F424898

General Info

Members Datasets Scaffolds Average Seq Length
368 255 736 350

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8002775197|8002780122
Length 396
Sequence TERTRDTASASDPRLATAFTRLTGARYPIVQTGMGWVSGARLTAATAAAGGLGILGSATMTFDELAAAIRAVKERTDAPFGVNLRSDAEDVEERVALMVREGVRVASFALAPRKDLFSRLRDAGIVTMPSVGARRHAEKVASWGADAVLVQGGEGGGHTGAVPTSLLLPQVVDAVDIPVVAAGGYFDGRGLVSALAYGAAGIGMGTRFLLTADSTVADNVKARYLAAGVDGTVVTTRVDGVPHRVLRTPLVDGLTSAGPLTRFPRAVRNAAAFRRSTGASWRGLLREGRALRAHAGLSWSQVLMSANTPMLLRASMVEGRDDLGLMTSGQVVGVIDDLPTVAELIERVVSEATTVLDRLSGIGGSTPEHVAGPGNTVTSVTISSEMPAAAGADAPA

Samples

Sample ID Description Type Environment
1 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
2 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
5 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
6 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
7 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
8 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
9 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
10 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
11 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
12 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
13 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
14 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
15 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
16 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
17 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
18 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
19 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
20 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
21 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
22 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
23 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
24 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
25 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
38 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
41 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
42 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
43 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
44 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
45 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
46 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
47 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
48 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
49 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
50 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
51 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
52 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
53 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
54 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
55 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
56 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
57 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
58 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
59 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
60 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
61 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
62 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
63 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
64 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
65 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
66 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
67 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
68 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
69 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
70 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
71 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
72 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
73 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
74 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
75 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
76 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
77 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
78 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
79 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
80 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
81 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
82 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
83 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
84 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
85 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
86 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
87 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
88 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
89 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
90 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
91 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
92 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
93 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
94 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
95 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
96 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
97 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
98 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
99 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
100 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
101 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
102 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
103 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
