F424860

General Info

Members Datasets Scaffolds Average Seq Length
368 221 736 242

Family's Representative Sequence

Representative Sequence 3300050510|nmdc:mga06r32_139085_c1|nmdc:mga06r32_139085_c1_958_1812
Length 284
Sequence MNRTENRASALGENFQRLLIANGGIMNISNTTAVRDLAAGIPGATRVFENFGIDYCCGGRRTLADACREAGLPVEDLARSLEEAGEASQPGAERDWRQETLTTLSGHIIDIHHSYTRQEIDRLEKLFDKVCSRHGENHPELFEARKTFYQLKQDLIPHMLKEEQVLFPYITRMEDAAGDGRAIPPPFFGTVRNPVRMMMTEHDTAGDLLKQLRGVTNGYTTPSDVCISFQTLYQALAAFEADLHQHIHLENNILFPRAVEMEETSAPDFYKPTGEFNEHRCFGH

Samples

Sample ID Description Type Environment
1 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
138 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
139 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
140 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
141 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
142 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
143 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
144 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
145 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
146 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
147 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
148 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
149 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
150 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
151 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
154 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
155 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
156 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
157 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
158 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
159 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
160 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
161 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
162 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
163 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
164 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
165 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
166 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
167 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
170 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
171 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
172 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
173 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
174 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
175 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
176 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
177 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
178 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
179 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
180 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
181 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
182 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
183 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
184 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
185 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
186 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
187 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
188 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
189 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
190 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
191 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
192 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
193 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
194 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
196 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
197 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
198 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
199 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
200 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
201 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
202 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
203 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
204 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
205 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
206 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
207 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
208 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
209 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
