F424941

General Info

Members Datasets Scaffolds Average Seq Length
369 218 738 245

Family's Representative Sequence

Representative Sequence 3300005340|Ga0070689_100000002|Ga0070689_100000002368
Length 269
Sequence VKVVLLGATKGMGRALARNLVSPPGGDPAGKPRRPKLEESKVEKPQIDLFLLGRDETDLARSARDLEVRGGRPVNSVGSAVCDLAKPDTFGPALDAAQRALGGIEVVVVTAGLFATQEKLEADPAFTARMLDANFTGTVLFCEEARKRLLARGGGTLCVFSSVAGERGRKPVILYGAAKAGLSHYLEGLDHKFRASGLKVITVKPGFVKTAMTAGLPVPPFAGDPDRVASLVLAAIERGAPVVYAPRIWGLIMLVIRQLPRFVMRKLNF

Samples

Sample ID Description Type Environment
1 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
56 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
137 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
138 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
139 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
140 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
141 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
142 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
143 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
144 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
145 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
146 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
147 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
148 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
149 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
150 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
151 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
152 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
153 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
154 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
155 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
156 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
157 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
158 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
161 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
162 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
163 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
164 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
165 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
166 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
167 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
168 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
171 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
172 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
173 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
174 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
175 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
176 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
177 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
178 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
179 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
180 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
181 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
182 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
183 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
184 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
185 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
186 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
187 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
188 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
189 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
190 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
191 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
195 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
196 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
197 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
198 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
199 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
200 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
202 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
203 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
204 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
205 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
206 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
207 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
208 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
209 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
210 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
211 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
