F425036

General Info

Members Datasets Scaffolds Average Seq Length
369 217 298 317

Family's Representative Sequence

Representative Sequence 3300013296|Ga0157374_10276589|Ga0157374_102765893
Length 348
Sequence LGALSWFTGECAAEQTGGPTYPTAPTRVSGKPMTNKIAVVGSGYMGGGIAQVLALAGARVALTDVSAEVAQKNYDRLIAESRDFVADGLFPEGATQTLQVNLWPANCIAEGVADADFIEECVPEVLTIKRDILSQISAAAQVGAIIGSNTSTISIGAMATAVTNPDRFLGVHFSNPAPFIPGVEIIPHNGTADATVTRVSEIINAAGKTSAVIKDATGFVLNRLQYALFHEATQLVEEGVATAEDIDTVVRTTFGFRLPFFGPFAIADMAGLDVYNFCYQSLQSGFPERFATPRILTELVAQGKLGTKSGGGFTDVPAERIPELIAYRNKAYVLMQKLLDDLGPAPTK

Samples

Sample ID Description Type Environment
1 2554235227 Arthrobacter sp. PAO19 Isolate Rhizosphere
2 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
3 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
4 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
5 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
6 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
7 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
8 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
9 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
10 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
11 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
12 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
13 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
14 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
15 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
16 2808606394 Promicromonospora sp. C35 Isolate Unclassified
17 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
18 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
19 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
20 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
21 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
22 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
23 2835188231 Isoptericola variabilis JZ7 Isolate Unclassified
24 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
25 2848551377 Brachybacterium saurashtrense DSM 23186 Isolate Unclassified
26 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
27 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
28 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
29 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
30 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
31 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
32 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
33 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
34 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
35 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
36 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
37 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
38 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
39 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
40 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
41 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
42 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
43 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
44 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
45 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
46 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
47 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
48 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
49 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
50 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
51 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
52 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
53 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
54 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
55 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
56 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
57 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
58 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
59 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
60 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
61 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
62 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
63 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
64 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
65 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
66 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
67 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
68 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
69 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
70 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
71 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
72 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
73 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
74 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
75 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
76 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
77 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
78 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
79 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
80 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
81 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
82 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
83 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
84 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
97 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
98 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
116 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
117 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
118 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
119 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
120 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
121 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
122 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
123 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
124 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
125 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
126 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
127 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
128 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
129 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
130 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
131 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
132 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
133 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
134 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
135 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
136 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
137 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
138 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
139 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
140 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
141 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
142 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
143 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
144 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
145 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
146 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
147 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
148 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
149 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
150 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
151 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
152 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
153 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
154 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
155 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
156 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
157 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
158 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
159 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
160 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
161 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
162 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
163 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
164 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
165 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
166 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
167 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
168 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
169 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
170 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
171 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
172 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
173 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
174 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
175 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
176 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
177 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
178 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
179 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
180 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
181 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
182 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
183 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
184 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
185 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
186 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
187 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
201 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
202 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
203 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
204 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
205 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
206 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
207 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
208 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
209 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
211 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
212 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
213 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
214 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
215 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
216 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
217 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 80.49
Metatranscriptomes 0.27
Isolates 19.24