104 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
105 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
106 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
107 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
108 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
109 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
110 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
111 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
112 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
113 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
114 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
115 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
116 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
117 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
118 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
119 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
120 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
121 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
122 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
123 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
124 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
125 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
126 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
127 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
128 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
129 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
130 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
131 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
132 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
133 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
134 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
135 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
136 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
137 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
138 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
139 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
140 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
141 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
142 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
143 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
144 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
145 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
146 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
147 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
148 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
149 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
150 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
151 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
152 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
153 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
154 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
155 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
156 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
157 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
158 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
159 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
160 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
161 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
162 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
163 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
164 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
165 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
166 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
167 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
168 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
169 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
174 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
175 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
177 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
178 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
179 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
180 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
181 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
182 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
183 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
184 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
185 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
186 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
187 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
188 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
189 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
190 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
191 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
192 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
193 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
194 8002775197 Frankia nepalensis CN7 Isolate Nodule
195 2508501039 Frankia saprophytica CN3 Isolate Nodule
196 2517572101 Frankia sp. DC12 Isolate Nodule
197 2582580736 Prauserella sp. Am3 Isolate Unclassified
198 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
199 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
200 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
201 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
202 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
203 2643221561 Nocardioides sp. Root151 Isolate Unclassified
204 2643221578 Streptomyces sp. Root63 Isolate Unclassified
205 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