210 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
211 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
212 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
213 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
214 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
215 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
216 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
217 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
218 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
219 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
220 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
221 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.09
Rhizosphere 98.37
Stem 0
Stem Tuber 0
Unclassified 19.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga06r32_139085_c1 3300050510 Bacteria 2404
2 JGI25406J46586_10002322 3300003203 Bacteria 8984
3 rootH1_10005683 3300003316 Bacteria 2191
4 Ga0070658_10142530 3300005327 Bacteria 2002
5 Ga0070683_100009998 3300005329 Bacteria 8136
6 Ga0070683_100035788 3300005329 Bacteria 4539
7 Ga0070683_100045766 3300005329 Bacteria 4039
8 Ga0070683_100137563 3300005329 Unclassified 2314
9 Ga0070670_100193944 3300005331 Bacteria 1765
10 Ga0070670_100202854 3300005331 Bacteria 1723
11 Ga0070677_10201041 3300005333 Bacteria 961
12 Ga0068869_100043336 3300005334 Bacteria 3231
13 Ga0070680_100032530 3300005336 Bacteria 4198
14 Ga0070680_100366752 3300005336 Bacteria 1225
15 Ga0068868_100031765 3300005338 Bacteria 4059
16 Ga0068868_100036733 3300005338 Unclassified 3794
17 Ga0070660_100026090 3300005339 Bacteria 4350
18 Ga0070689_100069683 3300005340 Bacteria 2744
19 Ga0070689_100152773 3300005340 Unclassified 1862
20 Ga0070687_100379556 3300005343 Bacteria 921
21 Ga0070669_100027847 3300005353 Bacteria 4068
22 Ga0070669_100666392 3300005353 Unclassified 876
23 Ga0070671_100033059 3300005355 Unclassified 4276
24 Ga0070674_100030716 3300005356 Unclassified 3554
25 Ga0070673_100129398 3300005364 Bacteria 2116
26 Ga0070659_100337048 3300005366 Bacteria 1263
27 Ga0070667_100677152 3300005367 Unclassified 953
28 Ga0070709_10147862 3300005434 Unclassified 1621
29 Ga0070714_100162580 3300005435 Bacteria 2021
30 Ga0070713_100222841 3300005436 Unclassified 1711
31 Ga0070701_10019783 3300005438 Unclassified 3184
32 Ga0070705_100012066 3300005440 Unclassified 4379
33 Ga0070705_100135756 3300005440 Bacteria 1611
34 Ga0070705_100705923 3300005440 Bacteria 793
35 Ga0070694_100002322 3300005444 Bacteria 11248
36 Ga0070662_100302850 3300005457 Unclassified 1299
37 Ga0070681_10007539 3300005458 Bacteria 10633
38 Ga0070681_10012331 3300005458 Bacteria 8475
39 Ga0068867_100132003 3300005459 Bacteria 1942
40 Ga0070679_100000945 3300005530 Bacteria 25224
41 Ga0070679_100056812 3300005530 Unclassified 3900
42 Ga0070679_100106679 3300005530 Unclassified 2787
43 Ga0070684_100005440 3300005535 Bacteria 9755
44 Ga0070684_100041023 3300005535 Bacteria 3988
45 Ga0070684_100045171 3300005535 Bacteria 3814
46 Ga0070684_100160873 3300005535 Bacteria 2037
47 Ga0070697_100000055 3300005536 Bacteria 86691
48 Ga0068853_100303576 3300005539 Bacteria 1476
49 Ga0070672_100072318 3300005543 Bacteria 2745
50 Ga0070686_100128887 3300005544 Unclassified 1747
51 Ga0070686_100195502 3300005544 Bacteria 1446
52 Ga0070665_100054701 3300005548 Bacteria 4002
53 Ga0068855_100018409 3300005563 Bacteria 8392
54 Ga0068855_100023432 3300005563 Bacteria 7394
55 Ga0068855_100049158 3300005563 Unclassified 4975
56 Ga0068855_100099486 3300005563 Bacteria 3349
57 Ga0068855_100165587 3300005563 Bacteria 2507
58 Ga0068855_100446521 3300005563 Bacteria 1412
59 Ga0070664_100001384 3300005564 Bacteria 19331
60 Ga0068857_100001030 3300005577 Bacteria 21530
61 Ga0068857_100039120 3300005577 Bacteria 4201
62 Ga0068857_100127458 3300005577 Bacteria 2294
63 Ga0068854_100055779 3300005578 Unclassified 2846
64 Ga0068854_100469717 3300005578 Unclassified 1054
65 Ga0068856_100048248 3300005614 Bacteria 4195
66 Ga0068856_100070015 3300005614 Bacteria 3469
67 Ga0068856_100123465 3300005614 Bacteria 2592
68 Ga0068856_100159402 3300005614 Bacteria 2266
69 Ga0068856_100369245 3300005614 Unclassified 1454
70 Ga0070702_100036249 3300005615 Bacteria 2731
71 Ga0068852_100000021 3300005616 Bacteria 126061
72 Ga0068852_100085752 3300005616 Bacteria 2806
73 Ga0068852_100166056 3300005616 Bacteria 2065
74 Ga0068859_100001894 3300005617 Bacteria 21321
75 Ga0068859_100054756 3300005617 Unclassified 4013
76 Ga0068859_100068790 3300005617 Bacteria 3575
77 Ga0068864_100004471 3300005618 Bacteria 11491