Biome Distribution

Category Percentage (%)
Aerial Root 0.54
Bulb 0
Endosphere 2.17
Nodule 0
Rhizoplane 6.78
Rhizosphere 73.17
Stem 0
Stem Tuber 0
Unclassified 17.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1000374 3300000549 Bacteria 7636
2 LJQas_1000664 3300000549 Bacteria 5534
3 JGI25152J39213_1000668 3300002773 Bacteria 17862
4 Ga0070658_10000285 3300005327 Bacteria 44343
5 Ga0070658_10016689 3300005327 Bacteria 5877
6 Ga0070676_10023941 3300005328 Bacteria 3435
7 Ga0070677_10004894 3300005333 Bacteria 4399
8 Ga0070666_10013301 3300005335 Bacteria 5218
9 Ga0070660_100113998 3300005339 Bacteria 2153
10 Ga0070669_100023385 3300005353 Bacteria 4425
11 Ga0070675_100050262 3300005354 Bacteria 3423
12 Ga0070673_100008443 3300005364 Bacteria 6848
13 Ga0070659_100025982 3300005366 Bacteria 4505
14 Ga0070667_100080429 3300005367 Bacteria 2787
15 Ga0070663_100242758 3300005455 Bacteria 1423
16 Ga0068867_100519907 3300005459 Bacteria 1026
17 Ga0068853_100037394 3300005539 Bacteria 4130
18 Ga0068853_100051876 3300005539 Bacteria 3532
19 Ga0070672_100265124 3300005543 Bacteria 1449
20 Ga0070665_100041982 3300005548 Bacteria 4598
21 Ga0070665_100339217 3300005548 Bacteria 1507
22 Ga0075364_10028398 3300006051 Bacteria 3581
23 Ga0075432_10000086 3300006058 Bacteria 19052
24 Ga0105243_10049730 3300009148 Bacteria 3308
25 Ga0105243_10140795 3300009148 Bacteria 2058
26 Ga0105243_10165302 3300009148 Bacteria 1912
27 Ga0105248_10192394 3300009177 Bacteria 2299
28 Ga0105246_10007374 3300011119 Bacteria 6739
29 Ga0105246_10014838 3300011119 Bacteria 4908
30 Ga0105246_10027834 3300011119 Bacteria 3708
31 Ga0105246_10064879 3300011119 Bacteria 2552
32 Ga0157371_10035865 3300013102 Bacteria 3553
33 Ga0157371_10122055 3300013102 Bacteria 1853
34 Ga0157370_10008333 3300013104 Bacteria 11180
35 Ga0157370_10010921 3300013104 Bacteria 9536
36 Ga0157370_10194637 3300013104 Bacteria 1882
37 Ga0157369_10065954 3300013105 Bacteria 3895
38 Ga0157369_10067766 3300013105 Bacteria 3836
39 Ga0157369_10097848 3300013105 Bacteria 3130
40 Ga0157369_10172378 3300013105 Bacteria 2279
41 Ga0157369_10301673 3300013105 Bacteria 1666
42 Ga0157374_10276589 3300013296 Bacteria 1657
43 Ga0157372_10113461 3300013307 Bacteria 3106
44 Ga0157376_10171234 3300014969 Bacteria 1978
45 Ga0163161_10057560 3300017792 Bacteria 2824
46 Ga0206351_10230950 3300020077 Bacteria 2035
47 Ga0209129_1000064 3300025258 Bacteria 236026
48 Ga0209025_1001863 3300025294 Bacteria 24711
49 Ga0209051_1002275 3300025303 Bacteria 14067
50 Ga0207697_10024915 3300025315 Bacteria 2447
51 Ga0207655_1005593 3300025728 Bacteria 8508
52 Ga0207655_1009434 3300025728 Bacteria 6054
53 Ga0207713_1022503 3300025735 Bacteria 2989
54 Ga0207645_10009185 3300025907 Bacteria 6852
55 Ga0207705_10000001 3300025909 Bacteria 2061880
56 Ga0207657_10255848 3300025919 Bacteria 1394
57 Ga0207681_10010088 3300025923 Bacteria 5780
58 Ga0207690_10006404 3300025932 Bacteria 6980
59 Ga0207709_10059873 3300025935 Bacteria 2372
60 Ga0207709_10217221 3300025935 Bacteria 1376
61 Ga0207691_10002705 3300025940 Bacteria 17329
62 Ga0207711_10156998 3300025941 Bacteria 2057
63 Ga0207658_10040496 3300025986 Bacteria 3369
64 Ga0207678_10337526 3300026067 Bacteria 1298
65 Ga0207683_10029694 3300026121 Bacteria 4735
66 Ga0207428_10029359 3300027907 Bacteria 4559
67 Ga0207428_10052618 3300027907 Bacteria 3251
68 Ga0268266_10209788 3300028379 Bacteria 1786
69 Ga0307408_100006695 3300031548 Bacteria 7642
70 Ga0307408_100016378 3300031548 Bacteria 4946
71 Ga0307408_100023867 3300031548 Bacteria 4169
72 Ga0307408_100027110 3300031548 Bacteria 3945
73 Ga0307408_100040806 3300031548 Bacteria 3288
74 Ga0307408_100090542 3300031548 Bacteria 2308
75 Ga0307408_100154951 3300031548 Bacteria 1813
76 Ga0307408_100162414 3300031548 Bacteria 1775
77 Ga0307408_100203486 3300031548 Bacteria 1604
78 Ga0307405_10005885 3300031731 Bacteria 5972
79 Ga0307405_10013138 3300031731 Bacteria 4410
80 Ga0307405_10031349 3300031731 Bacteria 3129
81 Ga0307405_10042145 3300031731 Bacteria 2776
82 Ga0307405_10054246 3300031731 Bacteria 2501
83 Ga0307405_10064425 3300031731 Bacteria 2330
84 Ga0307405_10066610 3300031731 Bacteria 2297
85 Ga0307405_10094938 3300031731 Bacteria 1985
86 Ga0307413_10014809 3300031824 Bacteria 3975
87 Ga0307413_10037079 3300031824 Bacteria 2813
88 Ga0307413_10175904 3300031824 Bacteria 1520
89 Ga0307413_10363964 3300031824 Bacteria 1121
90 Ga0307410_10007852 3300031852 Bacteria 5874
91 Ga0307410_10025880 3300031852 Bacteria 3686
92 Ga0307410_10035239 3300031852 Bacteria 3248
93 Ga0307410_10154027 3300031852 Bacteria 1714
94 Ga0307406_10073627 3300031901 Bacteria 2247
95 Ga0307406_10180612 3300031901 Bacteria 1536
96 Ga0307407_10006997 3300031903 Bacteria 5072
97 Ga0307407_10014578 3300031903 Bacteria 3855
98 Ga0307407_10119215 3300031903 Bacteria 1670
99 Ga0307412_10006307 3300031911 Bacteria 6698
100 Ga0307412_10013841 3300031911 Bacteria 4741
101 Ga0307412_10030903 3300031911 Bacteria 3377
102 Ga0307412_10038000 3300031911 Bacteria 3096
103 Ga0307412_10047528 3300031911 Bacteria 2819
104 Ga0307412_10075190 3300031911 Bacteria 2316
105 Ga0307409_100009453 3300031995 Bacteria 5990
106 Ga0307409_100505698 3300031995 Bacteria 1178
107 Ga0307416_100009514 3300032002 Bacteria 6367
108 Ga0307416_100012216 3300032002 Bacteria 5771
109 Ga0307416_100020759 3300032002 Bacteria 4697
110 Ga0307416_100072744 3300032002 Bacteria 2863
111 Ga0307416_100087443 3300032002 Bacteria 2660
112 Ga0307416_100180063 3300032002 Bacteria 1980
113 Ga0307416_100366238 3300032002 Bacteria 1465
114 Ga0307416_100666230 3300032002 Bacteria 1127
115 Ga0307414_10020241 3300032004 Bacteria 4144
116 Ga0307414_10050817 3300032004 Bacteria 2874
117 Ga0307414_10177510 3300032004 Bacteria 1709
118 Ga0307411_10076246 3300032005 Bacteria 2291
119 Ga0307411_10092540 3300032005 Bacteria 2115
120 Ga0307415_100009634 3300032126 Bacteria 5429
121 Ga0307415_100011918 3300032126 Bacteria 5003
122 Ga0307415_100109120 3300032126 Bacteria 2049
123 Ga0307415_100254511 3300032126 Bacteria 1429
124 Ga0395899_0013212 3300037312 Bacteria 6316
125 Ga0395899_0022591 3300037312 Bacteria 4765
126 Ga0395899_0027429 3300037312 Bacteria 4295
127 Ga0395899_0054024 3300037312 Bacteria 2973
128 Ga0395899_0101863 3300037312 Bacteria 2072
129 Ga0395900_0042993 3300037418 Bacteria 4655
130 Ga0395900_0057637 3300037418 Bacteria 3999
131 Ga0395900_0079156 3300037418 Bacteria 3377
132 Ga0395900_0092053 3300037418 Bacteria 3115
133 Ga0395900_0117785 3300037418 Bacteria 2725
134 Ga0395900_0190277 3300037418 Bacteria 2082
135 Ga0395898_0002890 3300037466 Bacteria 19576
136 Ga0395898_0014559 3300037466 Bacteria 8078
137 Ga0395898_0050557 3300037466 Bacteria 4067
138 Ga0395898_0052174 3300037466 Bacteria 3995
139 Ga0395898_0102989 3300037466 Bacteria 2739
140 Ga0395898_0287646 3300037466 Bacteria 1568
141 Ga0395905_0031881 3300037471 Bacteria 4959
142 Ga0395901_0027767 3300038443 Bacteria 5820
143 Ga0395901_0042663 3300038443 Bacteria 4703
144 Ga0395901_0052333 3300038443 Bacteria 4243
145 Ga0395901_0269070 3300038443 Bacteria 1773
146 Ga0439436_0003646 3300041404 Bacteria 4693
147 Ga0439438_028126 3300041405 Bacteria 1514