206 2643221647 Streptomyces sp. Root369 Isolate Unclassified
207 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
208 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
209 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
210 2643221696 Nocardioides sp. Root140 Isolate Unclassified
211 2643221714 Streptomyces sp. Root264 Isolate Unclassified
212 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
213 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
214 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
215 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
216 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
217 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
218 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
219 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
220 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
221 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
222 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
223 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
224 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
225 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
226 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
227 2862574272 Streptomyces sp. AcE210 Isolate Nodule
228 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
229 2867475112 Streptomyces sp. TM32 Isolate Unclassified
230 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
231 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
232 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
233 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
234 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
235 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
236 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
237 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
238 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
239 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
240 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
241 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
242 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
243 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
244 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
245 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
246 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
247 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
248 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
249 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
250 8002784119 Frankia sp. AgB1.9 Isolate Nodule
251 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
252 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
253 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
254 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified
255 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.61
Metatranscriptomes 0.54
Isolates 16.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.07
Nodule 2.72
Rhizoplane 3.53
Rhizosphere 66.03
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25160J50197_1010407 3300003354 Bacteria 3368
2 JGI25160J50197_1010458 3300003354 Bacteria 3356
3 Ga0006562J51391_1094202 3300003578 Bacteria 7930
4 Ga0006562J51391_1094203 3300003578 Bacteria 6250
5 Ga0070680_100000063 3300005336 Bacteria 55957
6 Ga0070680_100005255 3300005336 Bacteria 9798
7 Ga0070671_100112120 3300005355 Bacteria 2291
8 Ga0070681_10000016 3300005458 Bacteria 126919
9 Ga0070681_10000060 3300005458 Bacteria 78566
10 Ga0070706_100016148 3300005467 Bacteria 6894
11 Ga0070706_100082738 3300005467 Bacteria 2973
12 Ga0070706_100217451 3300005467 Bacteria 1784
13 Ga0070707_100350587 3300005468 Bacteria 1433
14 Ga0070698_100025986 3300005471 Bacteria 6100
15 Ga0070679_100000048 3300005530 Bacteria 89533
16 Ga0070679_100000105 3300005530 Bacteria 65645
17 Ga0070684_100278180 3300005535 Bacteria 1533
18 Ga0068853_100246885 3300005539 Bacteria 1637
19 Ga0070665_100000536 3300005548 Bacteria 53463
20 Ga0070704_100226785 3300005549 Bacteria 1522
21 Ga0068864_100026531 3300005618 Bacteria 4885
22 Ga0081455_10018367 3300005937 Bacteria 6664
23 Ga0075365_10053257 3300006038 Bacteria 2679
24 Ga0075368_10040985 3300006042 Bacteria 1819
25 Ga0075364_10027639 3300006051 Bacteria 3626
26 Ga0075370_10037124 3300006353 Bacteria 2739
27 Ga0075428_100022275 3300006844 Bacteria 7014
28 Ga0075431_100392736 3300006847 Bacteria 1389
29 Ga0105242_10174457 3300009176 Bacteria 1892
30 Ga0182007_10003573 3300015262 Bacteria 7313
31 Ga0207426_1000393 3300025302 Bacteria 74583
32 Ga0207426_1008845 3300025302 Bacteria 4030
33 Ga0207426_1010084 3300025302 Bacteria 3692
34 Ga0207647_10008520 3300025904 Bacteria 7344
35 Ga0207705_10029928 3300025909 Bacteria 3883
36 Ga0207684_10022373 3300025910 Bacteria 5396
37 Ga0207684_10090149 3300025910 Bacteria 2613
38 Ga0207684_10207380 3300025910 Bacteria 1691
39 Ga0207707_10000027 3300025912 Bacteria 171601
40 Ga0207707_10000185 3300025912 Bacteria 65663
41 Ga0207693_10089715 3300025915 Bacteria 2409
42 Ga0207660_10001440 3300025917 Bacteria 15976
43 Ga0207660_10003836 3300025917 Bacteria 9798
44 Ga0207652_10000217 3300025921 Bacteria 60702
45 Ga0207652_10000575 3300025921 Bacteria 36922
46 Ga0207652_10009443 3300025921 Bacteria 7845
47 Ga0207700_10088718 3300025928 Bacteria 2435
48 Ga0207669_10024917 3300025937 Bacteria 3224
49 Ga0207661_10100542 3300025944 Bacteria 2427
50 Ga0207667_10158885 3300025949 Bacteria 2326
51 Ga0207667_10419276 3300025949 Bacteria 1362
52 Ga0207639_10216824 3300026041 Bacteria 1651