212 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
213 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
214 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
215 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
216 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
217 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
218 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.79
Nodule 0
Rhizoplane 2.44
Rhizosphere 93.77
Stem 0
Stem Tuber 0
Unclassified 13.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070689_100000002 3300005340 Bacteria 695141
2 Ga0065715_10002532 3300005293 Bacteria 8187
3 Ga0070658_10005419 3300005327 Bacteria 10350
4 Ga0070658_10171956 3300005327 Bacteria 1820
5 Ga0070676_10028674 3300005328 Bacteria 3162
6 Ga0070676_10029532 3300005328 Bacteria 3119
7 Ga0070683_100004430 3300005329 Bacteria 11577
8 Ga0070690_100055506 3300005330 Bacteria 2537
9 Ga0068869_100008601 3300005334 Bacteria 6590
10 Ga0068869_100123748 3300005334 Bacteria 1981
11 Ga0070666_10003786 3300005335 Bacteria 9169
12 Ga0070680_100004750 3300005336 Bacteria 10228
13 Ga0070682_100228783 3300005337 Bacteria 1328
14 Ga0070682_100243694 3300005337 Bacteria 1292
15 Ga0068868_100101609 3300005338 Bacteria 2327
16 Ga0068868_100112513 3300005338 Bacteria 2213
17 Ga0070660_100288061 3300005339 Bacteria 1345
18 Ga0070689_100045405 3300005340 Bacteria 3383
19 Ga0070687_100047741 3300005343 Bacteria 2198
20 Ga0070661_100482546 3300005344 Bacteria 990
21 Ga0070668_100259178 3300005347 Bacteria 1445
22 Ga0070675_100045529 3300005354 Bacteria 3590
23 Ga0070675_100216266 3300005354 Bacteria 1667
24 Ga0070671_100024286 3300005355 Bacteria 4962
25 Ga0070673_100007556 3300005364 Bacteria 7185
26 Ga0070688_100004245 3300005365 Bacteria 7452
27 Ga0070688_100066349 3300005365 Bacteria 2296
28 Ga0070688_100069192 3300005365 Bacteria 2253
29 Ga0070667_100282524 3300005367 Unclassified 1490
30 Ga0070713_100102267 3300005436 Bacteria 2484
31 Ga0070710_10345186 3300005437 Bacteria 984
32 Ga0070711_100321286 3300005439 Bacteria 1237
33 Ga0070705_100137914 3300005440 Bacteria 1601
34 Ga0070663_100178441 3300005455 Unclassified 1646
35 Ga0070681_10278179 3300005458 Bacteria 1585
36 Ga0068867_100024526 3300005459 Bacteria 4322
37 Ga0068867_100125908 3300005459 Bacteria 1985
38 Ga0070685_10024141 3300005466 Unclassified 3337
39 Ga0070685_10141384 3300005466 Bacteria 1516
40 Ga0070685_10145375 3300005466 Unclassified 1497
41 Ga0070706_100001395 3300005467 Bacteria 25557
42 Ga0070706_100146593 3300005467 Unclassified 2204
43 Ga0070707_100148267 3300005468 Bacteria 2284
44 Ga0070707_100155562 3300005468 Unclassified 2227
45 Ga0070698_100155085 3300005471 Bacteria 2236
46 Ga0070679_100016001 3300005530 Bacteria 7224
47 Ga0070684_100004428 3300005535 Bacteria 10692
48 Ga0070684_100109229 3300005535 Bacteria 2479
49 Ga0068853_100003012 3300005539 Bacteria 12861
50 Ga0070672_100207349 3300005543 Unclassified 1641
51 Ga0070686_100003080 3300005544 Bacteria 9133
52 Ga0070686_100021246 3300005544 Bacteria 3855
53 Ga0070686_100101134 3300005544 Bacteria 1948
54 Ga0070695_100076860 3300005545 Bacteria 2199
55 Ga0070696_100028467 3300005546 Bacteria 3814
56 Ga0070665_100147305 3300005548 Bacteria 2357
57 Ga0068855_100003532 3300005563 Bacteria 19108
58 Ga0068855_100630291 3300005563 Unclassified 1153
59 Ga0070664_100007388 3300005564 Bacteria 8863
60 Ga0068857_100067838 3300005577 Bacteria 3175
61 Ga0068857_100800412 3300005577 Bacteria 900
62 Ga0068856_100074515 3300005614 Bacteria 3361
63 Ga0068856_100112534 3300005614 Bacteria 2720
64 Ga0068856_100140864 3300005614 Bacteria 2419
65 Ga0068856_100189573 3300005614 Bacteria 2070
66 Ga0070702_100022351 3300005615 Bacteria 3341
67 Ga0070702_100052099 3300005615 Bacteria 2346
68 Ga0068852_100099403 3300005616 Bacteria 2623
69 Ga0068859_100036505 3300005617 Bacteria 4934
70 Ga0068859_100529243 3300005617 Unclassified 1273
71 Ga0068864_100164172 3300005618 Bacteria 2021
72 Ga0068861_100118338 3300005719 Unclassified 2134
73 Ga0068861_100147025 3300005719 Bacteria 1929
74 Ga0068870_10001682 3300005840 Bacteria 9038
75 Ga0068863_100002423 3300005841 Bacteria 18517
76 Ga0068858_100123443 3300005842 Unclassified 2423
77 Ga0068860_100009771 3300005843 Bacteria 9526
78 Ga0068860_100016824 3300005843 Bacteria 7130
79 Ga0068860_100225082 3300005843 Bacteria 1822
80 Ga0068860_100434581 3300005843 Unclassified 1303
81 Ga0068862_100108318 3300005844 Bacteria 2437
82 Ga0068862_100356318 3300005844 Bacteria 1359
83 Ga0068862_100515628 3300005844 Unclassified 1137