148 Ga0439465_0019080 3300041413 Bacteria 2144
149 Ga0451793_0262462 3300041452 Bacteria 2321
150 Ga0451853_1743894 3300041512 Bacteria 1423
151 Ga0439449_0000948 3300042007 Bacteria 11362
152 Ga0439449_0003937 3300042007 Bacteria 5756
153 Ga0439434_0046986 3300042435 Bacteria 1333
154 Ga0439459_0004966 3300042438 Bacteria 2164
155 Ga0466972_0010736 3300044658 Bacteria 4597
156 Ga0466972_0128963 3300044658 Bacteria 1191
157 Ga0466965_0001682 3300044683 Bacteria 9077
158 Ga0466965_0002335 3300044683 Bacteria 8021
159 Ga0466965_0016078 3300044683 Bacteria 3556
160 Ga0466965_0047479 3300044683 Bacteria 2126
161 Ga0466961_0134477 3300044693 Bacteria 1549
162 Ga0466970_0008733 3300044765 Bacteria 5105
163 Ga0466970_0124256 3300044765 Bacteria 1415
164 Ga0466957_0180335 3300044842 Bacteria 1379
165 Ga0466960_0000047 3300044901 Bacteria 40180
166 Ga0495650_0000508 3300046471 Bacteria 58152
167 Ga0495580_0005331 3300046472 Bacteria 10658
168 Ga0495639_0003861 3300046475 Bacteria 6433
169 Ga0495662_0082656 3300046476 Bacteria 1563
170 Ga0495664_0069672 3300046477 Bacteria 2100
171 Ga0495606_0020136 3300046507 Bacteria 4932
172 Ga0495586_0010621 3300046535 Bacteria 4898
173 Ga0495586_0049335 3300046535 Bacteria 2276
174 Ga0495586_0070379 3300046535 Bacteria 1910
175 Ga0495609_0092022 3300046538 Bacteria 1319
176 Ga0495656_0150204 3300046615 Bacteria 1124
177 Ga0495588_0004632 3300046674 Bacteria 6071
178 Ga0495588_0019370 3300046674 Bacteria 3331
179 Ga0495623_0029644 3300046679 Bacteria 3521
180 Ga0495670_0056177 3300046691 Bacteria 1974
181 Ga0495581_0061759 3300047315 Bacteria 2165
182 Ga0495581_0077520 3300047315 Bacteria 1923
183 Ga0495581_0097384 3300047315 Bacteria 1708
184 Ga0495675_0053379 3300047444 Bacteria 2565
185 Ga0495681_0050577 3300047470 Bacteria 1958
186 Ga0495686_0001484 3300047472 Bacteria 25494
187 Ga0495593_0020732 3300047673 Bacteria 3676
188 Ga0496100_0008250 3300048903 Bacteria 5804
189 Ga0496101_0000037 3300048904 Bacteria 166198
190 Ga0496102_0000083 3300048905 Bacteria 138102
191 Ga0496102_0085195 3300048905 Bacteria 2917
192 Ga0496102_0119523 3300048905 Bacteria 2460
193 Ga0496102_0241393 3300048905 Bacteria 1703
194 Ga0496103_0000060 3300048906 Bacteria 138526
195 Ga0496103_0045206 3300048906 Bacteria 2717
196 Ga0496104_0476470 3300048907 Bacteria 1159
197 Ga0496105_0088277 3300048908 Bacteria 2561
198 Ga0496105_0089746 3300048908 Bacteria 2539
199 Ga0496106_0015015 3300048909 Bacteria 5732
200 Ga0496106_0061859 3300048909 Bacteria 2841
201 Ga0496106_0075049 3300048909 Bacteria 2589
202 Ga0496107_0053053 3300048910 Bacteria 2925
203 Ga0496107_0205833 3300048910 Bacteria 1462
204 Ga0496110_0348231 3300048913 Bacteria 1349
205 Ga0496111_0099871 3300048914 Bacteria 2131
206 Ga0496112_0057916 3300048915 Bacteria 3815
207 Ga0496112_0103712 3300048915 Bacteria 2814
208 Ga0496113_0042262 3300048916 Bacteria 3367
209 Ga0496113_0113289 3300048916 Bacteria 2114
210 Ga0496114_0020990 3300048917 Bacteria 5306
211 Ga0496114_0422706 3300048917 Bacteria 1180
212 Ga0496116_0000159 3300048919 Bacteria 138102
213 Ga0496117_0000167 3300048920 Bacteria 138102
214 Ga0496117_0000184 3300048920 Bacteria 127675
215 Ga0496117_0001288 3300048920 Bacteria 36949
216 Ga0496117_0002253 3300048920 Bacteria 24900
217 Ga0496118_0000121 3300048921 Bacteria 138102
218 Ga0496118_0000142 3300048921 Bacteria 126087
219 Ga0496118_0003655 3300048921 Bacteria 19103
220 Ga0496118_0053752 3300048921 Bacteria 3057
221 Ga0496119_0000577 3300048922 Bacteria 49361
222 Ga0496119_0005696 3300048922 Bacteria 11816
223 Ga0496119_0015725 3300048922 Bacteria 5802
224 Ga0496119_0020374 3300048922 Bacteria 4841
225 Ga0496119_0084611 3300048922 Bacteria 1818
226 Ga0496119_0108133 3300048922 Bacteria 1549
227 Ga0496119_0122602 3300048922 Bacteria 1427
228 Ga0496120_0009809 3300048923 Bacteria 6748
229 Ga0496120_0013989 3300048923 Bacteria 5368
230 Ga0496120_0015637 3300048923 Bacteria 4996
231 Ga0496120_0061252 3300048923 Bacteria 2102
232 Ga0496121_0000025 3300048924 Bacteria 453467
233 Ga0496121_0000062 3300048924 Bacteria 274819
234 Ga0496122_0001203 3300048925 Bacteria 44067
235 Ga0496122_0128193 3300048925 Bacteria 1619
236 Ga0496123_0000009 3300048926 Bacteria 509486
237 Ga0496123_0023426 3300048926 Bacteria 4726
238 Ga0496124_0000090 3300048927 Bacteria 192095
239 Ga0496124_0012255 3300048927 Bacteria 8477
240 Ga0496124_0267608 3300048927 Bacteria 1253
241 Ga0496125_0012109 3300048928 Bacteria 8581
242 Ga0496125_0065122 3300048928 Bacteria 2890
243 Ga0496126_0000368 3300048929 Bacteria 92918
244 Ga0496126_0155202 3300048929 Bacteria 1959
245 Ga0501031_0002760 3300049568 Bacteria 11188
246 Ga0501031_0018629 3300049568 Bacteria 4521
247 Ga0501032_0000266 3300049569 Bacteria 44067
248 Ga0501032_0004511 3300049569 Bacteria 10478
249 Ga0501032_0048071 3300049569 Bacteria 2880
250 Ga0501032_0058704 3300049569 Bacteria 2583
251 Ga0501033_0006256 3300049570 Bacteria 9330
252 Ga0501033_0068969 3300049570 Bacteria 2599
253 Ga0501034_0000112 3300049571 Bacteria 150146
254 Ga0501034_0001221 3300049571 Bacteria 35159
255 Ga0501034_0010024 3300049571 Bacteria 9897
256 Ga0501034_0114003 3300049571 Bacteria 2692
257 Ga0501036_0021805 3300049572 Bacteria 5384
258 Ga0501037_0003004 3300049573 Bacteria 12247
259 Ga0501037_0025932 3300049573 Bacteria 4330
260 Ga0501037_0042166 3300049573 Bacteria 3354
261 Ga0501038_0007696 3300049574 Bacteria 9934
262 Ga0501038_0026085 3300049574 Bacteria 5205
263 Ga0501038_0070461 3300049574 Bacteria 2968
264 Ga0501039_0000081 3300049575 Bacteria 72305
265 Ga0501042_0092322 3300049578 Bacteria 2173
266 Ga0501043_0000249 3300049579 Bacteria 48895
267 Ga0501043_0014511 3300049579 Bacteria 6168
268 Ga0501043_0077107 3300049579 Bacteria 2618
269 Ga0501043_0127905 3300049579 Bacteria 1991
270 Ga0501046_0000206 3300049580 Bacteria 61319
271 Ga0501046_0017262 3300049580 Bacteria 6027
272 Ga0501046_0177497 3300049580 Bacteria 1594
273 Ga0501047_0000760 3300049581 Bacteria 33710
274 Ga0501047_0008498 3300049581 Bacteria 9683
275 Ga0501047_0074949 3300049581 Bacteria 3256
276 Ga0501047_0150977 3300049581 Bacteria 2199
277 Ga0501048_0000428 3300049582 Bacteria 29576
278 Ga0501048_0128293 3300049582 Bacteria 1793
279 Ga0501067_0007009 3300049583 Bacteria 6258
280 Ga0501068_0007803 3300049584 Bacteria 5928
281 Ga0501069_0002225 3300049585 Bacteria 9779
282 Ga0501070_0011287 3300049586 Bacteria 7547
283 Ga0501073_0011943 3300049589 Bacteria 6341
284 Ga0501074_0000045 3300049590 Bacteria 58704
285 Ga0501079_0343629 3300049741 Bacteria 1169
286 Ga0501080_0005176 3300049742 Bacteria 11618
287 Ga0501080_0265068 3300049742 Bacteria 1564
288 Ga0501083_0061222 3300049744 Bacteria 2513
289 Ga0501035_0000980 3300049822 Bacteria 30233
290 Ga0501035_0045467 3300049822 Bacteria 3950
291 Ga0501035_0160443 3300049822 Bacteria 1946
292 Ga0501035_0204579 3300049822 Bacteria 1691
293 Ga0501044_0042837 3300049823 Bacteria 4706
294 Ga0501044_0332689 3300049823 Bacteria 1441
295 nmdc:mga00v17_101497_c1 3300050491 Bacteria 1816
296 nmdc:mga00v17_21981_c1 3300050491 Bacteria 2293
297 Ga0500616_0001620 3300053153 Bacteria 20932
298 Ga0501084_0015038 3300054114 Bacteria 6417