78 Ga0068864_100194694 3300005618 Bacteria 1859
79 Ga0068866_10005495 3300005718 Bacteria 5235
80 Ga0068866_10013391 3300005718 Bacteria 3598
81 Ga0068861_100094679 3300005719 Unclassified 2364
82 Ga0068861_100151685 3300005719 Unclassified 1902
83 Ga0068851_10122774 3300005834 Unclassified 1397
84 Ga0068870_10003682 3300005840 Bacteria 6513
85 Ga0068863_100179995 3300005841 Bacteria 2029
86 Ga0068858_100020410 3300005842 Bacteria 6195
87 Ga0068858_100245058 3300005842 Bacteria 1701
88 Ga0068858_100726657 3300005842 Bacteria 967
89 Ga0068860_100034555 3300005843 Unclassified 4850
90 Ga0068860_100070031 3300005843 Bacteria 3334
91 Ga0081455_10001934 3300005937 Bacteria 24890
92 Ga0081455_10013263 3300005937 Bacteria 8163
93 Ga0081455_10036377 3300005937 Unclassified 4384
94 Ga0081539_10003514 3300005985 Bacteria 19110
95 Ga0070716_100050354 3300006173 Bacteria 2364
96 Ga0097621_100007811 3300006237 Bacteria 7674
97 Ga0097621_100089165 3300006237 Bacteria 2578
98 Ga0068871_100016982 3300006358 Bacteria 5496
99 Ga0075428_100842771 3300006844 Unclassified 974
100 Ga0075430_100316709 3300006846 Bacteria 1290
101 Ga0075431_100104893 3300006847 Unclassified 2917
102 Ga0075431_100115450 3300006847 Bacteria 2771
103 Ga0075431_100298824 3300006847 Bacteria 1627
104 Ga0075434_100308145 3300006871 Unclassified 1604
105 Ga0075434_100595090 3300006871 Bacteria 1125
106 Ga0068865_100003891 3300006881 Bacteria 8957
107 Ga0068865_100141704 3300006881 Bacteria 1813
108 Ga0097620_100001894 3300006931 Bacteria 21321
109 Ga0097620_100054755 3300006931 Unclassified 4013
110 Ga0097620_100068790 3300006931 Bacteria 3575
111 Ga0075435_100029001 3300007076 Bacteria 4343
112 Ga0105240_10002385 3300009093 Bacteria 30289
113 Ga0105240_10003055 3300009093 Bacteria 26321
114 Ga0105240_10126840 3300009093 Bacteria 3065
115 Ga0105240_10427264 3300009093 Unclassified 1487
116 Ga0105240_11093455 3300009093 Unclassified 849
117 Ga0111539_10018934 3300009094 Bacteria 8514
118 Ga0105245_10000186 3300009098 Bacteria 58710
119 Ga0105245_10103985 3300009098 Unclassified 2632
120 Ga0114129_11406973 3300009147 Bacteria 860
121 Ga0105241_10002350 3300009174 Bacteria 14209
122 Ga0105241_10045062 3300009174 Unclassified 3344
123 Ga0105241_10457372 3300009174 Bacteria 1130
124 Ga0105242_10004946 3300009176 Bacteria 10319
125 Ga0105248_10035324 3300009177 Bacteria 5591
126 Ga0105248_10172848 3300009177 Unclassified 2435
127 Ga0105237_10114956 3300009545 Bacteria 2684
128 Ga0105237_10242757 3300009545 Bacteria 1803
129 Ga0105237_10861943 3300009545 Bacteria 913
130 Ga0105238_10008807 3300009551 Bacteria 10096
131 Ga0105238_10044289 3300009551 Bacteria 4499
132 Ga0105238_10089927 3300009551 Bacteria 3057
133 Ga0105249_10338583 3300009553 Bacteria 1520
134 Ga0105239_10087816 3300010375 Unclassified 3428
135 Ga0105239_10164076 3300010375 Bacteria 2483
136 Ga0157373_10011001 3300013100 Bacteria 6663
137 Ga0157373_10105202 3300013100 Unclassified 1985
138 Ga0157373_10219961 3300013100 Unclassified 1340
139 Ga0157371_10027426 3300013102 Bacteria 4132
140 Ga0157370_10000067 3300013104 Bacteria 113351
141 Ga0157370_10017919 3300013104 Bacteria 7132
142 Ga0157370_10073901 3300013104 Bacteria 3216
143 Ga0157370_10482488 3300013104 Bacteria 1139
144 Ga0157370_10531492 3300013104 Bacteria 1079
145 Ga0157370_10536216 3300013104 Bacteria 1073
146 Ga0157369_10001168 3300013105 Bacteria 32769
147 Ga0157369_10006658 3300013105 Bacteria 13352
148 Ga0157369_10009444 3300013105 Bacteria 11150
149 Ga0157369_10077408 3300013105 Unclassified 3564
150 Ga0157369_10132516 3300013105 Bacteria 2640
151 Ga0157369_10187012 3300013105 Bacteria 2178
152 Ga0157374_10001549 3300013296 Bacteria 19372
153 Ga0157374_10009039 3300013296 Bacteria 8543
154 Ga0157374_10498074 3300013296 Bacteria 1223
155 Ga0157378_10001211 3300013297 Bacteria 23426
156 Ga0157378_10026354 3300013297 Bacteria 5124
157 Ga0157378_10073929 3300013297 Bacteria 3066
158 Ga0163162_10012824 3300013306 Bacteria 8186
159 Ga0163162_10473080 3300013306 Bacteria 1385
160 Ga0157372_10001720 3300013307 Bacteria 23742
161 Ga0157372_10008305 3300013307 Bacteria 11039
162 Ga0157372_10011340 3300013307 Bacteria 9478
163 Ga0157372_10014476 3300013307 Bacteria 8441
164 Ga0157372_10021287 3300013307 Bacteria 7004
165 Ga0157372_10390073 3300013307 Unclassified 1623
166 Ga0157372_10809260 3300013307 Bacteria 1088
167 Ga0157375_10208858 3300013308 Bacteria 2109
168 Ga0157375_10554243 3300013308 Unclassified 1311
169 Ga0163163_10081868 3300014325 Bacteria 3231