53 Ga0209282_1106956 3300027666 Bacteria 1428
54 Ga0268266_10026191 3300028379 Bacteria 4962
55 Ga0268265_10338124 3300028380 Bacteria 1370
56 Ga0307517_10096414 3300028786 Bacteria 2369
57 Ga0307515_10001023 3300028794 Bacteria 63806
58 Ga0265338_10151253 3300028800 Bacteria 1803
59 Ga0307511_10001886 3300030521 Bacteria 22019
60 Ga0307511_10054508 3300030521 Bacteria 3151
61 Ga0307511_10055830 3300030521 Bacteria 3095
62 Ga0307512_10010153 3300030522 Bacteria 9002
63 Ga0307512_10034795 3300030522 Bacteria 4304
64 Ga0307513_10003539 3300031456 Bacteria 21142
65 Ga0307513_10277915 3300031456 Bacteria 1453
66 Ga0307509_10062748 3300031507 Bacteria 3916
67 Ga0307508_10008345 3300031616 Bacteria 9576
68 Ga0307508_10075557 3300031616 Bacteria 2946
69 Ga0307508_10300719 3300031616 Bacteria 1197
70 Ga0307516_10010098 3300031730 Bacteria 10438
71 Ga0307516_10058602 3300031730 Bacteria 3748
72 Ga0307518_10030839 3300031838 Bacteria 3884
73 Ga0307518_10031900 3300031838 Bacteria 3819
74 Ga0307518_10061713 3300031838 Bacteria 2721
75 Ga0307518_10080915 3300031838 Bacteria 2345
76 Ga0307416_100095372 3300032002 Bacteria 2569
77 Ga0307416_100354826 3300032002 Bacteria 1486
78 Ga0307415_100379700 3300032126 Bacteria 1199
79 Ga0307507_10014834 3300033179 Bacteria 9240
80 Ga0307507_10019990 3300033179 Bacteria 7515
81 Ga0307507_10024114 3300033179 Bacteria 6645
82 Ga0307510_10007566 3300033180 Bacteria 12944
83 Ga0307510_10034112 3300033180 Bacteria 5704
84 Ga0373954_0068157 3300035118 Bacteria 1687
85 Ga0373933_0087018 3300035724 Bacteria 1924
86 Ga0373937_0118205 3300036401 Bacteria 2469
87 Ga0395898_0009610 3300037466 Bacteria 10154
88 Ga0395898_0082217 3300037466 Bacteria 3105
89 Ga0436365_0052999 3300039437 Bacteria 1716
90 Ga0439436_0045212 3300041404 Bacteria 1253
91 Ga0451837_0199371 3300041494 Bacteria 1113
92 Ga0451853_1335386 3300041512 Bacteria 1657
93 Ga0439448_0003884 3300042005 Bacteria 4183
94 Ga0439449_0000442 3300042007 Bacteria 15380
95 Ga0439449_0078917 3300042007 Bacteria 1214
96 Ga0439457_000676 3300042014 Bacteria 10064
97 Ga0439457_001457 3300042014 Bacteria 7106
98 Ga0450894_000344 3300042131 Bacteria 8207
99 Ga0450896_000776 3300042133 Bacteria 3586
100 Ga0450898_000918 3300042134 Bacteria 3698
101 Ga0450899_000532 3300042135 Bacteria 4351
102 Ga0450903_000010 3300042138 Bacteria 35657
103 Ga0439458_0002906 3300042157 Bacteria 4114
104 Ga0466965_0000328 3300044683 Bacteria 15868
105 Ga0466966_0003616 3300044684 Bacteria 10199
106 Ga0466966_0004959 3300044684 Bacteria 8748
107 Ga0466966_0057253 3300044684 Bacteria 2464
108 Ga0466961_0001263 3300044693 Bacteria 15604
109 Ga0466961_0011189 3300044693 Bacteria 5736
110 Ga0466961_0031216 3300044693 Bacteria 3425
111 Ga0466963_0002567 3300044694 Bacteria 10186
112 Ga0466964_0004936 3300044706 Bacteria 4930
113 Ga0466971_0000643 3300044719 Bacteria 13885
114 Ga0466968_0041479 3300044735 Bacteria 1943
115 Ga0466970_0000784 3300044765 Bacteria 15349
116 Ga0466957_0000472 3300044842 Bacteria 19985
117 Ga0466959_0001522 3300045049 Bacteria 14235
118 Ga0466958_0000634 3300045836 Bacteria 15090
119 Ga0466958_0235693 3300045836 Bacteria 1169
120 Ga0466967_0042859 3300045976 Bacteria 3914
121 Ga0466967_0334725 3300045976 Bacteria 1462
122 Ga0495592_0006615 3300046454 Bacteria 8640
123 Ga0495592_0060433 3300046454 Bacteria 2787
124 Ga0495603_0002864 3300046455 Bacteria 10194
125 Ga0495603_0014849 3300046455 Bacteria 4711
126 Ga0495603_0118318 3300046455 Bacteria 1544
127 Ga0495629_0001666 3300046459 Bacteria 17435
128 Ga0495629_0018200 3300046459 Bacteria 5032
129 Ga0495629_0022175 3300046459 Bacteria 4529
130 Ga0495629_0035001 3300046459 Bacteria 3550
131 Ga0495638_0029025 3300046460 Bacteria 3568
132 Ga0495651_0010135 3300046462 Bacteria 7239
133 Ga0495651_0150275 3300046462 Bacteria 1679
134 Ga0495653_0065668 3300046463 Bacteria 2730
135 Ga0495580_0019493 3300046472 Bacteria 5039
136 Ga0495582_0014173 3300046473 Bacteria 4387
137 Ga0495662_0001555 3300046476 Bacteria 11410
138 Ga0495662_0003574 3300046476 Bacteria 7854
139 Ga0495662_0009872 3300046476 Bacteria 4689
140 Ga0495664_0002328 3300046477 Bacteria 10181
141 Ga0495585_0096729 3300046492 Bacteria 1584
142 Ga0495594_0006114 3300046499 Bacteria 6189
143 Ga0495594_0008394 3300046499 Bacteria 5323
144 Ga0495594_0030258 3300046499 Bacteria 2928
145 Ga0495594_0041249 3300046499 Bacteria 2527
146 Ga0495607_0102084 3300046501 Bacteria 1535
147 Ga0495606_0005742 3300046507 Bacteria 11732
148 Ga0495608_0013112 3300046511 Bacteria 5752
149 Ga0495610_0097749 3300046512 Bacteria 1320
150 Ga0495616_0008908 3300046513 Bacteria 5897
151 Ga0495618_0069035 3300046514 Bacteria 2247
152 Ga0495618_0145639 3300046514 Bacteria 1514
153 Ga0495618_0217544 3300046514 Bacteria 1206
154 Ga0495620_0030329 3300046515 Bacteria 2491
155 Ga0495628_0034441 3300046516 Bacteria 4073
156 Ga0495630_0040830 3300046517 Bacteria 3466
157 Ga0495631_0009264 3300046518 Bacteria 4925
158 Ga0495632_0049450 3300046519 Bacteria 2078
159 Ga0495632_0052331 3300046519 Bacteria 2008
160 Ga0495643_0004562 3300046522 Bacteria 9645
161 Ga0495643_0009657 3300046522 Bacteria 5976
162 Ga0495648_0029585 3300046524 Bacteria 3633
163 Ga0495666_0019373 3300046526 Bacteria 3376
164 Ga0495652_0114328 3300046529 Bacteria 2165
165 Ga0495654_0057579 3300046530 Bacteria 1877
166 Ga0495640_0020653 3300046533 Bacteria 4844
167 Ga0495640_0075586 3300046533 Bacteria 2249
168 Ga0495640_0097669 3300046533 Bacteria 1931
169 Ga0495586_0005988 3300046535 Bacteria 6504
170 Ga0495587_0017545 3300046536 Bacteria 4446
171 Ga0495645_0003607 3300046543 Bacteria 10498