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048928 Ga0496125_0065122 Ga0496125_0065122_1244_2161 264
2 3300048925 Ga0496122_0001203 Ga0496122_0001203_554_1504 275
3 3300048926 Ga0496123_0000009 Ga0496123_0000009_233155_234105 275
4 3300048927 Ga0496124_0012255 Ga0496124_0012255_5719_6669 275
5 3300048929 Ga0496126_0155202 Ga0496126_0155202_797_1747 275
6 3300048921 Ga0496118_0053752 Ga0496118_0053752_1527_2444 281
7 3300044683 Ga0466965_0016078 Ga0466965_0016078_408_1376 282
8 3300048925 Ga0496122_0128193 Ga0496122_0128193_124_1077 284
9 3300048927 Ga0496124_0267608 Ga0496124_0267608_38_991 284
10 3300046538 Ga0495609_0092022 Ga0495609_0092022_211_1164 285
11 3300031901 Ga0307406_10180612 Ga0307406_101806122 287
12 3300048923 Ga0496120_0061252 Ga0496120_0061252_907_1812 288
13 3300031548 Ga0307408_100154951 Ga0307408_1001549512 290
14 3300031731 Ga0307405_10064425 Ga0307405_100644252 290
15 3300048922 Ga0496119_0005696 Ga0496119_0005696_2597_3502 290
16 3300020077 Ga0206351_10230950 Ga0206351_102309503 292
17 3300005548 Ga0070665_100339217 Ga0070665_1003392172 293
18 3300031731 Ga0307405_10094938 Ga0307405_100949382 293
19 3300031903 Ga0307407_10119215 Ga0307407_101192152 293
20 3300048920 Ga0496117_0002253 Ga0496117_0002253_22710_23663 293
21 3300048928 Ga0496125_0012109 Ga0496125_0012109_6865_7818 293
22 3300048922 Ga0496119_0122602 Ga0496119_0122602_238_1191 294
23 3300013102 Ga0157371_10035865 Ga0157371_100358653 295
24 3300013105 Ga0157369_10301673 Ga0157369_103016732 295
25 3300013307 Ga0157372_10113461 Ga0157372_101134612 295
26 3300048922 Ga0496119_0084611 Ga0496119_0084611_471_1424 295
27 3300044765 Ga0466970_0008733 Ga0466970_0008733_3480_4433 296
28 3300046535 Ga0495586_0049335 Ga0495586_0049335_491_1444 298
29 3300048915 Ga0496112_0057916 Ga0496112_0057916_1840_2793 299
30 3300048920 Ga0496117_0000184 Ga0496117_0000184_43973_44926 299
31 3300048921 Ga0496118_0000142 Ga0496118_0000142_66373_67326 299
32 3300048922 Ga0496119_0020374 Ga0496119_0020374_1262_2215 299
33 3300048923 Ga0496120_0015637 Ga0496120_0015637_3665_4618 299
34 3300048926 Ga0496123_0023426 Ga0496123_0023426_2209_3162 299
35 3300048927 Ga0496124_0000090 Ga0496124_0000090_92992_93945 299
36 3300037466 Ga0395898_0287646 Ga0395898_0287646_210_1175 301
37 3300038443 Ga0395901_0269070 Ga0395901_0269070_661_1626 301
38 3300037312 Ga0395899_0022591 Ga0395899_0022591_1317_2294 302
39 3300037312 Ga0395899_0054024 Ga0395899_0054024_304_1257 302
40 3300037312 Ga0395899_0101863 Ga0395899_0101863_600_1553 302
41 3300037418 Ga0395900_0079156 Ga0395900_0079156_926_1879 302
42 3300037418 Ga0395900_0092053 Ga0395900_0092053_2103_3056 302
43 3300037418 Ga0395900_0117785 Ga0395900_0117785_494_1471 302
44 3300037466 Ga0395898_0014559 Ga0395898_0014559_6637_7590 302
45 3300037466 Ga0395898_0102989 Ga0395898_0102989_965_1942 302
46 3300037471 Ga0395905_0031881 Ga0395905_0031881_2442_3419 302
47 3300038443 Ga0395901_0042663 Ga0395901_0042663_2801_3778 302
48 3300038443 Ga0395901_0052333 Ga0395901_0052333_2095_3048 302
49 3300048920 Ga0496117_0001288 Ga0496117_0001288_9113_10063 302
50 3300048921 Ga0496118_0003655 Ga0496118_0003655_8768_9718 302
51 3300049571 Ga0501034_0114003 Ga0501034_0114003_94_1095 302
52 3300002773 JGI25152J39213_1000668 JGI25152J39213_10006682 303
53 3300013105 Ga0157369_10097848 Ga0157369_100978482 303
54 3300025258 Ga0209129_1000064 Ga0209129_1000064181 303
55 3300025294 Ga0209025_1001863 Ga0209025_100186322 303
56 3300049580 Ga0501046_0017262 Ga0501046_0017262_4443_5444 303
57 3300032002 Ga0307416_100020759 Ga0307416_1000207595 304
58 3300041413 Ga0439465_0019080 Ga0439465_0019080_263_1177 304
59 3300041512 Ga0451853_1743894 Ga0451853_1743894_478_1395 304
60 3300046507 Ga0495606_0020136 Ga0495606_0020136_3113_4027 304
61 3300048903 Ga0496100_0008250 Ga0496100_0008250_4749_5663 304
62 3300048904 Ga0496101_0000037 Ga0496101_0000037_48902_49816 304
63 3300048905 Ga0496102_0000083 Ga0496102_0000083_67497_68411 304
64 3300048906 Ga0496103_0000060 Ga0496103_0000060_67921_68835 304
65 3300048908 Ga0496105_0089746 Ga0496105_0089746_697_1611 304
66 3300048909 Ga0496106_0015015 Ga0496106_0015015_1049_1963 304
67 3300048910 Ga0496107_0053053 Ga0496107_0053053_1320_2234 304
68 3300048919 Ga0496116_0000159 Ga0496116_0000159_69692_70606 304
69 3300048920 Ga0496117_0000167 Ga0496117_0000167_67497_68411 304
70 3300048921 Ga0496118_0000121 Ga0496118_0000121_69692_70606 304
71 3300048922 Ga0496119_0015725 Ga0496119_0015725_4176_5090 304
72 3300048923 Ga0496120_0009809 Ga0496120_0009809_3453_4367 304
73 3300048924 Ga0496121_0000062 Ga0496121_0000062_269248_270162 304
74 3300049568 Ga0501031_0002760 Ga0501031_0002760_5168_6142 304
75 3300049569 Ga0501032_0000266 Ga0501032_0000266_4954_5928 304
76 3300049571 Ga0501034_0010024 Ga0501034_0010024_5316_6290 304
77 3300049573 Ga0501037_0003004 Ga0501037_0003004_5480_6454 304
78 3300049574 Ga0501038_0007696 Ga0501038_0007696_5181_6155 304
79 3300049575 Ga0501039_0000081 Ga0501039_0000081_5449_6423 304
80 3300049579 Ga0501043_0000249 Ga0501043_0000249_5529_6503 304
81 3300049580 Ga0501046_0000206 Ga0501046_0000206_11937_12911 304
82 3300049581 Ga0501047_0008498 Ga0501047_0008498_4945_5919 304
83 3300049582 Ga0501048_0000428 Ga0501048_0000428_15229_16203 304
84 3300049583 Ga0501067_0007009 Ga0501067_0007009_5262_6236 304
85 3300049584 Ga0501068_0007803 Ga0501068_0007803_540_1514 304
86 3300049585 Ga0501069_0002225 Ga0501069_0002225_3842_4816 304