170 Ga0157380_10015405 3300014326 Bacteria 5619
171 Ga0157380_10197738 3300014326 Bacteria 1781
172 Ga0157377_10190375 3300014745 Unclassified 1296
173 Ga0157376_10710434 3300014969 Bacteria 1011
174 Ga0163161_10016372 3300017792 Bacteria 5175
175 Ga0207642_10011568 3300025899 Unclassified 3154
176 Ga0207642_10015055 3300025899 Unclassified 2871
177 Ga0207680_10196464 3300025903 Bacteria 1372
178 Ga0207647_10121747 3300025904 Bacteria 1538
179 Ga0207699_10157216 3300025906 Unclassified 1510
180 Ga0207643_10051535 3300025908 Bacteria 2336
181 Ga0207705_10010468 3300025909 Bacteria 6744
182 Ga0207654_10000034 3300025911 Bacteria 113041
183 Ga0207654_10132122 3300025911 Bacteria 1581
184 Ga0207654_10426150 3300025911 Bacteria 927
185 Ga0207707_10012272 3300025912 Bacteria 7448
186 Ga0207695_10000026 3300025913 Bacteria 624558
187 Ga0207695_10011293 3300025913 Bacteria 10827
188 Ga0207695_10037145 3300025913 Bacteria 5257
189 Ga0207671_10117105 3300025914 Bacteria 2033
190 Ga0207660_10050809 3300025917 Bacteria 2945
191 Ga0207660_10218694 3300025917 Unclassified 1494
192 Ga0207662_10005452 3300025918 Bacteria 6788
193 Ga0207657_10002216 3300025919 Bacteria 21083
194 Ga0207657_10517531 3300025919 Bacteria 934
195 Ga0207652_10143717 3300025921 Unclassified 2134
196 Ga0207646_10015069 3300025922 Bacteria 7316
197 Ga0207681_10008189 3300025923 Bacteria 6393
198 Ga0207694_10006117 3300025924 Bacteria 9201
199 Ga0207694_10035590 3300025924 Bacteria 3821
200 Ga0207650_10258260 3300025925 Bacteria 1412
201 Ga0207687_10000725 3300025927 Bacteria 22382
202 Ga0207664_10004519 3300025929 Bacteria 9426
203 Ga0207664_10175375 3300025929 Bacteria 1837
204 Ga0207644_10708987 3300025931 Bacteria 839
205 Ga0207706_10223658 3300025933 Bacteria 1648
206 Ga0207686_10004860 3300025934 Bacteria 7223
207 Ga0207670_10012852 3300025936 Bacteria 4914
208 Ga0207670_10138005 3300025936 Bacteria 1795
209 Ga0207669_10137519 3300025937 Bacteria 1690
210 Ga0207704_10028051 3300025938 Bacteria 3117
211 Ga0207704_10116236 3300025938 Bacteria 1820
212 Ga0207665_10057866 3300025939 Bacteria 2619
213 Ga0207691_10024825 3300025940 Bacteria 5634
214 Ga0207711_10018200 3300025941 Bacteria 5840
215 Ga0207689_10005730 3300025942 Bacteria 11036
216 Ga0207661_10008786 3300025944 Bacteria 7228
217 Ga0207661_10027451 3300025944 Bacteria 4349
218 Ga0207661_10061310 3300025944 Bacteria 3038
219 Ga0207661_10084946 3300025944 Bacteria 2623
220 Ga0207679_10000979 3300025945 Bacteria 18360
221 Ga0207667_10000056 3300025949 Bacteria 206107
222 Ga0207667_10002988 3300025949 Bacteria 21008
223 Ga0207667_10007192 3300025949 Bacteria 13428
224 Ga0207667_10057713 3300025949 Unclassified 4073
225 Ga0207667_10125799 3300025949 Bacteria 2640
226 Ga0207712_10553901 3300025961 Bacteria 989
227 Ga0207640_10042530 3300025981 Unclassified 2898
228 Ga0207640_10379461 3300025981 Unclassified 1145
229 Ga0207640_10382433 3300025981 Bacteria 1141
230 Ga0207677_10000865 3300026023 Bacteria 17254
231 Ga0207677_10198323 3300026023 Unclassified 1593
232 Ga0207703_10029866 3300026035 Bacteria 4304
233 Ga0207703_10201357 3300026035 Bacteria 1769
234 Ga0207639_10267683 3300026041 Bacteria 1498
235 Ga0207702_10021859 3300026078 Bacteria 5298
236 Ga0207702_10107287 3300026078 Bacteria 2476
237 Ga0207702_10141763 3300026078 Bacteria 2176
238 Ga0207702_10143875 3300026078 Bacteria 2161
239 Ga0207641_10016410 3300026088 Bacteria 6064
240 Ga0207648_10015972 3300026089 Bacteria 6879
241 Ga0207648_10230184 3300026089 Bacteria 1649
242 Ga0207676_10014393 3300026095 Bacteria 5690
243 Ga0207676_10069828 3300026095 Bacteria 2814
244 Ga0207674_10003030 3300026116 Bacteria 20822
245 Ga0207674_10023573 3300026116 Bacteria 6590
246 Ga0207674_10049485 3300026116 Unclassified 4298
247 Ga0207675_100024853 3300026118 Bacteria 5575
248 Ga0207675_100062211 3300026118 Bacteria 3485
249 Ga0207683_10148213 3300026121 Unclassified 2117
250 Ga0207698_10000016 3300026142 Bacteria 183355
251 Ga0207698_10159443 3300026142 Bacteria 1971
252 Ga0207698_10282950 3300026142 Bacteria 1535
253 Ga0207698_10418399 3300026142 Bacteria 1285
254 Ga0207428_10004578 3300027907 Bacteria 13102
255 Ga0268264_10003531 3300028381 Bacteria 13465
256 Ga0265323_10002765 3300028653 Bacteria 7907
257 Ga0265338_10016700 3300028800 Bacteria 7955
258 Ga0265338_10055106 3300028800 Unclassified 3540
259 Ga0265338_10370982 3300028800 Bacteria 1025
260 Ga0265330_10156980 3300031235 Bacteria 966
261 Ga0265325_10000515 3300031241 Bacteria 28005
262 Ga0265325_10015797 3300031241 Bacteria 4235
