
397 Ga0070660_100119836
398 Ga0070660_100191188
399 Ga0070660_100228870
400 Ga0070660_100366647
401 Ga0070660_100622218
402 Ga0070689_100117779
403 Ga0070687_100032639
404 Ga0070661_100035502
405 Ga0070661_100334298
406 Ga0070661_100619868
407 Ga0070692_10301972
408 Ga0070668_100633698
409 Ga0070669_101113578
410 Ga0070675_100005465
411 Ga0070675_100020151
412 Ga0070671_100054554
413 Ga0070671_100055692
414 Ga0070671_100412282
415 Ga0070671_100542361
416 Ga0070674_100030016
417 Ga0070674_100900600
418 Ga0070673_100001556
419 Ga0070673_100016507
420 Ga0070673_100204797
421 Ga0070659_100134273
422 Ga0070659_100151263
423 Ga0070659_100658956
424 Ga0070659_101119018
425 Ga0070667_100008190
426 Ga0070713_100380906
427 Ga0070663_100434584
428 Ga0070678_100145961
429 Ga0070662_100020139
430 Ga0070662_100045561
431 Ga0070662_100067946
432 Ga0070662_100903499
433 Ga0070662_101908879
434 Ga0068867_100272082
435 Ga0070685_10098950
436 Ga0070679_100163430
437 Ga0068853_100058741
438 Ga0068853_100290415
439 Ga0070672_100106051
440 Ga0070693_100128018
441 Ga0070665_100024564
442 Ga0068855_101234477
443 Ga0068855_101384435
444 Ga0070664_100008081
445 Ga0070664_100297227
446 Ga0070664_100426706
447 Ga0070664_100598577
448 Ga0068854_100044447
449 Ga0068852_100131388
450 Ga0068852_100325606
451 Ga0068852_101175209
452 Ga0068859_100172336
453 Ga0068859_100198612
454 Ga0068864_100001115
455 Ga0068864_101734318
456 Ga0068866_10073690
457 Ga0068851_10118806
458 Ga0068851_10233469
459 Ga0068870_10355688
460 Ga0068863_100328434
461 Ga0068863_101602831
462 Ga0068858_100037977
463 Ga0070712_100011803
464 Ga0097621_100432368
465 Ga0068871_100593456
466 Ga0068865_100550277
467 Ga0097620_100172338
468 Ga0097620_100198606
469 Ga0105245_10044198
470 Ga0105245_10363192
471 Ga0105242_10621312
472 Ga0105248_10015208
473 Ga0105248_10029128
474 Ga0105248_10080139
475 Ga0105248_10187569
476 Ga0105248_10226487
477 Ga0105238_11115410
478 Ga0105238_12743886
479 Ga0157327_1015216
480 Ga0157371_10067015
481 Ga0157369_10120900
482 Ga0157369_10715615
483 Ga0157374_10002080
484 Ga0157374_10352899
485 Ga0157374_10622226
486 Ga0157374_10699263
487 Ga0157378_10261331
488 Ga0157378_10311255
489 Ga0157378_10466617
490 Ga0163162_10068635
491 Ga0157372_10031190
492 Ga0157375_10004032
493 Ga0157375_10073288
494 Ga0157375_10784622
495 Ga0157375_13270783
496 Ga0157380_10774627
497 Ga0157377_10155845
498 Ga0157379_10020585
499 Ga0157376_10926794
500 Ga0213876_10014519
501 Ga0207697_10007965
502 Ga0207697_10094986
503 Ga0207682_10110231
504 Ga0207642_10054397
505 Ga0207642_10074126
506 Ga0207688_10000929
507 Ga0207680_10056295
508 Ga0207680_10062236
509 Ga0207680_10424352
510 Ga0207647_10015127
511 Ga0207647_10018323
512 Ga0207647_10040343
513 Ga0207645_10051825
514 Ga0207705_10121160
515 Ga0207705_10289532
516 Ga0207654_10972575
517 Ga0207693_10353425
518 Ga0207660_10127343
519 Ga0207662_10026295
520 Ga0207662_10118901
521 Ga0207657_10047304
522 Ga0207657_10158027
523 Ga0207657_10297137
524 Ga0207657_10516674
525 Ga0207657_10773566
526 Ga0207657_10820916
527 Ga0207657_10824918
528 Ga0207649_10067306
529 Ga0207649_10410628
530 Ga0207652_10970125
531 Ga0207652_11365104
532 Ga0207681_10504689
533 Ga0207650_10031562
534 Ga0207650_10149065
535 Ga0207650_10257869
536 Ga0207650_10513848
537 Ga0207659_10016559
538 Ga0207659_10144343
539 Ga0207687_10065993
540 Ga0207687_11418527
541 Ga0207700_10822111
542 Ga0207644_10015901
543 Ga0207644_10056500
544 Ga0207644_10969976
545 Ga0207690_10215898
546 Ga0207690_10922767
547 Ga0207690_11073994
548 Ga0207690_11516588
549 Ga0207706_10017444
550 Ga0207706_10032357
551 Ga0207706_10057190
552 Ga0207706_10137865
553 Ga0207706_10326974
554 Ga0207686_10804753
555 Ga0207670_10129054
556 Ga0207669_10027672
557 Ga0207669_10175216
558 Ga0207704_10520666
559 Ga0207691_10085899
560 Ga0207691_10452909
561 Ga0207711_10065147
562 Ga0207711_10072309
563 Ga0207711_10075468
564 Ga0207711_10131265