87 3300049586 Ga0501070_0011287 Ga0501070_0011287_2933_3907 304
88 3300049589 Ga0501073_0011943 Ga0501073_0011943_4889_5863 304
89 3300049590 Ga0501074_0000045 Ga0501074_0000045_52378_53352 304
90 3300049742 Ga0501080_0005176 Ga0501080_0005176_5605_6579 304
91 3300049744 Ga0501083_0061222 Ga0501083_0061222_1250_2224 304
92 3300049822 Ga0501035_0000980 Ga0501035_0000980_22511_23485 304
93 3300049823 Ga0501044_0042837 Ga0501044_0042837_3608_4582 304
94 3300054114 Ga0501084_0015038 Ga0501084_0015038_478_1452 304
95 3300009148 Ga0105243_10140795 Ga0105243_101407951 305
96 3300011119 Ga0105246_10007374 Ga0105246_100073748 305
97 3300025935 Ga0207709_10059873 Ga0207709_100598732 305
98 3300037418 Ga0395900_0042993 Ga0395900_0042993_1037_2002 307
99 3300037466 Ga0395898_0050557 Ga0395898_0050557_2144_3109 307
100 3300038443 Ga0395901_0027767 Ga0395901_0027767_2877_3842 307
101 3300044658 Ga0466972_0128963 Ga0466972_0128963_183_1157 307
102 3300044683 Ga0466965_0047479 Ga0466965_0047479_1084_2058 307
103 3300044842 Ga0466957_0180335 Ga0466957_0180335_352_1326 307
104 3300031548 Ga0307408_100162414 Ga0307408_1001624142 309
105 3300032002 Ga0307416_100072744 Ga0307416_1000727443 309
106 3300013104 Ga0157370_10194637 Ga0157370_101946372 310
107 3300013105 Ga0157369_10067766 Ga0157369_100677663 310
108 3300048916 Ga0496113_0113289 Ga0496113_0113289_973_1926 310
109 iso_pu_bacteria 2758568621 2760622947 311
110 iso_pu_bacteria 2808606447 2809225339 311
111 iso_pu_bacteria 8056579771 8056581103 311
112 iso_pu_bacteria 2554235227 2555230423 312
113 iso_pu_bacteria 2687453129 2687580815 312
114 iso_pu_bacteria 2773857763 2774397863 312
115 iso_pu_bacteria 2808606306 2808629816 312
116 iso_pu_bacteria 2811994872 2812324720 312
117 iso_pu_bacteria 2821268502 2821271324 312
118 iso_pu_bacteria 2833709550 2833712593 312
119 iso_pu_bacteria 2902792274 2902795675 312
120 iso_pu_bacteria 2929212328 2929213062 312
121 iso_pu_bacteria 2946080515 2946083711 312
122 iso_pu_bacteria 8045830549 8045833598 312
123 iso_pu_bacteria 2751185788 2753300214 313
124 iso_pu_bacteria 2775506735 2775658476 313
125 iso_pu_bacteria 2808606357 2808830083 313
126 iso_pu_bacteria 2808606360 2808851259 313
127 iso_pu_bacteria 2808606366 2808876216 313
128 iso_pu_bacteria 2808606371 2808897718 313
129 iso_pu_bacteria 2808606700 2810365702 313
130 iso_pu_bacteria 2811994871 2812318141 313
131 iso_pu_bacteria 2844849076 2844850342 313
132 iso_pu_bacteria 2848551377 2848554292 313
133 iso_pu_bacteria 2857729791 2857731894 313
134 iso_pu_bacteria 2905926851 2905928871 313
135 iso_pu_bacteria 2909074476 2909076365 313
136 iso_pu_bacteria 2919039151 2919040360 313
137 iso_pu_bacteria 2919042368 2919044369 313
138 iso_pu_bacteria 2919051321 2919054288 313
139 iso_pu_bacteria 2928104781 2928105775 313
140 iso_pu_bacteria 2928121344 2928124243 313
141 iso_pu_bacteria 2939598168 2939599389 313
142 iso_pu_bacteria 2945916053 2945920239 313
143 iso_pu_bacteria 2946003308 2946005990 313
144 iso_pu_bacteria 2946059875 2946063956 313
145 iso_pu_bacteria 2964326757 2964329616 313
146 iso_pu_bacteria 2984551494 2984552287 313
147 iso_pu_bacteria 2739367654 2739604870 314
148 iso_pu_bacteria 2758568522 2760303247 314
149 iso_pu_bacteria 2808606394 2809028077 314
150 iso_pu_bacteria 2902837492 2902840413 314
151 iso_pu_bacteria 2835188231 2835190884 315
152 iso_pu_bacteria 2852646457 2852647661 315
153 iso_pu_bacteria 2887443736 2887445296 315
154 iso_pu_bacteria 2928090899 2928093253 315
155 iso_pu_bacteria 2945968032 2945968829 315
156 iso_pu_bacteria 2946033335 2946036507 315
157 iso_pu_bacteria 2984580707 2984583123 315
158 3300005327 Ga0070658_10000285 Ga0070658_1000028512 316
159 3300005327 Ga0070658_10016689 Ga0070658_100166896 316
160 3300005339 Ga0070660_100113998 Ga0070660_1001139982 316
161 3300005366 Ga0070659_100025982 Ga0070659_1000259824 316
162 3300005455 Ga0070663_100242758 Ga0070663_1002427582 316
163 3300005459 Ga0068867_100519907 Ga0068867_1005199071 316
164 3300005539 Ga0068853_100037394 Ga0068853_1000373944 316
165 3300005539 Ga0068853_100051876 Ga0068853_1000518761 316
166 3300013102 Ga0157371_10122055 Ga0157371_101220553 316
167 3300013104 Ga0157370_10008333 Ga0157370_1000833311 316
168 3300013104 Ga0157370_10010921 Ga0157370_100109213 316
169 3300025909 Ga0207705_10000001 Ga0207705_10000001557 316
170 3300025919 Ga0207657_10255848 Ga0207657_102558482 316
171 3300025932 Ga0207690_10006404 Ga0207690_100064044 316
172 3300026067 Ga0207678_10337526 Ga0207678_103375262 316
173 3300032002 Ga0307416_100666230 Ga0307416_1006662302 316
174 3300042438 Ga0439459_0004966 Ga0439459_0004966_174_1124 316
175 3300044658 Ga0466972_0010736 Ga0466972_0010736_220_1170 316
176 3300044683 Ga0466965_0002335 Ga0466965_0002335_258_1208 316
177 3300044901 Ga0466960_0000047 Ga0466960_0000047_27149_28099 316
178 3300047472 Ga0495686_0001484 Ga0495686_0001484_143_1093 316
179 3300048922 Ga0496119_0000577 Ga0496119_0000577_24188_25171 316
180 3300048923 Ga0496120_0013989 Ga0496120_0013989_72_1055 316
181 3300048924 Ga0496121_0000025 Ga0496121_0000025_384244_385227 316
182 3300048929 Ga0496126_0000368 Ga0496126_0000368_89566_90516 316
183 3300049569 Ga0501032_0058704 Ga0501032_0058704_666_1640 316
184 3300049573 Ga0501037_0025932 Ga0501037_0025932_581_1555 316
185 3300049581 Ga0501047_0000760 Ga0501047_0000760_3348_4322 316
186 3300049822 Ga0501035_0045467 Ga0501035_0045467_59_1033 316