84 Ga0068862_100809950 3300005844 Bacteria 915
85 Ga0075365_10040447 3300006038 Bacteria 3040
86 Ga0075368_10021057 3300006042 Bacteria 2474
87 Ga0075363_100067079 3300006048 Bacteria 1944
88 Ga0075364_10045130 3300006051 Bacteria 2868
89 Ga0075367_10000805 3300006178 Bacteria 12373
90 Ga0075366_10001270 3300006195 Bacteria 12554
91 Ga0097621_100593053 3300006237 Unclassified 1012
92 Ga0075370_10085238 3300006353 Bacteria 1819
93 Ga0075428_100000135 3300006844 Bacteria 65097
94 Ga0075428_100035458 3300006844 Bacteria 5500
95 Ga0075428_100433631 3300006844 Bacteria 1408
96 Ga0075428_101082218 3300006844 Bacteria 847
97 Ga0075430_100000391 3300006846 Bacteria 32271
98 Ga0075430_100037352 3300006846 Bacteria 4117
99 Ga0075430_100049163 3300006846 Bacteria 3560
100 Ga0075430_100116851 3300006846 Bacteria 2223
101 Ga0075431_100007525 3300006847 Bacteria 10843
102 Ga0075431_100133597 3300006847 Bacteria 2559
103 Ga0075431_100485279 3300006847 Bacteria 1228
104 Ga0075433_10000554 3300006852 Bacteria 24604
105 Ga0075433_10221492 3300006852 Bacteria 1681
106 Ga0075434_100006860 3300006871 Bacteria 10488
107 Ga0075429_100011425 3300006880 Bacteria 7693
108 Ga0075429_100101090 3300006880 Unclassified 2517
109 Ga0075429_100217789 3300006880 Bacteria 1672
110 Ga0075429_100556111 3300006880 Bacteria 1005
111 Ga0068865_100013897 3300006881 Bacteria 5104
112 Ga0068865_100035066 3300006881 Bacteria 3371
113 Ga0097620_100036505 3300006931 Bacteria 4934
114 Ga0097620_100529257 3300006931 Unclassified 1273
115 Ga0075435_100006199 3300007076 Bacteria 8438
116 Ga0075435_100349714 3300007076 Bacteria 1267
117 Ga0105240_10000636 3300009093 Bacteria 64769
118 Ga0111539_10002438 3300009094 Bacteria 24735
119 Ga0111539_10003089 3300009094 Bacteria 22074
120 Ga0111539_10011570 3300009094 Bacteria 11074
121 Ga0111539_10089890 3300009094 Bacteria 3609
122 Ga0111539_10188444 3300009094 Bacteria 2408
123 Ga0105245_10071224 3300009098 Bacteria 3157
124 Ga0105245_10154910 3300009098 Bacteria 2170
125 Ga0114129_10134802 3300009147 Bacteria 3389
126 Ga0105243_10052972 3300009148 Bacteria 3217
127 Ga0105241_10222350 3300009174 Bacteria 1588
128 Ga0105242_10017938 3300009176 Bacteria 5528
129 Ga0105248_10020423 3300009177 Bacteria 7339
130 Ga0105237_10000252 3300009545 Bacteria 76162
131 Ga0105238_10006495 3300009551 Bacteria 11630
132 Ga0105249_10005278 3300009553 Bacteria 11155
133 Ga0105249_10152659 3300009553 Bacteria 2225
134 Ga0105239_10183310 3300010375 Bacteria 2343
135 Ga0105239_10362268 3300010375 Bacteria 1638
136 Ga0105239_10369056 3300010375 Unclassified 1622
137 Ga0157374_10152335 3300013296 Bacteria 2248
138 Ga0157374_10495830 3300013296 Bacteria 1225
139 Ga0163162_10018807 3300013306 Bacteria 6773
140 Ga0157375_10075524 3300013308 Bacteria 3395
141 Ga0157375_10489296 3300013308 Unclassified 1395
142 Ga0157380_10001011 3300014326 Bacteria 17890
143 Ga0157380_10140744 3300014326 Bacteria 2073
144 Ga0157377_10032955 3300014745 Bacteria 2825
145 Ga0157377_10188010 3300014745 Bacteria 1303
146 Ga0157379_10145475 3300014968 Bacteria 2137
147 Ga0157376_10086823 3300014969 Bacteria 2698
148 Ga0157376_10299553 3300014969 Bacteria 1521
149 Ga0207697_10004024 3300025315 Bacteria 7125
150 Ga0207682_10004144 3300025893 Bacteria 6137
151 Ga0207642_10231286 3300025899 Unclassified 1039
152 Ga0207688_10002224 3300025901 Bacteria 10450
153 Ga0207645_10002607 3300025907 Bacteria 14062
154 Ga0207645_10172074 3300025907 Bacteria 1420
155 Ga0207643_10001432 3300025908 Bacteria 13681
156 Ga0207705_10092260 3300025909 Bacteria 2219
157 Ga0207684_10200189 3300025910 Unclassified 1723
158 Ga0207684_10635949 3300025910 Bacteria 910
159 Ga0207707_10134091 3300025912 Bacteria 2166
160 Ga0207695_10001610 3300025913 Bacteria 36606
161 Ga0207671_10000303 3300025914 Bacteria 72722
162 Ga0207663_10311169 3300025916 Bacteria 1180
163 Ga0207660_10123973 3300025917 Bacteria 1960
164 Ga0207660_10358689 3300025917 Bacteria 1169
165 Ga0207662_10001146 3300025918 Bacteria 12530
166 Ga0207662_10006675 3300025918 Bacteria 6236
167 Ga0207662_10046040 3300025918 Bacteria 2580
168 Ga0207657_10102890 3300025919 Bacteria 2368
169 Ga0207652_10065897 3300025921 Bacteria 3137
170 Ga0207652_10112380 3300025921 Bacteria 2417
171 Ga0207646_10275934 3300025922 Bacteria 1519
172 Ga0207646_10357423 3300025922 Unclassified 1320
173 Ga0207694_10007638 3300025924 Bacteria 8194
174 Ga0207694_10080224 3300025924 Unclassified 2561
175 Ga0207650_10127927 3300025925 Bacteria 1985
176 Ga0207659_10012598 3300025926 Bacteria 5387