565 Ga0207689_10336138
566 Ga0207689_10839465
567 Ga0207679_10004438
568 Ga0207679_10338376
569 Ga0207679_10866493
570 Ga0207667_10508314
571 Ga0207651_10146572
572 Ga0207651_10210215
573 Ga0207668_10055982
574 Ga0207668_10553088
575 Ga0207640_10050010
576 Ga0207640_10067163
577 Ga0207640_10691180
578 Ga0207658_10006321
579 Ga0207658_10114126
580 Ga0207658_10592024
581 Ga0207658_11388162
582 Ga0207677_10000918
583 Ga0207677_10004159
584 Ga0207677_10015041
585 Ga0207677_10363600
586 Ga0207703_10149486
587 Ga0207703_11248488
588 Ga0207678_10008367
589 Ga0207678_10040856
590 Ga0207678_10056073
591 Ga0207702_10722702
592 Ga0207641_10647468
593 Ga0207648_10026549
594 Ga0207676_10196125
595 Ga0207674_10015977
596 Ga0207674_11121235
597 Ga0207683_10103308
598 Ga0207698_10034638
599 Ga0207698_10206432
600 Ga0207698_10931522
601 Ga0207698_10991744
602 Ga0207698_10996817
603 Ga0207698_11885418
604 Ga0268266_10140717
605 Ga0307408_100031371
606 Ga0307405_10400269
607 Ga0307405_10787983
608 Ga0307413_10006754
609 Ga0307413_10074096
610 Ga0307413_10104722
611 Ga0307410_10000955
612 Ga0307410_10021570
613 Ga0307410_10026028
614 Ga0307410_10037420
615 Ga0307410_10447436
616 Ga0307410_10752117
617 Ga0307407_10022660
618 Ga0307407_10038304
619 Ga0307407_10106663
620 Ga0307407_10367990
621 Ga0307412_10021795
622 Ga0307412_10154422
623 Ga0307412_10158102
624 Ga0307412_10224198
625 Ga0307409_100000527
626 Ga0307409_100088901
627 Ga0307409_100165600
628 Ga0307416_100005012
629 Ga0307416_100018674
630 Ga0307416_100081789
631 Ga0307416_100295608
632 Ga0307416_100522582
633 Ga0307414_10102697
634 Ga0307414_10270763
635 Ga0307414_10344121
636 Ga0307414_10421484
637 Ga0307414_10591117
638 Ga0307414_10621754
639 Ga0307414_11171329
640 Ga0307411_10000789
641 Ga0307411_10186767
642 Ga0307411_10205738
643 Ga0307411_10330671
644 Ga0307411_11510655
645 Ga0307415_100018792
646 Ga0307415_100182614
647 Ga0307415_100242249
648 Ga0307415_100355747
649 Ga0307415_101054744
650 Ga0373943_0006277
651 Ga0373946_0017448
652 Ga0373935_0046295
653 Ga0373935_0079089
654 Ga0373935_0519612
655 Ga0373927_0732799
656 Ga0373937_0686764
657 Ga0395899_0094913
658 Ga0395899_0133520
659 Ga0395900_0012013
660 Ga0395900_0146376
661 Ga0395905_0022735
662 Ga0395905_0449124
663 Ga0395901_0080303
664 Ga0436365_0258191
665 Ga0439465_0022251
666 Ga0439432_012890
667 Ga0439449_0008523
668 Ga0466972_0041769
669 Ga0466972_0182024
670 Ga0466972_0438472
671 Ga0466965_0549279
672 Ga0466966_0062522
673 Ga0466966_0121777
674 Ga0466966_0217716
675 Ga0466966_0366953
676 Ga0466966_0441902
677 Ga0466963_0012768
678 Ga0466963_0030739
679 Ga0466963_0100907
680 Ga0466964_0061655
681 Ga0466970_0288595
682 Ga0466957_0024129
683 Ga0466957_0145198
684 Ga0466957_0393912
685 Ga0466957_0644303
686 Ga0466959_0070982
687 Ga0466959_0136900
688 Ga0466959_1083809
689 Ga0466958_0041905
690 Ga0466958_0068300
691 Ga0466967_0027353
692 Ga0466967_0044267
693 Ga0466967_0057272
694 Ga0466967_0238911
695 Ga0466967_0251587
696 Ga0466967_0995790
697 Ga0466967_2021192
698 Ga0495663_0096040
699 Ga0495621_0078287
700 Ga0495633_0049358
701 Ga0495669_0013362
702 Ga0495669_0017913
703 Ga0495670_0000238
704 Ga0495677_0004947
705 Ga0496101_0086340
706 Ga0496102_0313548
707 Ga0496103_0074678
708 Ga0496103_0261415
709 Ga0496107_1367747
710 Ga0496108_0508832
711 Ga0496108_1096646
712 Ga0496109_0203707
713 Ga0496110_0973149
714 Ga0496111_0433197
715 Ga0496112_0007583
716 Ga0496112_0880741
717 Ga0496113_0022523
718 Ga0496113_0190912
719 Ga0501067_0076864
720 Ga0501207_015315
721 Ga0501223_005869
722 Ga0501227_128655
723 Ga0501230_096015
724 Ga0501235_014387
725 Ga0501236_021391
726 Ga0501242_058418
727 Ga0501243_026206
728 Ga0501249_005776
729 Ga0501257_029160
730 Ga0501221_032905
731 Ga0501234_006093
732 Ga0501268_020034
733 Ga0501270_004171
734 Ga0501272_006221
735 Ga0501283_048137
736 Ga0466962_0046652
737 Ga0466962_0330695
738 Ga0466962_0375218