187 3300053153 Ga0500616_0001620 Ga0500616_0001620_4898_5848 316
188 3300013105 Ga0157369_10172378 Ga0157369_101723782 317
189 3300049568 Ga0501031_0018629 Ga0501031_0018629_1430_2383 317
190 3300049569 Ga0501032_0048071 Ga0501032_0048071_83_1036 317
191 3300049570 Ga0501033_0006256 Ga0501033_0006256_6852_7805 317
192 3300049570 Ga0501033_0068969 Ga0501033_0068969_1055_2014 317
193 3300049572 Ga0501036_0021805 Ga0501036_0021805_2294_3247 317
194 3300049574 Ga0501038_0070461 Ga0501038_0070461_1454_2407 317
195 3300049578 Ga0501042_0092322 Ga0501042_0092322_495_1448 317
196 3300049579 Ga0501043_0127905 Ga0501043_0127905_748_1701 317
197 3300049580 Ga0501046_0177497 Ga0501046_0177497_549_1502 317
198 3300049581 Ga0501047_0074949 Ga0501047_0074949_1742_2695 317
199 3300049581 Ga0501047_0150977 Ga0501047_0150977_790_1749 317
200 3300049582 Ga0501048_0128293 Ga0501048_0128293_93_1046 317
201 3300049741 Ga0501079_0343629 Ga0501079_0343629_55_1008 317
202 3300049742 Ga0501080_0265068 Ga0501080_0265068_519_1472 317
203 3300049822 Ga0501035_0160443 Ga0501035_0160443_434_1387 317
204 3300049822 Ga0501035_0204579 Ga0501035_0204579_23_982 317
205 iso_pu_bacteria 2919538618 2919539162 317
206 3300006051 Ga0075364_10028398 Ga0075364_100283983 318
207 3300031548 Ga0307408_100040806 Ga0307408_1000408064 318
208 3300031548 Ga0307408_100203486 Ga0307408_1002034862 318
209 3300041452 Ga0451793_0262462 Ga0451793_0262462_94_1056 318
210 3300047315 Ga0495581_0077520 Ga0495581_0077520_491_1477 318
211 3300050491 nmdc:mga00v17_101497_c1 nmdc:mga00v17_101497_c1_396_1370 318
212 3300050491 nmdc:mga00v17_21981_c1 nmdc:mga00v17_21981_c1_684_1646 318
213 iso_pu_bacteria 2883821847 2883824389 318
214 iso_pu_bacteria 2919391150 2919394013 318
215 iso_pu_bacteria 2945920336 2945921982 318
216 iso_pu_bacteria 2945956166 2945957421 318
217 iso_pu_bacteria 2946037020 2946037770 318
218 3300031824 Ga0307413_10363964 Ga0307413_103639641 319
219 iso_pu_bacteria 2904497146 2904499197 319
220 iso_pu_bacteria 2919034639 2919035645 319
221 iso_pu_bacteria 2919059106 2919060345 319
222 iso_pu_bacteria 2932426870 2932427743 319
223 iso_pu_bacteria 2933418574 2933418693 319
224 iso_pu_bacteria 2939647034 2939650130 319
225 iso_pu_bacteria 2939674588 2939677615 319
226 3300037312 Ga0395899_0027429 Ga0395899_0027429_825_1790 320
227 3300037418 Ga0395900_0057637 Ga0395900_0057637_2483_3448 320
228 3300037466 Ga0395898_0002890 Ga0395898_0002890_5527_6492 320
229 iso_pu_bacteria 2690315906 2691512130 320
230 iso_pu_bacteria 2808606370 2808891426 320
231 iso_pu_bacteria 2945920336 2945920931 320
232 iso_pu_bacteria 2946037020 2946038821 320
233 iso_pu_bacteria 8004021418 8004025280 320
234 iso_pu_bacteria 8004025490 8004026844 320
235 iso_pu_bacteria 2904776348 2904778288 321
236 iso_pu_bacteria 2910809715 2910813604 321
237 3300027907 Ga0207428_10052618 Ga0207428_100526182 322
238 3300031548 Ga0307408_100090542 Ga0307408_1000905423 322
239 3300031731 Ga0307405_10054246 Ga0307405_100542462 322
240 3300031824 Ga0307413_10037079 Ga0307413_100370792 322
241 3300031852 Ga0307410_10154027 Ga0307410_101540271 322
242 3300031911 Ga0307412_10075190 Ga0307412_100751901 322
243 3300032002 Ga0307416_100087443 Ga0307416_1000874431 322
244 3300032002 Ga0307416_100366238 Ga0307416_1003662382 322
245 3300032005 Ga0307411_10092540 Ga0307411_100925402 322
246 3300037312 Ga0395899_0013212 Ga0395899_0013212_893_1861 322
247 3300037418 Ga0395900_0190277 Ga0395900_0190277_950_1921 322
248 3300037466 Ga0395898_0052174 Ga0395898_0052174_516_1487 322
249 3300042007 Ga0439449_0003937 Ga0439449_0003937_385_1353 322
250 3300044683 Ga0466965_0001682 Ga0466965_0001682_2447_3445 322
251 3300044693 Ga0466961_0134477 Ga0466961_0134477_123_1094 322
252 3300044765 Ga0466970_0124256 Ga0466970_0124256_351_1322 322
253 3300048906 Ga0496103_0045206 Ga0496103_0045206_1441_2409 322
254 3300049571 Ga0501034_0001221 Ga0501034_0001221_5716_6711 322
255 3300049574 Ga0501038_0026085 Ga0501038_0026085_1243_2211 322
256 3300049579 Ga0501043_0077107 Ga0501043_0077107_1054_2022 322
257 3300049823 Ga0501044_0332689 Ga0501044_0332689_256_1230 322
258 iso_pu_bacteria 2857740372 2857740756 322
259 3300005328 Ga0070676_10023941 Ga0070676_100239411 323
260 3300005333 Ga0070677_10004894 Ga0070677_100048941 323
261 3300005335 Ga0070666_10013301 Ga0070666_100133014 323
262 3300005353 Ga0070669_100023385 Ga0070669_1000233853 323
263 3300005354 Ga0070675_100050262 Ga0070675_1000502623 323
264 3300005364 Ga0070673_100008443 Ga0070673_1000084435 323
265 3300005367 Ga0070667_100080429 Ga0070667_1000804292 323
266 3300005543 Ga0070672_100265124 Ga0070672_1002651242 323
267 3300005548 Ga0070665_100041982 Ga0070665_1000419823 323
268 3300006058 Ga0075432_10000086 Ga0075432_1000008617 323
269 3300009148 Ga0105243_10049730 Ga0105243_100497304 323
270 3300009148 Ga0105243_10165302 Ga0105243_101653022 323
271 3300009177 Ga0105248_10192394 Ga0105248_101923943 323
272 3300011119 Ga0105246_10027834 Ga0105246_100278344 323
273 3300011119 Ga0105246_10064879 Ga0105246_100648793 323
274 3300013105 Ga0157369_10065954 Ga0157369_100659544 323
275 3300017792 Ga0163161_10057560 Ga0163161_100575603 323
276 3300025315 Ga0207697_10024915 Ga0207697_100249153 323
277 3300025728 Ga0207655_1005593 Ga0207655_10055936 323
278 3300025735 Ga0207713_1022503 Ga0207713_10225032 323
279 3300025907 Ga0207645_10009185 Ga0207645_100091853 323
280 3300025923 Ga0207681_10010088 Ga0207681_100100883 323