177 Ga0207687_10233249 3300025927 Bacteria 1455
178 Ga0207644_10014483 3300025931 Bacteria 5274
179 Ga0207644_10414359 3300025931 Unclassified 1103
180 Ga0207706_10007146 3300025933 Bacteria 10328
181 Ga0207706_10207404 3300025933 Unclassified 1718
182 Ga0207686_10039980 3300025934 Unclassified 2849
183 Ga0207670_10000001 3300025936 Bacteria 949312
184 Ga0207704_10195460 3300025938 Unclassified 1475
185 Ga0207691_10006543 3300025940 Bacteria 11248
186 Ga0207691_10034464 3300025940 Bacteria 4707
187 Ga0207689_10003343 3300025942 Bacteria 14696
188 Ga0207689_10006550 3300025942 Bacteria 10274
189 Ga0207679_10014193 3300025945 Bacteria 5233
190 Ga0207667_10377589 3300025949 Bacteria 1444
191 Ga0207667_10712064 3300025949 Unclassified 1006
192 Ga0207651_10033261 3300025960 Bacteria 3323
193 Ga0207651_10046955 3300025960 Bacteria 2908
194 Ga0207651_10223517 3300025960 Bacteria 1524
195 Ga0207712_10107692 3300025961 Bacteria 2085
196 Ga0207658_10099538 3300025986 Bacteria 2274
197 Ga0207658_10576930 3300025986 Bacteria 1009
198 Ga0207703_10523862 3300026035 Unclassified 1115
199 Ga0207678_10103195 3300026067 Bacteria 2434
200 Ga0207708_10022670 3300026075 Bacteria 4741
201 Ga0207708_10051822 3300026075 Unclassified 3125
202 Ga0207708_10273030 3300026075 Bacteria 1368
203 Ga0207641_10029639 3300026088 Bacteria 4526
204 Ga0207648_10002824 3300026089 Bacteria 18422
205 Ga0207648_10018533 3300026089 Bacteria 6300
206 Ga0207676_10083254 3300026095 Bacteria 2605
207 Ga0207675_100012293 3300026118 Bacteria 7997
208 Ga0207675_100188159 3300026118 Unclassified 1979
209 Ga0207683_10106971 3300026121 Unclassified 2502
210 Ga0207698_10097742 3300026142 Unclassified 2424
211 Ga0207428_10000373 3300027907 Bacteria 57156
212 Ga0207428_10002222 3300027907 Bacteria 19484
213 Ga0207428_10075754 3300027907 Bacteria 2636
214 Ga0207428_10144975 3300027907 Bacteria 1810
215 Ga0268266_10035778 3300028379 Bacteria 4223
216 Ga0268266_10046567 3300028379 Bacteria 3713
217 Ga0268265_10214149 3300028380 Bacteria 1681
218 Ga0268265_10861527 3300028380 Bacteria 887
219 Ga0268264_10085629 3300028381 Bacteria 2705
220 Ga0268264_10111799 3300028381 Unclassified 2394
221 Ga0268264_10194717 3300028381 Bacteria 1850
222 Ga0268264_10692291 3300028381 Unclassified 1012
223 Ga0265319_1051425 3300028563 Bacteria 1358
224 Ga0265334_10115561 3300028573 Bacteria 962
225 Ga0265318_10000049 3300028577 Bacteria 119684
226 Ga0265318_10000363 3300028577 Bacteria 35847
227 Ga0265318_10016307 3300028577 Bacteria 3072
228 Ga0265318_10088311 3300028577 Bacteria 1142
229 Ga0265338_10002343 3300028800 Bacteria 28632
230 Ga0265330_10000113 3300031235 Bacteria 66221
231 Ga0265330_10002814 3300031235 Bacteria 9321
232 Ga0265330_10017430 3300031235 Bacteria 3307
233 Ga0265330_10079525 3300031235 Bacteria 1413
234 Ga0265332_10000074 3300031238 Bacteria 84980
235 Ga0265332_10000106 3300031238 Bacteria 71076
236 Ga0265332_10000541 3300031238 Bacteria 25660
237 Ga0265332_10007183 3300031238 Bacteria 5041
238 Ga0265332_10015075 3300031238 Bacteria 3415
239 Ga0265332_10036877 3300031238 Bacteria 2122
240 Ga0265328_10000163 3300031239 Bacteria 30684
241 Ga0265328_10001749 3300031239 Bacteria 9938
242 Ga0265328_10003417 3300031239 Bacteria 7012
243 Ga0265328_10008076 3300031239 Bacteria 4361
244 Ga0265320_10000055 3300031240 Bacteria 109446
245 Ga0265320_10004668 3300031240 Bacteria 8946
246 Ga0265320_10005735 3300031240 Bacteria 7919
247 Ga0265320_10008936 3300031240 Bacteria 6086
248 Ga0265325_10041308 3300031241 Bacteria 2417
249 Ga0265329_10000946 3300031242 Bacteria 14611
250 Ga0265329_10004941 3300031242 Bacteria 5457
251 Ga0265329_10078766 3300031242 Bacteria 1043
252 Ga0265340_10013715 3300031247 Bacteria 4250
253 Ga0265339_10011105 3300031249 Bacteria 5560
254 Ga0265339_10015556 3300031249 Bacteria 4558
255 Ga0265339_10050549 3300031249 Bacteria 2273
256 Ga0265339_10105165 3300031249 Bacteria 1466
257 Ga0265331_10000043 3300031250 Bacteria 189515
258 Ga0265331_10000074 3300031250 Bacteria 149282
259 Ga0265331_10000884 3300031250 Bacteria 24309
260 Ga0265316_10000037 3300031344 Bacteria 149295
261 Ga0265316_10003047 3300031344 Bacteria 17099
262 Ga0265316_10038017 3300031344 Bacteria 3881
263 Ga0265313_10000037 3300031595 Bacteria 124084
264 Ga0265313_10038026 3300031595 Bacteria 2400
265 Ga0265313_10060815 3300031595 Bacteria 1770
266 Ga0265314_10000272 3300031711 Bacteria 75661
267 Ga0265314_10001545 3300031711 Bacteria 25384
268 Ga0265314_10002278 3300031711 Bacteria 19879