172 Ga0495645_0046561 3300046543 Bacteria 3161
173 Ga0495622_0008189 3300046557 Bacteria 4843
174 Ga0495622_0009969 3300046557 Bacteria 4394
175 Ga0495656_0178621 3300046615 Bacteria 1042
176 Ga0495668_0042237 3300046616 Bacteria 2538
177 Ga0495634_0014109 3300046642 Bacteria 5768
178 Ga0495611_0032725 3300046648 Bacteria 2292
179 Ga0495625_0013614 3300046660 Bacteria 6526
180 Ga0495635_0013819 3300046663 Bacteria 5647
181 Ga0495635_0019345 3300046663 Bacteria 4749
182 Ga0495635_0020363 3300046663 Bacteria 4621
183 Ga0495588_0001251 3300046674 Bacteria 10914
184 Ga0495588_0056310 3300046674 Bacteria 2029
185 Ga0495657_0007090 3300046675 Bacteria 8692
186 Ga0495657_0020933 3300046675 Bacteria 4699
187 Ga0495657_0046558 3300046675 Bacteria 2935
188 Ga0495623_0119402 3300046679 Bacteria 1588
189 Ga0495646_0001474 3300046680 Bacteria 13981
190 Ga0495646_0008763 3300046680 Bacteria 6426
191 Ga0495658_0016427 3300046683 Bacteria 3810
192 Ga0495658_0059112 3300046683 Bacteria 2194
193 Ga0495613_0008460 3300046689 Bacteria 7634
194 Ga0495613_0011963 3300046689 Bacteria 6449
195 Ga0495613_0020388 3300046689 Bacteria 4941
196 Ga0495613_0100037 3300046689 Bacteria 2094
197 Ga0495624_0192167 3300046690 Bacteria 1241
198 Ga0495670_0016001 3300046691 Bacteria 3687
199 Ga0495670_0103863 3300046691 Bacteria 1466
200 Ga0495671_0005347 3300046692 Bacteria 7533
201 Ga0495649_0070796 3300046694 Bacteria 1869
202 Ga0495649_0084388 3300046694 Bacteria 1696
203 Ga0495589_0021400 3300046794 Bacteria 3305
204 Ga0495589_0051864 3300046794 Bacteria 2027
205 Ga0495589_0065126 3300046794 Bacteria 1786
206 Ga0495589_0099914 3300046794 Bacteria 1404
207 Ga0495600_0022185 3300046809 Bacteria 4074
208 Ga0495600_0031049 3300046809 Bacteria 3460
209 Ga0495600_0031532 3300046809 Bacteria 3434
210 Ga0495581_0009392 3300047315 Bacteria 5659
211 Ga0495604_0000463 3300047317 Bacteria 36017
212 Ga0495604_0015229 3300047317 Bacteria 6139
213 Ga0495604_0027094 3300047317 Bacteria 4559
214 Ga0495636_0001674 3300047318 Bacteria 8448
215 Ga0495636_0003560 3300047318 Bacteria 6038
216 Ga0495674_0023360 3300047319 Bacteria 5700
217 Ga0495674_0054149 3300047319 Bacteria 3524
218 Ga0495672_0002597 3300047320 Bacteria 16370
219 Ga0495676_0004638 3300047321 Bacteria 12592
220 Ga0495676_0015381 3300047321 Bacteria 6814
221 Ga0495676_0017857 3300047321 Bacteria 6262
222 Ga0495676_0043000 3300047321 Bacteria 3701
223 Ga0495676_0044884 3300047321 Bacteria 3602
224 Ga0495680_0051895 3300047322 Bacteria 3199
225 Ga0495683_0013639 3300047323 Bacteria 4246
226 Ga0495683_0028662 3300047323 Bacteria 2846
227 Ga0495687_001642 3300047443 Bacteria 20129
228 Ga0495687_011964 3300047443 Bacteria 4625
229 Ga0495675_0011900 3300047444 Bacteria 5468
230 Ga0495685_000823 3300047447 Bacteria 9464
231 Ga0495685_004583 3300047447 Bacteria 4478
232 Ga0495685_006806 3300047447 Bacteria 3758
233 Ga0495685_020791 3300047447 Bacteria 2256
234 Ga0495685_025954 3300047447 Bacteria 2016
235 Ga0495681_0002257 3300047470 Bacteria 13855
236 Ga0495681_0008041 3300047470 Bacteria 6650
237 Ga0495593_0005975 3300047673 Bacteria 7169
238 Ga0495593_0024718 3300047673 Bacteria 3326
239 Ga0495593_0116013 3300047673 Bacteria 1365
240 Ga0495602_0017076 3300048088 Bacteria 7281
241 Ga0495614_0003035 3300048089 Bacteria 7480
242 Ga0495614_0004823 3300048089 Bacteria 6086
243 Ga0495614_0021049 3300048089 Bacteria 2819
244 Ga0495626_0038171 3300048091 Bacteria 2278
245 Ga0496100_0003291 3300048903 Bacteria 8405
246 Ga0496101_0010914 3300048904 Bacteria 6012
247 Ga0496102_0000332 3300048905 Bacteria 58001
248 Ga0496102_0018979 3300048905 Bacteria 6050
249 Ga0496103_0000113 3300048906 Bacteria 87947
250 Ga0496103_0009608 3300048906 Bacteria 5726
251 Ga0496104_0195573 3300048907 Bacteria 1934
252 Ga0496105_0218955 3300048908 Bacteria 1550
253 Ga0496106_0090037 3300048909 Bacteria 2367
254 Ga0496106_0115749 3300048909 Bacteria 2091
255 Ga0496107_0201094 3300048910 Bacteria 1481
256 Ga0496109_0107722 3300048912 Bacteria 2589
257 Ga0496114_0241520 3300048917 Bacteria 1588
258 Ga0496116_0000429 3300048919 Bacteria 58973
259 Ga0496116_0000530 3300048919 Bacteria 51367
260 Ga0496117_0000148 3300048920 Bacteria 149369
261 Ga0496117_0006116 3300048920 Bacteria 12319
262 Ga0496117_0012839 3300048920 Bacteria 7346
263 Ga0496118_0000042 3300048921 Bacteria 287521
264 Ga0496118_0000712 3300048921 Bacteria 53654
265 Ga0496119_0000243 3300048922 Bacteria 77072
266 Ga0496119_0001864 3300048922 Bacteria 24352
267 Ga0496119_0099728 3300048922 Bacteria 1633
268 Ga0496121_0005277 3300048924 Bacteria 16657
269 Ga0496121_0080863 3300048924 Bacteria 2574
270 Ga0496122_0001611 3300048925 Bacteria 35279
271 Ga0496122_0061080 3300048925 Bacteria 2769
272 Ga0496123_0051757 3300048926 Bacteria 2732
273 Ga0496125_0074885 3300048928 Bacteria 2622
274 Ga0496126_0000686 3300048929 Bacteria 61986
275 Ga0501033_0128769 3300049570 Bacteria 1835
276 Ga0501034_0001240 3300049571 Bacteria 34655
277 Ga0501034_0125194 3300049571 Bacteria 2555
278 Ga0501038_0006474 3300049574 Bacteria 10839
279 Ga0501047_0001074 3300049581 Bacteria 27231
280 Ga0501047_0037941 3300049581 Bacteria 4660
281 Ga0501047_0124963 3300049581 Bacteria 2453
282 Ga0501070_0368979 3300049586 Bacteria 1164
283 Ga0501080_0106103 3300049742 Bacteria 2604
284 Ga0501080_0306735 3300049742 Bacteria 1439
285 Ga0501044_0003264 3300049823 Bacteria 18246
286 Ga0501044_0014833 3300049823 Bacteria 8400
287 Ga0501044_0056560 3300049823 Bacteria 4028
288 Ga0501045_0321848 3300049824 Bacteria 1151
289 nmdc:mga00v17_5889_c1 3300050491 Bacteria 6475
290 nmdc:mga06z11_62418_c1 3300050494 Bacteria 1946