281 3300025940 Ga0207691_10002705 Ga0207691_100027054 323
282 3300025941 Ga0207711_10156998 Ga0207711_101569983 323
283 3300025986 Ga0207658_10040496 Ga0207658_100404962 323
284 3300026121 Ga0207683_10029694 Ga0207683_100296944 323
285 3300027907 Ga0207428_10029359 Ga0207428_100293594 323
286 3300028379 Ga0268266_10209788 Ga0268266_102097882 323
287 3300031548 Ga0307408_100006695 Ga0307408_1000066957 323
288 3300031548 Ga0307408_100016378 Ga0307408_1000163782 323
289 3300031548 Ga0307408_100023867 Ga0307408_1000238673 323
290 3300031548 Ga0307408_100027110 Ga0307408_1000271103 323
291 3300031731 Ga0307405_10005885 Ga0307405_100058854 323
292 3300031731 Ga0307405_10013138 Ga0307405_100131382 323
293 3300031731 Ga0307405_10031349 Ga0307405_100313493 323
294 3300031731 Ga0307405_10042145 Ga0307405_100421453 323
295 3300031731 Ga0307405_10066610 Ga0307405_100666102 323
296 3300031824 Ga0307413_10014809 Ga0307413_100148093 323
297 3300031824 Ga0307413_10175904 Ga0307413_101759042 323
298 3300031852 Ga0307410_10007852 Ga0307410_100078525 323
299 3300031852 Ga0307410_10025880 Ga0307410_100258803 323
300 3300031852 Ga0307410_10035239 Ga0307410_100352393 323
301 3300031901 Ga0307406_10073627 Ga0307406_100736271 323
302 3300031903 Ga0307407_10006997 Ga0307407_100069974 323
303 3300031903 Ga0307407_10014578 Ga0307407_100145783 323
304 3300031911 Ga0307412_10006307 Ga0307412_100063075 323
305 3300031911 Ga0307412_10013841 Ga0307412_100138414 323
306 3300031911 Ga0307412_10030903 Ga0307412_100309033 323
307 3300031911 Ga0307412_10038000 Ga0307412_100380003 323
308 3300031911 Ga0307412_10047528 Ga0307412_100475283 323
309 3300031995 Ga0307409_100009453 Ga0307409_1000094533 323
310 3300031995 Ga0307409_100505698 Ga0307409_1005056982 323
311 3300032002 Ga0307416_100009514 Ga0307416_1000095144 323
312 3300032002 Ga0307416_100012216 Ga0307416_1000122165 323
313 3300032002 Ga0307416_100180063 Ga0307416_1001800632 323
314 3300032004 Ga0307414_10020241 Ga0307414_100202414 323
315 3300032004 Ga0307414_10050817 Ga0307414_100508172 323
316 3300032004 Ga0307414_10177510 Ga0307414_101775102 323
317 3300032005 Ga0307411_10076246 Ga0307411_100762463 323
318 3300032126 Ga0307415_100009634 Ga0307415_1000096343 323
319 3300032126 Ga0307415_100011918 Ga0307415_1000119182 323
320 3300032126 Ga0307415_100109120 Ga0307415_1001091202 323
321 3300032126 Ga0307415_100254511 Ga0307415_1002545111 323
322 3300041404 Ga0439436_0003646 Ga0439436_0003646_3403_4404 323
323 3300041405 Ga0439438_028126 Ga0439438_028126_16_1017 323
324 3300042007 Ga0439449_0000948 Ga0439449_0000948_1602_2603 323
325 3300042435 Ga0439434_0046986 Ga0439434_0046986_65_1066 323
326 3300046471 Ga0495650_0000508 Ga0495650_0000508_9512_10519 323
327 3300046472 Ga0495580_0005331 Ga0495580_0005331_4165_5154 323
328 3300046475 Ga0495639_0003861 Ga0495639_0003861_414_1400 323
329 3300046476 Ga0495662_0082656 Ga0495662_0082656_509_1492 323
330 3300046477 Ga0495664_0069672 Ga0495664_0069672_1066_2049 323
331 3300046535 Ga0495586_0010621 Ga0495586_0010621_2338_3324 323
332 3300046535 Ga0495586_0070379 Ga0495586_0070379_92_1075 323
333 3300046615 Ga0495656_0150204 Ga0495656_0150204_96_1082 323
334 3300046674 Ga0495588_0004632 Ga0495588_0004632_1487_2473 323
335 3300046674 Ga0495588_0019370 Ga0495588_0019370_412_1398 323
336 3300046679 Ga0495623_0029644 Ga0495623_0029644_1419_2402 323
337 3300046691 Ga0495670_0056177 Ga0495670_0056177_927_1913 323
338 3300047315 Ga0495581_0061759 Ga0495581_0061759_38_1024 323
339 3300047315 Ga0495581_0097384 Ga0495581_0097384_468_1454 323
340 3300047444 Ga0495675_0053379 Ga0495675_0053379_140_1123 323
341 3300047470 Ga0495681_0050577 Ga0495681_0050577_87_1073 323
342 3300047673 Ga0495593_0020732 Ga0495593_0020732_2069_3055 323
343 3300048905 Ga0496102_0085195 Ga0496102_0085195_1841_2830 323
344 3300048905 Ga0496102_0119523 Ga0496102_0119523_257_1243 323
345 3300048905 Ga0496102_0241393 Ga0496102_0241393_181_1167 323
346 3300048907 Ga0496104_0476470 Ga0496104_0476470_105_1091 323
347 3300048908 Ga0496105_0088277 Ga0496105_0088277_584_1570 323
348 3300048909 Ga0496106_0061859 Ga0496106_0061859_1360_2346 323
349 3300048909 Ga0496106_0075049 Ga0496106_0075049_1565_2551 323
350 3300048910 Ga0496107_0205833 Ga0496107_0205833_25_1011 323
351 3300048913 Ga0496110_0348231 Ga0496110_0348231_56_1042 323
352 3300048914 Ga0496111_0099871 Ga0496111_0099871_452_1438 323
353 3300048915 Ga0496112_0103712 Ga0496112_0103712_253_1242 323
354 3300048916 Ga0496113_0042262 Ga0496113_0042262_1603_2589 323
355 3300048917 Ga0496114_0422706 Ga0496114_0422706_124_1110 323
356 3300048922 Ga0496119_0108133 Ga0496119_0108133_352_1338 323
357 3300049569 Ga0501032_0004511 Ga0501032_0004511_6135_7127 323
358 3300049571 Ga0501034_0000112 Ga0501034_0000112_133819_134811 323
359 3300049573 Ga0501037_0042166 Ga0501037_0042166_111_1103 323
360 3300049579 Ga0501043_0014511 Ga0501043_0014511_929_1921 323
361 3300011119 Ga0105246_10014838 Ga0105246_100148384 325
362 3300025303 Ga0209051_1002275 Ga0209051_10022753 325
363 3300025728 Ga0207655_1009434 Ga0207655_10094343 325
364 3300025935 Ga0207709_10217221 Ga0207709_102172212 325
365 3300000549 LJQas_1000374 LJQas_10003743 326
366 3300000549 LJQas_1000664 LJQas_10006647 326
367 3300013296 Ga0157374_10276589 Ga0157374_102765893 326
368 3300014969 Ga0157376_10171234 Ga0157376_101712342 326
369 3300048917 Ga0496114_0020990 Ga0496114_0020990_3227_4273 326