269 Ga0265314_10004315 3300031711 Bacteria 13270
270 Ga0265314_10005002 3300031711 Bacteria 12076
271 Ga0265314_10053621 3300031711 Unclassified 2796
272 Ga0265342_10000293 3300031712 Bacteria 56747
273 Ga0265342_10000473 3300031712 Bacteria 43592
274 Ga0265342_10003299 3300031712 Bacteria 13345
275 Ga0265342_10011340 3300031712 Bacteria 6108
276 Ga0265342_10021043 3300031712 Bacteria 4172
277 Ga0265342_10031211 3300031712 Bacteria 3296
278 Ga0265342_10129708 3300031712 Unclassified 1414
279 Ga0307405_10034026 3300031731 Bacteria 3028
280 Ga0316577_10122747 3300031733 Unclassified 1460
281 Ga0307413_10224228 3300031824 Bacteria 1375
282 Ga0307406_10043419 3300031901 Bacteria 2811
283 Ga0307412_10023441 3300031911 Bacteria 3798
284 Ga0307409_100032282 3300031995 Bacteria 3794
285 Ga0307416_100035557 3300032002 Bacteria 3806
286 Ga0307416_100937901 3300032002 Bacteria 967
287 Ga0307414_10121059 3300032004 Bacteria 2012
288 Ga0307411_10030557 3300032005 Bacteria 3303
289 Ga0307415_100011455 3300032126 Bacteria 5076
290 Ga0373953_0018796 3300035117 Bacteria 2562
291 Ga0373957_0168044 3300035120 Bacteria 906
292 Ga0373946_0183689 3300035171 Unclassified 994
293 Ga0373955_0006001 3300035172 Bacteria 5510
294 Ga0373955_0039411 3300035172 Bacteria 2522
295 Ga0373955_0077691 3300035172 Bacteria 1870
296 Ga0373955_0169414 3300035172 Unclassified 1292
297 Ga0316574_0093657 3300035398 Bacteria 1918
298 Ga0373933_0002811 3300035724 Bacteria 9727
299 Ga0373933_0055929 3300035724 Bacteria 2368
300 Ga0373937_0006251 3300036401 Bacteria 10273
301 Ga0373937_0020675 3300036401 Bacteria 5903
302 Ga0373937_0036803 3300036401 Bacteria 4460
303 Ga0373937_0330720 3300036401 Bacteria 1442
304 Ga0316584_0075160 3300036712 Unclassified 2533
305 Ga0373925_0614696 3300037068 Bacteria 895
306 Ga0451807_1627519 3300041486 Bacteria 1263
307 Ga0439464_0065513 3300042439 Bacteria 1069
308 Ga0451577_0000784 3300042876 Bacteria 47799
309 Ga0466969_0025373 3300044656 Bacteria 3048
310 Ga0466966_0056418 3300044684 Bacteria 2485
311 Ga0453684_0000216 3300044712 Bacteria 250915
312 Ga0466971_0261295 3300044719 Unclassified 826
313 Ga0466960_0007645 3300044901 Unclassified 4401
314 Ga0495638_0026288 3300046460 Bacteria 3773
315 Ga0495667_0191896 3300046559 Unclassified 1309
316 Ga0495669_0041162 3300046684 Unclassified 2051
317 Ga0495680_0049876 3300047322 Bacteria 3276
318 Ga0496104_0237338 3300048907 Bacteria 1735
319 Ga0496105_0237210 3300048908 Bacteria 1481
320 Ga0496107_0176354 3300048910 Bacteria 1587
321 Ga0496108_0163257 3300048911 Bacteria 1926
322 Ga0496108_0351086 3300048911 Bacteria 1287
323 Ga0496109_0180206 3300048912 Bacteria 1984
324 Ga0496110_0715629 3300048913 Bacteria 903
325 Ga0496114_0005927 3300048917 Bacteria 9608
326 Ga0501034_0116858 3300049571 Bacteria 2655
327 Ga0501034_0131472 3300049571 Bacteria 2486
328 Ga0501043_0061970 3300049579 Bacteria 2937
329 Ga0501047_0030307 3300049581 Bacteria 5216
330 Ga0501047_0703212 3300049581 Bacteria 828
331 Ga0501069_0011239 3300049585 Bacteria 4749
332 Ga0501070_0597473 3300049586 Unclassified 880
333 Ga0501072_0122297 3300049588 Bacteria 2074
334 Ga0501075_0436989 3300049591 Bacteria 998
335 Ga0501079_0080329 3300049741 Bacteria 2522
336 Ga0501079_0450788 3300049741 Unclassified 1010
337 Ga0501080_0893725 3300049742 Bacteria 775
338 Ga0501044_0007911 3300049823 Bacteria 11690
339 Ga0501045_0036752 3300049824 Bacteria 3558
340 nmdc:mga03n38_69418_c1 3300050490 Bacteria 1627
341 nmdc:mga00v17_176312_c1 3300050491 Bacteria 1379
342 nmdc:mga0yw44_13077_c1 3300050492 Bacteria 4354
343 nmdc:mga0k408_382_c1 3300050493 Bacteria 24271
344 nmdc:mga06z11_82652_c1 3300050494 Bacteria 1727
345 nmdc:mga04h51_11309_c1 3300050495 Bacteria 2474
346 nmdc:mga07m45_42040_c1 3300050496 Bacteria 2561
347 nmdc:mga05p37_110266_c1 3300050507 Bacteria 3385
348 nmdc:mga09592_11485_c1 3300050508 Bacteria 7207
349 nmdc:mga09592_122656_c1 3300050508 Unclassified 2233
350 nmdc:mga09592_30719_c1 3300050508 Bacteria 4471
351 nmdc:mga09592_96449_c1 3300050508 Bacteria 2530
352 nmdc:mga0qj67_233170_c1 3300050509 Bacteria 1493
353 nmdc:mga0qj67_324_c1 3300050509 Bacteria 32941
354 nmdc:mga0qj67_3667_c2 3300050509 Bacteria 9397
355 nmdc:mga0qj67_86045_c1 3300050509 Bacteria 2522
356 nmdc:mga06r32_3164_c1 3300050510 Bacteria 14741
357 nmdc:mga06r32_42809_c2 3300050510 Bacteria 3979
358 nmdc:mga06r32_476275_c1 3300050510 Bacteria 1227
359 nmdc:mga06r32_943836_c1 3300050510 Unclassified 817
360 nmdc:mga08y16_177585_c1 3300050511 Bacteria 2211
361 nmdc:mga08y16_336_c1 3300050511 Bacteria 42608