291 Ga0500578_0018430 3300053086 Bacteria 4484
292 Ga0500643_017079 3300053087 Bacteria 2439
293 Ga0500566_0123928 3300053094 Bacteria 1390
294 Ga0500640_020802 3300053095 Bacteria 2824
295 Ga0500660_040876 3300053100 Bacteria 2359
296 Ga0500560_011944 3300053107 Bacteria 2233
297 Ga0500560_051121 3300053107 Bacteria 1326
298 Ga0500569_013621 3300053109 Bacteria 1995
299 Ga0500595_028063 3300053119 Bacteria 1921
300 Ga0500652_003264 3300053131 Bacteria 4904
301 Ga0500658_0003847 3300053134 Bacteria 5647
302 Ga0500573_0062595 3300053140 Bacteria 2130
303 Ga0500600_0004326 3300053149 Bacteria 8331
304 Ga0500634_0003575 3300053161 Bacteria 6956
305 Ga0500587_003322 3300053739 Bacteria 2257
306 Ga0466962_0000306 3300061719 Bacteria 21050
307 8002780122 8002775197 Bacteria 10728764
308 2508676150 2508501039 Bacteria 9978592
309 2517763525 2517572101 Bacteria 6884336
310 2583153171 2582580736 Bacteria 5325865
311 2585306698 2582581313 Bacteria 10042643
312 2585314200 2582581314 Bacteria 11452267
313 2586062556 2585427649 Bacteria 9053857
314 2616694176 2616644814 Bacteria 11555299
315 2616899325 2616644941 Bacteria 8510691
316 2643823674 2643221561 Bacteria 4984412
317 2643897270 2643221578 Bacteria 9213798
318 2643945265 2643221587 Bacteria 7586415
319 2644271015 2643221647 Bacteria 10741251
320 2644408415 2643221673 Bacteria 9196637
321 2644432164 2643221677 Bacteria 7584031
322 2644435679 2643221678 Bacteria 9540101
323 2644535354 2643221696 Bacteria 5431823
324 2644629494 2643221714 Bacteria 9015452
325 2676198708 2675902999 Bacteria 9438463
326 2774843286 2773857921 Bacteria 9435764
327 2785345047 2784746763 Bacteria 9783172
328 2785365938 2784746768 Bacteria 10036182
329 2786668880 2786546132 Bacteria 10419719
330 2808840489 2808606359 Bacteria 9866990
331 2808919069 2808606375 Bacteria 9466072
332 2809588265 2808606522 Bacteria 9488490
333 2811847501 2808606982 Bacteria 7791042
334 2812359691 2811994879 Bacteria 9313447
335 2842889805 2842888712 Bacteria 4279094
336 2852638329 2852635781 Bacteria 8251373
337 2862288802 2862281513 Bacteria 9621493
338 2862294025 2862290372 Bacteria 7471434
339 2862392455 2862382967 Bacteria 10317375
340 2862583061 2862574272 Bacteria 10567477
341 2863406308 2863404153 Bacteria 9672205
342 2867476506 2867475112 Bacteria 6909112
343 2870787857 2870782633 Bacteria 9624083
344 2875393214 2875391855 Bacteria 7600475
345 2877684534 2877676314 Bacteria 9512378
346 2912721738 2912715099 Bacteria 9460473
347 2915771322 2915768154 Bacteria 8424322
348 2918501319 2918501144 Bacteria 8668083
349 2919473066 2919468124 Bacteria 9133025
350 2935395528 2935390628 Bacteria 7043367
351 2946051479 2946045630 Bacteria 8527308
352 2946066219 2946064051 Bacteria 8957905
353 2946074485 2946072368 Bacteria 8999607
354 2947231154 2947224130 Bacteria 9938529
355 2954387915 2954380949 Bacteria 10050426
356 2954688976 2954682443 Bacteria 9862841
357 2954698725 2954691527 Bacteria 10720516
358 2954703497 2954701450 Bacteria 10834262
359 2990064340 2990059506 Bacteria 9321252
360 2995464362 2995463766 Bacteria 8577691
361 2997602809 2997600082 Bacteria 9896405
362 3006499815 3006493962 Bacteria 8825450
363 8002789382 8002784119 Bacteria 9788632
364 8004215042 8004212874 Bacteria 2861420
365 8008561999 8008558824 Bacteria 10610750
366 8048410021 8048406513 Bacteria 8936924
367 8056064252 8056060235 Bacteria 7259403
368 8056670388 8056667051 Bacteria 6953971
369 JGI25160J50197_1010407
370 JGI25160J50197_1010458
371 Ga0006562J51391_1094202
372 Ga0006562J51391_1094203
373 Ga0070680_100000063
374 Ga0070680_100005255
375 Ga0070671_100112120
376 Ga0070681_10000016
377 Ga0070681_10000060
378 Ga0070706_100016148
379 Ga0070706_100082738
380 Ga0070706_100217451
381 Ga0070707_100350587
382 Ga0070698_100025986
383 Ga0070679_100000048
384 Ga0070679_100000105
385 Ga0070684_100278180
386 Ga0068853_100246885
387 Ga0070665_100000536
388 Ga0070704_100226785
389 Ga0068864_100026531
390 Ga0081455_10018367
391 Ga0075365_10053257
392 Ga0075368_10040985
393 Ga0075364_10027639
394 Ga0075370_10037124
395 Ga0075428_100022275
396 Ga0075431_100392736
397 Ga0105242_10174457
398 Ga0182007_10003573
399 Ga0207426_1000393
400 Ga0207426_1008845
401 Ga0207426_1010084
402 Ga0207647_10008520
403 Ga0207705_10029928
404 Ga0207684_10022373
405 Ga0207684_10090149
406 Ga0207684_10207380
407 Ga0207707_10000027
408 Ga0207707_10000185
409 Ga0207693_10089715
410 Ga0207660_10001440
411 Ga0207660_10003836
412 Ga0207652_10000217
413 Ga0207652_10000575
414 Ga0207652_10009443
415 Ga0207700_10088718
416 Ga0207669_10024917
417 Ga0207661_10100542
418 Ga0207667_10158885
419 Ga0207667_10419276
420 Ga0207639_10216824
421 Ga0209282_1106956
422 Ga0268266_10026191
423 Ga0268265_10338124
424 Ga0307517_10096414
425 Ga0307515_10001023
426 Ga0265338_10151253
427 Ga0307511_10001886
428 Ga0307511_10054508
429 Ga0307511_10055830
430 Ga0307512_10010153
431 Ga0307512_10034795
432 Ga0307513_10003539
433 Ga0307513_10277915
434 Ga0307509_10062748
435 Ga0307508_10008345
436 Ga0307508_10075557
437 Ga0307508_10300719
438 Ga0307516_10010098
439 Ga0307516_10058602
440 Ga0307518_10030839
441 Ga0307518_10031900
442 Ga0307518_10061713
443 Ga0307518_10080915
444 Ga0307416_100095372
445 Ga0307416_100354826
446 Ga0307415_100379700
447 Ga0307507_10014834
448 Ga0307507_10019990
449 Ga0307507_10024114
450 Ga0307510_10007566
451 Ga0307510_10034112
452 Ga0373954_0068157
453 Ga0373933_0087018
454 Ga0373937_0118205
455 Ga0395898_0009610
456 Ga0395898_0082217
457 Ga0436365_0052999
458 Ga0439436_0045212
459 Ga0451837_0199371
460 Ga0451853_1335386
461 Ga0439448_0003884