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02737

3HCDH_N

3-hydroxyacyl-CoA dehydrogenase, NAD binding domain

36

216

0.99

PF00725

3HCDH

3-hydroxyacyl-CoA dehydrogenase, C-terminal domain

218

316

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7fgp-assembly1.cif.gz_B crystal structure of aureimonas altamirenisis flavin-containing opine dehydrogenase (fad-bound form) 0.9591 13 42
4j33-assembly1.cif.gz_A crystal structure of kynurenine 3-monooxygenase (kmo-394) 0.9508 12 44
5x6r-assembly1.cif.gz_A crystal structure of saccharomyces cerevisiae kmo in complex with ro 61-8048 0.948 12 44
4j33-assembly2.cif.gz_B crystal structure of kynurenine 3-monooxygenase (kmo-394) 0.948 12 44
4j36-assembly1.cif.gz_A cocrystal structure of kynurenine 3-monooxygenase in complex with upf 648 inhibitor(kmo-394upf) 0.9474 14 44
ID Description Score Start End Superfamily
af_A0A0R0JSV2_33_153_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9554 74 198 3.40.50.720
2eq6B02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9538 13 41 3.50.50.60
af_Q54VB8_19_206_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9474 13 198 3.40.50.720
2wtbA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9474 13 196 3.40.50.720
af_I1MHA5_112_472_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9469 14 41 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A399TPB3-F1-model_v4 deleted 0.9908 12 326
AF-A0A1A7XAH6-F1-model_v4 Enoyl-Coenzyme A, hydratase/3-hydroxyacyl Coenzyme A dehydrogenase 0.9833 93 202 GO:0003857
GO:0005777
GO:0006635
GO:0016829
GO:0016853
GO:0070403
AF-A0A519DPZ4-F1-model_v4 deleted 0.9831 11 132
AF-A0A399TPB3-F1-model_v4 deleted 0.9815 12 326
AF-A0A2U1SZB5-F1-model_v4 3-hydroxyacyl-CoA dehydrogenase 0.9787 12 320 GO:0006631
GO:0009056
GO:0016616
GO:0070403

Feature Viewer

pLDDT pTM Quality
93.48 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map