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

28

111

0.96

PF13279

4HBT_2

Thioesterase-like superfamily

20

139

0.93

PF20791

Acyl-ACP_TE_C

Acyl-ACP thioesterase C-terminal domain

7

58

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
2o6t-assembly3.cif.gz_K crystal structure of the pa5185 protein from pseudomonas aeruginosa strain pao1- orthorhombic form (p2221). 0.9262 5 142
5dio-assembly1.cif.gz_A-2 crystal structure of unnamed thioesterase lpg2867 from legionella pneumophila, the d21a mutant 0.9051 15 137
5v10-assembly1.cif.gz_A-2 crystal structure of the putative tol-pal system-associated acyl-coa thioesterase from pseudomonas aeruginosa pao1 0.9035 14 139
5byu-assembly1.cif.gz_A crystal structure of unnamed thioesterase ipg2867 from legionella pneumophila 0.9018 15 137
2egi-assembly1.cif.gz_H crystal structure of a hypothetical protein(aq1494) from aquifex aeolicus 0.9011 14 121
ID Description Score Start End Superfamily
2av9A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9177 5 141 3.10.129.10
af_O07408_6_147_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9102 7 139 3.10.129.10
2egiH00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9011 14 121 3.10.129.10
af_A0A1D8PI65_18_238_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8982 62 118 3.10.129.10
5v10B00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8947 13 138 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A4Y8ZR63-F1-model_v4 Acyl-CoA thioesterase 0.9472 7 142 GO:0047617
AF-A0A3S4NUK5-F1-model_v4 deleted 0.9458 1 141
AF-A0A6H2DSU8-F1-model_v4 Acyl-CoA thioesterase 0.9446 1 141 GO:0047617
AF-A0A524KNZ5-F1-model_v4 Acyl-CoA thioesterase 0.9445 3 142 GO:0047617
AF-A0A2W4URX1-F1-model_v4 Thioesterase 0.944 2 141 GO:0047617

Map