263 Ga0265340_10001090 3300031247 Bacteria 15466
264 Ga0265340_10010111 3300031247 Bacteria 5055
265 Ga0265340_10169096 3300031247 Bacteria 991
266 Ga0265339_10000013 3300031249 Bacteria 197953
267 Ga0265331_10038355 3300031250 Bacteria 2342
268 Ga0265316_10003692 3300031344 Bacteria 15426
269 Ga0265316_10173753 3300031344 Unclassified 1606
270 Ga0265316_10522163 3300031344 Bacteria 847
271 Ga0307513_10023153 3300031456 Bacteria 7267
272 Ga0307408_100008359 3300031548 Bacteria 6834
273 Ga0307408_100137620 3300031548 Bacteria 1913
274 Ga0265313_10004842 3300031595 Bacteria 10119
275 Ga0265313_10008282 3300031595 Bacteria 6931
276 Ga0265342_10001946 3300031712 Bacteria 18489
277 Ga0307405_10004407 3300031731 Bacteria 6654
278 Ga0307413_10009748 3300031824 Bacteria 4614
279 Ga0307406_10018752 3300031901 Bacteria 4048
280 Ga0307416_100019234 3300032002 Bacteria 4837
281 Ga0307414_10001934 3300032004 Bacteria 10717
282 Ga0307411_10011846 3300032005 Bacteria 4729
283 Ga0307415_100016981 3300032126 Bacteria 4354
284 Ga0373959_0071125 3300034820 Unclassified 787
285 Ga0373934_0002815 3300035086 Bacteria 6371
286 Ga0373934_0004264 3300035086 Bacteria 5280
287 Ga0373941_0114157 3300035115 Unclassified 955
288 Ga0373954_0007507 3300035118 Bacteria 4770
289 Ga0373956_0003684 3300035119 Bacteria 6183
290 Ga0373956_0005592 3300035119 Bacteria 5026
291 Ga0373957_0023019 3300035120 Bacteria 2224
292 Ga0373955_0001572 3300035172 Bacteria 9761
293 Ga0373955_0002140 3300035172 Bacteria 8534
294 Ga0373955_0195785 3300035172 Unclassified 1202
295 Ga0373961_0048482 3300035241 Bacteria 1252
296 Ga0373924_0219531 3300035410 Unclassified 840
297 Ga0373935_0416208 3300035692 Unclassified 967
298 Ga0373933_0000093 3300035724 Bacteria 56013
299 Ga0373933_0009384 3300035724 Bacteria 5344
300 Ga0373933_0106623 3300035724 Unclassified 1744
301 Ga0373937_0000020 3300036401 Bacteria 131263
302 Ga0373937_0004934 3300036401 Bacteria 11340
303 Ga0373925_0204414 3300037068 Unclassified 1572
304 Ga0395900_0451424 3300037418 Bacteria 1242
305 Ga0395898_0086547 3300037466 Bacteria 3020
306 Ga0395898_0276276 3300037466 Unclassified 1602
307 Ga0395898_0351712 3300037466 Unclassified 1405
308 Ga0395901_0683641 3300038443 Bacteria 1026
309 Ga0451577_0280710 3300042876 Bacteria 1509
310 Ga0453683_0075795 3300044673 Unclassified 2106
311 Ga0466961_0301208 3300044693 Bacteria 979
312 Ga0451576_0249453 3300045051 Bacteria 1855
313 Ga0451576_0305882 3300045051 Unclassified 1663
314 Ga0451576_0341232 3300045051 Bacteria 1568
315 Ga0466967_0344665 3300045976 Bacteria 1441
316 Ga0495653_0052802 3300046463 Bacteria 3114
317 Ga0495653_0120413 3300046463 Bacteria 1872
318 Ga0495608_0043548 3300046511 Bacteria 2999
319 Ga0495652_0229049 3300046529 Bacteria 1391
320 Ga0495587_0001999 3300046536 Bacteria 13591
321 Ga0495587_0004413 3300046536 Bacteria 9267
322 Ga0495587_0126066 3300046536 Bacteria 1465
323 Ga0495667_0047938 3300046559 Bacteria 2821
324 Ga0495635_0305921 3300046663 Bacteria 1065
325 Ga0495657_0071829 3300046675 Bacteria 2259
326 Ga0495623_0049187 3300046679 Bacteria 2672
327 Ga0495623_0139053 3300046679 Bacteria 1446
328 Ga0495581_0074789 3300047315 Unclassified 1960
329 Ga0495604_0000432 3300047317 Bacteria 37715
330 Ga0495604_0036251 3300047317 Bacteria 3889
331 Ga0495675_0000967 3300047444 Bacteria 17453
332 Ga0495684_0005390 3300047471 Bacteria 9960
333 Ga0495602_0000037 3300048088 Bacteria 132280
334 Ga0495602_0003166 3300048088 Bacteria 16961
335 Ga0496100_0629245 3300048903 Bacteria 835
336 Ga0496109_0000309 3300048912 Bacteria 46079
337 Ga0496112_0218289 3300048915 Bacteria 1863
338 Ga0496113_0242377 3300048916 Bacteria 1439
339 Ga0501047_0411249 3300049581 Bacteria 1185
340 Ga0501070_0488523 3300049586 Unclassified 990
341 Ga0501202_000706 3300049652 Bacteria 4982
342 Ga0501207_000442 3300049654 Bacteria 4639
343 Ga0501209_001771 3300049656 Bacteria 3143
344 Ga0501216_003966 3300049660 Bacteria 2178
345 Ga0501217_000434 3300049661 Bacteria 6814
346 Ga0501223_001325 3300049663 Bacteria 5730
347 Ga0501224_000441 3300049664 Bacteria 4974
348 Ga0501227_003060 3300049665 Bacteria 3642
349 Ga0501230_004382 3300049667 Bacteria 1937
350 Ga0501233_004171 3300049668 Bacteria 2634
351 Ga0501235_008323 3300049669 Bacteria 2263
352 Ga0501253_041200 3300049683 Unclassified 931
353 Ga0501257_014301 3300049686 Bacteria 1823
354 Ga0501260_001462 3300049689 Bacteria 1953
355 Ga0501221_010290 3300049704 Bacteria 1658
356 Ga0501225_0001580 3300049705 Bacteria 7137
357 Ga0501234_000377 3300049707 Bacteria 6617