362 nmdc:mga08y16_3669_c1 3300050511 Bacteria 15981
363 nmdc:mga08y16_582364_c1 3300050511 Unclassified 1130
364 nmdc:mga0n895_26154_c1 3300050512 Bacteria 5523
365 nmdc:mga0rr50_4313_c1 3300050513 Bacteria 8333
366 nmdc:mga0rr50_516209_c1 3300050513 Bacteria 1016
367 nmdc:mga0a205_89283_c1 3300050515 Bacteria 2979
368 Ga0495601_0171512 3300053077 Bacteria 1418
369 Ga0501082_0471773 3300060353 Unclassified 1097
370 Ga0070689_100000002
371 Ga0065715_10002532
372 Ga0070658_10005419
373 Ga0070658_10171956
374 Ga0070676_10028674
375 Ga0070676_10029532
376 Ga0070683_100004430
377 Ga0070690_100055506
378 Ga0068869_100008601
379 Ga0068869_100123748
380 Ga0070666_10003786
381 Ga0070680_100004750
382 Ga0070682_100228783
383 Ga0070682_100243694
384 Ga0068868_100101609
385 Ga0068868_100112513
386 Ga0070660_100288061
387 Ga0070689_100045405
388 Ga0070687_100047741
389 Ga0070661_100482546
390 Ga0070668_100259178
391 Ga0070675_100045529
392 Ga0070675_100216266
393 Ga0070671_100024286
394 Ga0070673_100007556
395 Ga0070688_100004245
396 Ga0070688_100066349
397 Ga0070688_100069192
398 Ga0070667_100282524
399 Ga0070713_100102267
400 Ga0070710_10345186
401 Ga0070711_100321286
402 Ga0070705_100137914
403 Ga0070663_100178441
404 Ga0070681_10278179
405 Ga0068867_100024526
406 Ga0068867_100125908
407 Ga0070685_10024141
408 Ga0070685_10141384
409 Ga0070685_10145375
410 Ga0070706_100001395
411 Ga0070706_100146593
412 Ga0070707_100148267
413 Ga0070707_100155562
414 Ga0070698_100155085
415 Ga0070679_100016001
416 Ga0070684_100004428
417 Ga0070684_100109229
418 Ga0068853_100003012
419 Ga0070672_100207349
420 Ga0070686_100003080
421 Ga0070686_100021246
422 Ga0070686_100101134
423 Ga0070695_100076860
424 Ga0070696_100028467
425 Ga0070665_100147305
426 Ga0068855_100003532
427 Ga0068855_100630291
428 Ga0070664_100007388
429 Ga0068857_100067838
430 Ga0068857_100800412
431 Ga0068856_100074515
432 Ga0068856_100112534
433 Ga0068856_100140864
434 Ga0068856_100189573
435 Ga0070702_100022351
436 Ga0070702_100052099
437 Ga0068852_100099403
438 Ga0068859_100036505
439 Ga0068859_100529243
440 Ga0068864_100164172
441 Ga0068861_100118338
442 Ga0068861_100147025
443 Ga0068870_10001682
444 Ga0068863_100002423
445 Ga0068858_100123443
446 Ga0068860_100009771
447 Ga0068860_100016824
448 Ga0068860_100225082
449 Ga0068860_100434581
450 Ga0068862_100108318
451 Ga0068862_100356318
452 Ga0068862_100515628
453 Ga0068862_100809950
454 Ga0075365_10040447
455 Ga0075368_10021057
456 Ga0075363_100067079
457 Ga0075364_10045130
458 Ga0075367_10000805
459 Ga0075366_10001270
460 Ga0097621_100593053
461 Ga0075370_10085238
462 Ga0075428_100000135
463 Ga0075428_100035458
464 Ga0075428_100433631
465 Ga0075428_101082218
466 Ga0075430_100000391
467 Ga0075430_100037352
468 Ga0075430_100049163
469 Ga0075430_100116851
470 Ga0075431_100007525
471 Ga0075431_100133597
472 Ga0075431_100485279
473 Ga0075433_10000554
474 Ga0075433_10221492
475 Ga0075434_100006860
476 Ga0075429_100011425
477 Ga0075429_100101090
478 Ga0075429_100217789
479 Ga0075429_100556111
480 Ga0068865_100013897
481 Ga0068865_100035066
482 Ga0097620_100036505
483 Ga0097620_100529257
484 Ga0075435_100006199
485 Ga0075435_100349714
486 Ga0105240_10000636
487 Ga0111539_10002438
488 Ga0111539_10003089
489 Ga0111539_10011570
490 Ga0111539_10089890
491 Ga0111539_10188444
492 Ga0105245_10071224
493 Ga0105245_10154910
494 Ga0114129_10134802
495 Ga0105243_10052972
496 Ga0105241_10222350
497 Ga0105242_10017938
498 Ga0105248_10020423
499 Ga0105237_10000252
500 Ga0105238_10006495
501 Ga0105249_10005278
502 Ga0105249_10152659
503 Ga0105239_10183310
504 Ga0105239_10362268
505 Ga0105239_10369056
506 Ga0157374_10152335
507 Ga0157374_10495830
508 Ga0163162_10018807
509 Ga0157375_10075524
510 Ga0157375_10489296
511 Ga0157380_10001011
512 Ga0157380_10140744
513 Ga0157377_10032955
514 Ga0157377_10188010
515 Ga0157379_10145475
516 Ga0157376_10086823
517 Ga0157376_10299553
518 Ga0207697_10004024
519 Ga0207682_10004144
520 Ga0207642_10231286
521 Ga0207688_10002224
522 Ga0207645_10002607
523 Ga0207645_10172074
524 Ga0207643_10001432
525 Ga0207705_10092260
526 Ga0207684_10200189
527 Ga0207684_10635949
528 Ga0207707_10134091
529 Ga0207695_10001610
530 Ga0207671_10000303
531 Ga0207663_10311169
532 Ga0207660_10123973
533 Ga0207660_10358689
534 Ga0207662_10001146
535 Ga0207662_10006675
536 Ga0207662_10046040
537 Ga0207657_10102890
538 Ga0207652_10065897
539 Ga0207652_10112380
540 Ga0207646_10275934
541 Ga0207646_10357423
542 Ga0207694_10007638
543 Ga0207694_10080224
544 Ga0207650_10127927