462 Ga0439449_0000442
463 Ga0439449_0078917
464 Ga0439457_000676
465 Ga0439457_001457
466 Ga0450894_000344
467 Ga0450896_000776
468 Ga0450898_000918
469 Ga0450899_000532
470 Ga0450903_000010
471 Ga0439458_0002906
472 Ga0466965_0000328
473 Ga0466966_0003616
474 Ga0466966_0004959
475 Ga0466966_0057253
476 Ga0466961_0001263
477 Ga0466961_0011189
478 Ga0466961_0031216
479 Ga0466963_0002567
480 Ga0466964_0004936
481 Ga0466971_0000643
482 Ga0466968_0041479
483 Ga0466970_0000784
484 Ga0466957_0000472
485 Ga0466959_0001522
486 Ga0466958_0000634
487 Ga0466958_0235693
488 Ga0466967_0042859
489 Ga0466967_0334725
490 Ga0495592_0006615
491 Ga0495592_0060433
492 Ga0495603_0002864
493 Ga0495603_0014849
494 Ga0495603_0118318
495 Ga0495629_0001666
496 Ga0495629_0018200
497 Ga0495629_0022175
498 Ga0495629_0035001
499 Ga0495638_0029025
500 Ga0495651_0010135
501 Ga0495651_0150275
502 Ga0495653_0065668
503 Ga0495580_0019493
504 Ga0495582_0014173
505 Ga0495662_0001555
506 Ga0495662_0003574
507 Ga0495662_0009872
508 Ga0495664_0002328
509 Ga0495585_0096729
510 Ga0495594_0006114
511 Ga0495594_0008394
512 Ga0495594_0030258
513 Ga0495594_0041249
514 Ga0495607_0102084
515 Ga0495606_0005742
516 Ga0495608_0013112
517 Ga0495610_0097749
518 Ga0495616_0008908
519 Ga0495618_0069035
520 Ga0495618_0145639
521 Ga0495618_0217544
522 Ga0495620_0030329
523 Ga0495628_0034441
524 Ga0495630_0040830
525 Ga0495631_0009264
526 Ga0495632_0049450
527 Ga0495632_0052331
528 Ga0495643_0004562
529 Ga0495643_0009657
530 Ga0495648_0029585
531 Ga0495666_0019373
532 Ga0495652_0114328
533 Ga0495654_0057579
534 Ga0495640_0020653
535 Ga0495640_0075586
536 Ga0495640_0097669
537 Ga0495586_0005988
538 Ga0495587_0017545
539 Ga0495645_0003607
540 Ga0495645_0046561
541 Ga0495622_0008189
542 Ga0495622_0009969
543 Ga0495656_0178621
544 Ga0495668_0042237
545 Ga0495634_0014109
546 Ga0495611_0032725
547 Ga0495625_0013614
548 Ga0495635_0013819
549 Ga0495635_0019345
550 Ga0495635_0020363
551 Ga0495588_0001251
552 Ga0495588_0056310
553 Ga0495657_0007090
554 Ga0495657_0020933
555 Ga0495657_0046558
556 Ga0495623_0119402
557 Ga0495646_0001474
558 Ga0495646_0008763
559 Ga0495658_0016427
560 Ga0495658_0059112
561 Ga0495613_0008460
562 Ga0495613_0011963
563 Ga0495613_0020388
564 Ga0495613_0100037
565 Ga0495624_0192167
566 Ga0495670_0016001
567 Ga0495670_0103863
568 Ga0495671_0005347
569 Ga0495649_0070796
570 Ga0495649_0084388
571 Ga0495589_0021400
572 Ga0495589_0051864
573 Ga0495589_0065126
574 Ga0495589_0099914
575 Ga0495600_0022185
576 Ga0495600_0031049
577 Ga0495600_0031532
578 Ga0495581_0009392
579 Ga0495604_0000463
580 Ga0495604_0015229
581 Ga0495604_0027094
582 Ga0495636_0001674
583 Ga0495636_0003560
584 Ga0495674_0023360
585 Ga0495674_0054149
586 Ga0495672_0002597
587 Ga0495676_0004638
588 Ga0495676_0015381
589 Ga0495676_0017857
590 Ga0495676_0043000
591 Ga0495676_0044884
592 Ga0495680_0051895
593 Ga0495683_0013639
594 Ga0495683_0028662
595 Ga0495687_001642
596 Ga0495687_011964
597 Ga0495675_0011900
598 Ga0495685_000823
599 Ga0495685_004583
600 Ga0495685_006806
601 Ga0495685_020791
602 Ga0495685_025954
603 Ga0495681_0002257
604 Ga0495681_0008041
605 Ga0495593_0005975
606 Ga0495593_0024718
607 Ga0495593_0116013
608 Ga0495602_0017076
609 Ga0495614_0003035
610 Ga0495614_0004823
611 Ga0495614_0021049
612 Ga0495626_0038171
613 Ga0496100_0003291
614 Ga0496101_0010914
615 Ga0496102_0000332
616 Ga0496102_0018979
617 Ga0496103_0000113
618 Ga0496103_0009608
619 Ga0496104_0195573
620 Ga0496105_0218955
621 Ga0496106_0090037
622 Ga0496106_0115749
623 Ga0496107_0201094
624 Ga0496109_0107722
625 Ga0496114_0241520
626 Ga0496116_0000429
627 Ga0496116_0000530
628 Ga0496117_0000148
629 Ga0496117_0006116
630 Ga0496117_0012839
631 Ga0496118_0000042
632 Ga0496118_0000712
633 Ga0496119_0000243
634 Ga0496119_0001864
635 Ga0496119_0099728
636 Ga0496121_0005277
637 Ga0496121_0080863
638 Ga0496122_0001611
639 Ga0496122_0061080
640 Ga0496123_0051757
641 Ga0496125_0074885
642 Ga0496126_0000686
643 Ga0501033_0128769
644 Ga0501034_0001240
645 Ga0501034_0125194
646 Ga0501038_0006474
647 Ga0501047_0001074
648 Ga0501047_0037941
649 Ga0501047_0124963
650 Ga0501070_0368979
651 Ga0501080_0106103
652 Ga0501080_0306735
653 Ga0501044_0003264
654 Ga0501044_0014833
655 Ga0501044_0056560
656 Ga0501045_0321848
657 nmdc:mga00v17_5889_c1
658 nmdc:mga06z11_62418_c1
659 Ga0500578_0018430
660 Ga0500643_017079
661 Ga0500566_0123928
662 Ga0500640_020802
663 Ga0500660_040876
664 Ga0500560_011944
665 Ga0500560_051121
666 Ga0500569_013621
667 Ga0500595_028063
668 Ga0500652_003264
669 Ga0500658_0003847
670 Ga0500573_0062595
671 Ga0500600_0004326
672 Ga0500634_0003575
673 Ga0500587_003322
674 Ga0466962_0000306
675 8002780122
676 2508676150
677 2517763525
678 2583153171
679 2585306698
680 2585314200
681 2586062556
682 2616694176
683 2616899325
684 2643823674
685 2643897270
686 2643945265
687 2644271015
688 2644408415
689 2644432164
690 2644435679
691 2644535354
692 2644629494
693 2676198708
694 2774843286
695 2785345047
696 2785365938
697 2786668880
698 2808840489
699 2808919069
700 2809588265
701 2811847501
702 2812359691
703 2842889805
704 2852638329
705 2862288802
706 2862294025
707 2862392455
708 2862583061
709 2863406308
710 2867476506
711 2870787857
712 2875393214
713 2877684534
714 2912721738
715 2915771322
716 2918501319
717 2919473066
718 2935395528
719 2946051479
720 2946066219
721 2946074485
722 2947231154
723 2954387915
724 2954688976
725 2954698725
726 2954703497
727 2990064340
728 2995464362
729 2997602809
730 3006499815
731 8002789382
732 8004215042
733 8008561999
734 8048410021
735 8056064252
736 8056670388