358 Ga0501212_014198 3300049851 Bacteria 1176
359 Ga0501226_000405 3300049853 Bacteria 6184
360 nmdc:mga05p37_258423_c1 3300050507 Bacteria 2086
361 nmdc:mga0qj67_281832_c1 3300050509 Bacteria 1347
362 nmdc:mga06r32_13595_c1 3300050510 Bacteria 7379
363 nmdc:mga06r32_229692_c1 3300050510 Bacteria 1843
364 nmdc:mga08y16_9913_c1 3300050511 Bacteria 10001
365 nmdc:mga0n895_636688_c1 3300050512 Bacteria 1066
366 nmdc:mga0rr50_17625_c1 3300050513 Bacteria 4773
367 Ga0495619_0157450 3300053085 Unclassified 1568
368 Ga0501084_0045922 3300054114 Unclassified 3657
369 nmdc:mga06r32_139085_c1
370 JGI25406J46586_10002322
371 rootH1_10005683
372 Ga0070658_10142530
373 Ga0070683_100009998
374 Ga0070683_100035788
375 Ga0070683_100045766
376 Ga0070683_100137563
377 Ga0070670_100193944
378 Ga0070670_100202854
379 Ga0070677_10201041
380 Ga0068869_100043336
381 Ga0070680_100032530
382 Ga0070680_100366752
383 Ga0068868_100031765
384 Ga0068868_100036733
385 Ga0070660_100026090
386 Ga0070689_100069683
387 Ga0070689_100152773
388 Ga0070687_100379556
389 Ga0070669_100027847
390 Ga0070669_100666392
391 Ga0070671_100033059
392 Ga0070674_100030716
393 Ga0070673_100129398
394 Ga0070659_100337048
395 Ga0070667_100677152
396 Ga0070709_10147862
397 Ga0070714_100162580
398 Ga0070713_100222841
399 Ga0070701_10019783
400 Ga0070705_100012066
401 Ga0070705_100135756
402 Ga0070705_100705923
403 Ga0070694_100002322
404 Ga0070662_100302850
405 Ga0070681_10007539
406 Ga0070681_10012331
407 Ga0068867_100132003
408 Ga0070679_100000945
409 Ga0070679_100056812
410 Ga0070679_100106679
411 Ga0070684_100005440
412 Ga0070684_100041023
413 Ga0070684_100045171
414 Ga0070684_100160873
415 Ga0070697_100000055
416 Ga0068853_100303576
417 Ga0070672_100072318
418 Ga0070686_100128887
419 Ga0070686_100195502
420 Ga0070665_100054701
421 Ga0068855_100018409
422 Ga0068855_100023432
423 Ga0068855_100049158
424 Ga0068855_100099486
425 Ga0068855_100165587
426 Ga0068855_100446521
427 Ga0070664_100001384
428 Ga0068857_100001030
429 Ga0068857_100039120
430 Ga0068857_100127458
431 Ga0068854_100055779
432 Ga0068854_100469717
433 Ga0068856_100048248
434 Ga0068856_100070015
435 Ga0068856_100123465
436 Ga0068856_100159402
437 Ga0068856_100369245
438 Ga0070702_100036249
439 Ga0068852_100000021
440 Ga0068852_100085752
441 Ga0068852_100166056
442 Ga0068859_100001894
443 Ga0068859_100054756
444 Ga0068859_100068790
445 Ga0068864_100004471
446 Ga0068864_100194694
447 Ga0068866_10005495
448 Ga0068866_10013391
449 Ga0068861_100094679
450 Ga0068861_100151685
451 Ga0068851_10122774
452 Ga0068870_10003682
453 Ga0068863_100179995
454 Ga0068858_100020410
455 Ga0068858_100245058
456 Ga0068858_100726657
457 Ga0068860_100034555
458 Ga0068860_100070031
459 Ga0081455_10001934
460 Ga0081455_10013263
461 Ga0081455_10036377
462 Ga0081539_10003514
463 Ga0070716_100050354
464 Ga0097621_100007811
465 Ga0097621_100089165
466 Ga0068871_100016982
467 Ga0075428_100842771
468 Ga0075430_100316709
469 Ga0075431_100104893
470 Ga0075431_100115450
471 Ga0075431_100298824
472 Ga0075434_100308145
473 Ga0075434_100595090
474 Ga0068865_100003891
475 Ga0068865_100141704
476 Ga0097620_100001894
477 Ga0097620_100054755
478 Ga0097620_100068790
479 Ga0075435_100029001
480 Ga0105240_10002385
481 Ga0105240_10003055
482 Ga0105240_10126840
483 Ga0105240_10427264
484 Ga0105240_11093455
485 Ga0111539_10018934
486 Ga0105245_10000186
487 Ga0105245_10103985
488 Ga0114129_11406973
489 Ga0105241_10002350
490 Ga0105241_10045062
491 Ga0105241_10457372
492 Ga0105242_10004946
493 Ga0105248_10035324
494 Ga0105248_10172848
495 Ga0105237_10114956
496 Ga0105237_10242757
497 Ga0105237_10861943
498 Ga0105238_10008807
499 Ga0105238_10044289
500 Ga0105238_10089927
501 Ga0105249_10338583
502 Ga0105239_10087816
503 Ga0105239_10164076
504 Ga0157373_10011001
505 Ga0157373_10105202
506 Ga0157373_10219961
507 Ga0157371_10027426
508 Ga0157370_10000067
509 Ga0157370_10017919
510 Ga0157370_10073901
511 Ga0157370_10482488
512 Ga0157370_10531492
513 Ga0157370_10536216
514 Ga0157369_10001168
515 Ga0157369_10006658
516 Ga0157369_10009444
517 Ga0157369_10077408
518 Ga0157369_10132516
519 Ga0157369_10187012
520 Ga0157374_10001549
521 Ga0157374_10009039
522 Ga0157374_10498074
523 Ga0157378_10001211
524 Ga0157378_10026354
525 Ga0157378_10073929
526 Ga0163162_10012824
527 Ga0163162_10473080
528 Ga0157372_10001720
529 Ga0157372_10008305
530 Ga0157372_10011340
531 Ga0157372_10014476
532 Ga0157372_10021287
533 Ga0157372_10390073
534 Ga0157372_10809260
535 Ga0157375_10208858
536 Ga0157375_10554243