545 Ga0207659_10012598
546 Ga0207687_10233249
547 Ga0207644_10014483
548 Ga0207644_10414359
549 Ga0207706_10007146
550 Ga0207706_10207404
551 Ga0207686_10039980
552 Ga0207670_10000001
553 Ga0207704_10195460
554 Ga0207691_10006543
555 Ga0207691_10034464
556 Ga0207689_10003343
557 Ga0207689_10006550
558 Ga0207679_10014193
559 Ga0207667_10377589
560 Ga0207667_10712064
561 Ga0207651_10033261
562 Ga0207651_10046955
563 Ga0207651_10223517
564 Ga0207712_10107692
565 Ga0207658_10099538
566 Ga0207658_10576930
567 Ga0207703_10523862
568 Ga0207678_10103195
569 Ga0207708_10022670
570 Ga0207708_10051822
571 Ga0207708_10273030
572 Ga0207641_10029639
573 Ga0207648_10002824
574 Ga0207648_10018533
575 Ga0207676_10083254
576 Ga0207675_100012293
577 Ga0207675_100188159
578 Ga0207683_10106971
579 Ga0207698_10097742
580 Ga0207428_10000373
581 Ga0207428_10002222
582 Ga0207428_10075754
583 Ga0207428_10144975
584 Ga0268266_10035778
585 Ga0268266_10046567
586 Ga0268265_10214149
587 Ga0268265_10861527
588 Ga0268264_10085629
589 Ga0268264_10111799
590 Ga0268264_10194717
591 Ga0268264_10692291
592 Ga0265319_1051425
593 Ga0265334_10115561
594 Ga0265318_10000049
595 Ga0265318_10000363
596 Ga0265318_10016307
597 Ga0265318_10088311
598 Ga0265338_10002343
599 Ga0265330_10000113
600 Ga0265330_10002814
601 Ga0265330_10017430
602 Ga0265330_10079525
603 Ga0265332_10000074
604 Ga0265332_10000106
605 Ga0265332_10000541
606 Ga0265332_10007183
607 Ga0265332_10015075
608 Ga0265332_10036877
609 Ga0265328_10000163
610 Ga0265328_10001749
611 Ga0265328_10003417
612 Ga0265328_10008076
613 Ga0265320_10000055
614 Ga0265320_10004668
615 Ga0265320_10005735
616 Ga0265320_10008936
617 Ga0265325_10041308
618 Ga0265329_10000946
619 Ga0265329_10004941
620 Ga0265329_10078766
621 Ga0265340_10013715
622 Ga0265339_10011105
623 Ga0265339_10015556
624 Ga0265339_10050549
625 Ga0265339_10105165
626 Ga0265331_10000043
627 Ga0265331_10000074
628 Ga0265331_10000884
629 Ga0265316_10000037
630 Ga0265316_10003047
631 Ga0265316_10038017
632 Ga0265313_10000037
633 Ga0265313_10038026
634 Ga0265313_10060815
635 Ga0265314_10000272
636 Ga0265314_10001545
637 Ga0265314_10002278
638 Ga0265314_10004315
639 Ga0265314_10005002
640 Ga0265314_10053621
641 Ga0265342_10000293
642 Ga0265342_10000473
643 Ga0265342_10003299
644 Ga0265342_10011340
645 Ga0265342_10021043
646 Ga0265342_10031211
647 Ga0265342_10129708
648 Ga0307405_10034026
649 Ga0316577_10122747
650 Ga0307413_10224228
651 Ga0307406_10043419
652 Ga0307412_10023441
653 Ga0307409_100032282
654 Ga0307416_100035557
655 Ga0307416_100937901
656 Ga0307414_10121059
657 Ga0307411_10030557
658 Ga0307415_100011455
659 Ga0373953_0018796
660 Ga0373957_0168044
661 Ga0373946_0183689
662 Ga0373955_0006001
663 Ga0373955_0039411
664 Ga0373955_0077691
665 Ga0373955_0169414
666 Ga0316574_0093657
667 Ga0373933_0002811
668 Ga0373933_0055929
669 Ga0373937_0006251
670 Ga0373937_0020675
671 Ga0373937_0036803
672 Ga0373937_0330720
673 Ga0316584_0075160
674 Ga0373925_0614696
675 Ga0451807_1627519
676 Ga0439464_0065513
677 Ga0451577_0000784
678 Ga0466969_0025373
679 Ga0466966_0056418
680 Ga0453684_0000216
681 Ga0466971_0261295
682 Ga0466960_0007645
683 Ga0495638_0026288
684 Ga0495667_0191896
685 Ga0495669_0041162
686 Ga0495680_0049876
687 Ga0496104_0237338
688 Ga0496105_0237210
689 Ga0496107_0176354
690 Ga0496108_0163257
691 Ga0496108_0351086
692 Ga0496109_0180206
693 Ga0496110_0715629
694 Ga0496114_0005927
695 Ga0501034_0116858
696 Ga0501034_0131472
697 Ga0501043_0061970
698 Ga0501047_0030307
699 Ga0501047_0703212
700 Ga0501069_0011239
701 Ga0501070_0597473
702 Ga0501072_0122297
703 Ga0501075_0436989
704 Ga0501079_0080329
705 Ga0501079_0450788
706 Ga0501080_0893725
707 Ga0501044_0007911
708 Ga0501045_0036752
709 nmdc:mga03n38_69418_c1
710 nmdc:mga00v17_176312_c1
711 nmdc:mga0yw44_13077_c1
712 nmdc:mga0k408_382_c1
713 nmdc:mga06z11_82652_c1
714 nmdc:mga04h51_11309_c1
715 nmdc:mga07m45_42040_c1
716 nmdc:mga05p37_110266_c1
717 nmdc:mga09592_11485_c1
718 nmdc:mga09592_122656_c1
719 nmdc:mga09592_30719_c1
720 nmdc:mga09592_96449_c1
721 nmdc:mga0qj67_233170_c1
722 nmdc:mga0qj67_324_c1
723 nmdc:mga0qj67_3667_c2
724 nmdc:mga0qj67_86045_c1
725 nmdc:mga06r32_3164_c1
726 nmdc:mga06r32_42809_c2
727 nmdc:mga06r32_476275_c1
728 nmdc:mga06r32_943836_c1
729 nmdc:mga08y16_177585_c1
730 nmdc:mga08y16_336_c1
731 nmdc:mga08y16_3669_c1
732 nmdc:mga08y16_582364_c1
733 nmdc:mga0n895_26154_c1
734 nmdc:mga0rr50_4313_c1
735 nmdc:mga0rr50_516209_c1
736 nmdc:mga0a205_89283_c1
737 Ga0495601_0171512
738 Ga0501082_0471773