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03060

NMO

Nitronate monooxygenase

16

351

0.93

PF00478

IMPDH

IMP dehydrogenase / GMP reductase domain

4

224

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
5gvj-assembly1.cif.gz_A-2 structure of fabk (m276a) mutant from thermotoga maritima 0.9538 7 343
5gvj-assembly2.cif.gz_B-3 structure of fabk (m276a) mutant from thermotoga maritima 0.9449 7 343
5gvj-assembly1.cif.gz_A-2 structure of fabk (m276a) mutant from thermotoga maritima 0.935 7 343
5gvj-assembly2.cif.gz_B-3 structure of fabk (m276a) mutant from thermotoga maritima 0.9295 7 343
5gvh-assembly1.cif.gz_A-2 structure of fabk from thermotoga maritima 0.9175 7 343
ID Description Score Start End Superfamily
5gvjA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9538 7 343 3.20.20.70
5gvjA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.935 7 343 3.20.20.70
af_Q0J4W4_4_271_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9122 14 252 3.20.20.70
af_A4I9N1_3_315_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9022 9 343 3.20.20.70
af_A4I9N1_3_315_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8883 9 343 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A4R4VAB7-F1-model_v4 Nitronate monooxygenase 0.9984 7 143 GO:0018580
AF-A0A7J0CL24-F1-model_v4 Nitronate monooxygenase domain-containing protein 0.9984 7 124 GO:0018580
AF-A0A5R8MCI6-F1-model_v4 Nitronate monooxygenase 0.997 7 130 GO:0018580
AF-A0A499VNE2-F1-model_v4 Nitronate monooxygenase domain-containing protein 0.9955 7 105 GO:0018580
AF-A0A7J5EHU8-F1-model_v4 Nitronate monooxygenase 0.9933 8 113 GO:0018580

Map