537 Ga0163163_10081868
538 Ga0157380_10015405
539 Ga0157380_10197738
540 Ga0157377_10190375
541 Ga0157376_10710434
542 Ga0163161_10016372
543 Ga0207642_10011568
544 Ga0207642_10015055
545 Ga0207680_10196464
546 Ga0207647_10121747
547 Ga0207699_10157216
548 Ga0207643_10051535
549 Ga0207705_10010468
550 Ga0207654_10000034
551 Ga0207654_10132122
552 Ga0207654_10426150
553 Ga0207707_10012272
554 Ga0207695_10000026
555 Ga0207695_10011293
556 Ga0207695_10037145
557 Ga0207671_10117105
558 Ga0207660_10050809
559 Ga0207660_10218694
560 Ga0207662_10005452
561 Ga0207657_10002216
562 Ga0207657_10517531
563 Ga0207652_10143717
564 Ga0207646_10015069
565 Ga0207681_10008189
566 Ga0207694_10006117
567 Ga0207694_10035590
568 Ga0207650_10258260
569 Ga0207687_10000725
570 Ga0207664_10004519
571 Ga0207664_10175375
572 Ga0207644_10708987
573 Ga0207706_10223658
574 Ga0207686_10004860
575 Ga0207670_10012852
576 Ga0207670_10138005
577 Ga0207669_10137519
578 Ga0207704_10028051
579 Ga0207704_10116236
580 Ga0207665_10057866
581 Ga0207691_10024825
582 Ga0207711_10018200
583 Ga0207689_10005730
584 Ga0207661_10008786
585 Ga0207661_10027451
586 Ga0207661_10061310
587 Ga0207661_10084946
588 Ga0207679_10000979
589 Ga0207667_10000056
590 Ga0207667_10002988
591 Ga0207667_10007192
592 Ga0207667_10057713
593 Ga0207667_10125799
594 Ga0207712_10553901
595 Ga0207640_10042530
596 Ga0207640_10379461
597 Ga0207640_10382433
598 Ga0207677_10000865
599 Ga0207677_10198323
600 Ga0207703_10029866
601 Ga0207703_10201357
602 Ga0207639_10267683
603 Ga0207702_10021859
604 Ga0207702_10107287
605 Ga0207702_10141763
606 Ga0207702_10143875
607 Ga0207641_10016410
608 Ga0207648_10015972
609 Ga0207648_10230184
610 Ga0207676_10014393
611 Ga0207676_10069828
612 Ga0207674_10003030
613 Ga0207674_10023573
614 Ga0207674_10049485
615 Ga0207675_100024853
616 Ga0207675_100062211
617 Ga0207683_10148213
618 Ga0207698_10000016
619 Ga0207698_10159443
620 Ga0207698_10282950
621 Ga0207698_10418399
622 Ga0207428_10004578
623 Ga0268264_10003531
624 Ga0265323_10002765
625 Ga0265338_10016700
626 Ga0265338_10055106
627 Ga0265338_10370982
628 Ga0265330_10156980
629 Ga0265325_10000515
630 Ga0265325_10015797
631 Ga0265340_10001090
632 Ga0265340_10010111
633 Ga0265340_10169096
634 Ga0265339_10000013
635 Ga0265331_10038355
636 Ga0265316_10003692
637 Ga0265316_10173753
638 Ga0265316_10522163
639 Ga0307513_10023153
640 Ga0307408_100008359
641 Ga0307408_100137620
642 Ga0265313_10004842
643 Ga0265313_10008282
644 Ga0265342_10001946
645 Ga0307405_10004407
646 Ga0307413_10009748
647 Ga0307406_10018752
648 Ga0307416_100019234
649 Ga0307414_10001934
650 Ga0307411_10011846
651 Ga0307415_100016981
652 Ga0373959_0071125
653 Ga0373934_0002815
654 Ga0373934_0004264
655 Ga0373941_0114157
656 Ga0373954_0007507
657 Ga0373956_0003684
658 Ga0373956_0005592
659 Ga0373957_0023019
660 Ga0373955_0001572
661 Ga0373955_0002140
662 Ga0373955_0195785
663 Ga0373961_0048482
664 Ga0373924_0219531
665 Ga0373935_0416208
666 Ga0373933_0000093
667 Ga0373933_0009384
668 Ga0373933_0106623
669 Ga0373937_0000020
670 Ga0373937_0004934
671 Ga0373925_0204414
672 Ga0395900_0451424
673 Ga0395898_0086547
674 Ga0395898_0276276
675 Ga0395898_0351712
676 Ga0395901_0683641
677 Ga0451577_0280710
678 Ga0453683_0075795
679 Ga0466961_0301208
680 Ga0451576_0249453
681 Ga0451576_0305882
682 Ga0451576_0341232
683 Ga0466967_0344665
684 Ga0495653_0052802
685 Ga0495653_0120413
686 Ga0495608_0043548
687 Ga0495652_0229049
688 Ga0495587_0001999
689 Ga0495587_0004413
690 Ga0495587_0126066
691 Ga0495667_0047938
692 Ga0495635_0305921
693 Ga0495657_0071829
694 Ga0495623_0049187
695 Ga0495623_0139053
696 Ga0495581_0074789
697 Ga0495604_0000432
698 Ga0495604_0036251
699 Ga0495675_0000967
700 Ga0495684_0005390
701 Ga0495602_0000037
702 Ga0495602_0003166
703 Ga0496100_0629245
704 Ga0496109_0000309
705 Ga0496112_0218289
706 Ga0496113_0242377
707 Ga0501047_0411249
708 Ga0501070_0488523
709 Ga0501202_000706
710 Ga0501207_000442
711 Ga0501209_001771
712 Ga0501216_003966
713 Ga0501217_000434
714 Ga0501223_001325
715 Ga0501224_000441
716 Ga0501227_003060
717 Ga0501230_004382
718 Ga0501233_004171
719 Ga0501235_008323
720 Ga0501253_041200
721 Ga0501257_014301
722 Ga0501260_001462
723 Ga0501221_010290
724 Ga0501225_0001580
725 Ga0501234_000377
726 Ga0501212_014198
727 Ga0501226_000405
728 nmdc:mga05p37_258423_c1
729 nmdc:mga0qj67_281832_c1
730 nmdc:mga06r32_13595_c1
731 nmdc:mga06r32_229692_c1
732 nmdc:mga08y16_9913_c1
733 nmdc:mga0n895_636688_c1
734 nmdc:mga0rr50_17625_c1
735 Ga0495619_0157450
736 Ga0501084_0045922