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

41

218

0.91

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

41

230

0.89

PF08659

KR

KR domain

36

210

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
8jat-assembly1.cif.gz_A-2 crystal structure of the 3-ketodihydrosphingosine reductase tsc10 from cryptococcus neoformans 0.8939 1 226
8jat-assembly1.cif.gz_A-2 crystal structure of the 3-ketodihydrosphingosine reductase tsc10 from cryptococcus neoformans 0.8857 1 226
2ehd-assembly1.cif.gz_A crystal structure analysis of oxidoreductase 0.8779 5 226
6ow4-assembly2.cif.gz_H-3 structure of the nadh-bound form of 20beta-hydroxysteroid dehydrogenase from bifidobacterium adolescentis strain l2-32 0.8752 4 233
6m5n-assembly1.cif.gz_A apo-form structure of borneol dehydrogenase 0.8742 1 229
ID Description Score Start End Superfamily
af_A0A0R0HUJ2_8_65_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9448 7 51 3.40.50.720
af_P9WGR3_8_247_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9106 8 248 3.40.50.720
af_P95150_9_261_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9076 5 250 3.40.50.720
af_P9WGS9_8_252_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9041 6 248 3.40.50.720
af_P9WGR3_8_247_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8998 8 248 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A4U1JGS4-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9551 6 251 GO:0016020
GO:0016491
AF-A0A523JYX1-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9479 3 251 GO:0016020
GO:0016491
AF-A0A3D2C2Z9-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9444 1 251 GO:0016020
GO:0016491
AF-A0A7C3EKD1-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9436 1 251 GO:0016020
GO:0016491
AF-A0A7Y5DZ93-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9417 64 251 GO:0016020
GO:0016491

Map