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04405

ScdA_N

Domain of Unknown function (DUF542)

30

85

0.96

PF01814

Hemerythrin

Hemerythrin HHE cation binding domain

104

258

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5fnn-assembly2.cif.gz_B iron and selenomethionine containing iron sulfur cluster repair protein ytfe 0.9059 4 238
5fnp-assembly2.cif.gz_B high resolution zn containing iron sulfur cluster repair protein ytfe 0.9041 4 238
5fnn-assembly2.cif.gz_B iron and selenomethionine containing iron sulfur cluster repair protein ytfe 0.9018 4 238
5fnp-assembly2.cif.gz_B high resolution zn containing iron sulfur cluster repair protein ytfe 0.9 4 238
5fny-assembly2.cif.gz_B low solvent content crystal form of zn containing iron sulfur cluster repair protein ytfe 0.8911 4 238
ID Description Score Start End Superfamily
af_P72360_81_224_1.20.120.520 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);nmb1532 protein domain like 0.9448 83 235 1.20.120.520
af_P72360_81_224_1.20.120.520 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);nmb1532 protein domain like 0.9322 83 235 1.20.120.520
af_P69506_74_219_1.20.120.520 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);nmb1532 protein domain like 0.9246 80 236 1.20.120.520
af_P69506_74_219_1.20.120.520 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);nmb1532 protein domain like 0.9063 80 236 1.20.120.520
af_I1MS50_29_191_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.6465 74 227 1.20.140.40
ID Description Score Start End GO Terms
AF-A0A3S0BQG1-F1-model_v4 Iron-sulfur cluster repair di-iron protein 0.9937 134 241 GO:0005737
GO:0046872
AF-A0A090WP53-F1-model_v4 Nitric oxide-dependent regulator DnrN or NorA 0.9917 110 241 GO:0005737
GO:0046872
AF-A0A6L4ZMJ5-F1-model_v4 Hemerythrin-like domain-containing protein 0.9906 106 241 GO:0005737
GO:0046872
AF-A0A3D3R1C8-F1-model_v4 deleted 0.9901 71 243
AF-A0A2V9ZXU0-F1-model_v4 Hemerythrin-like domain-containing protein 0.9865 136 243 GO:0005737
GO:0046872

Map