F424852

General Info

Members Datasets Scaffolds Average Seq Length
368 212 736 291

Family's Representative Sequence

Representative Sequence 3300049589|Ga0501073_0292423|Ga0501073_0292423_190_1092
Length 300
Sequence VVSHPVDRTPDPIPXPILTRAQIPPVNGRPVRKDEIELHERGLYIESWLPERRSRRKPLLFVHGELAGSWVWEKFLGYFAGRGWEGHALNLRNHYWSQTADPATLSFDTYLEDVVAALDRLGPTTVAVGHGMGGLLALKAAERVAISGLVLIGAELPRDLRPTARPYELREIPEVYGRSLIGWETLPEKLLRDERDLTLPDVLRIQHLLGQKPHEAGAARRQMVAGVPVDRRVVGEVPRLVIGGGLDQRVTLDDSERLAEWLDAEFEPFGAHSHYGLILGEQSHQQVAESVRAFLETHRL

Samples

Sample ID Description Type Environment
1 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
116 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
117 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
118 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
119 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
120 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
121 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
122 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
123 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
124 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
125 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
126 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
127 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
128 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
129 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
130 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
131 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
132 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
133 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
134 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
135 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
136 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
137 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
140 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
141 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
142 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
143 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
144 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
145 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
146 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
148 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
149 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
150 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
151 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
152 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
153 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
154 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
155 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
156 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
157 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
158 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
159 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
160 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
161 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
162 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
163 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
164 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
165 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
166 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
167 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
168 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
169 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
170 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
171 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
172 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
173 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
174 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
175 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
176 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
187 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
188 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
189 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
190 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
191 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
192 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
193 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
194 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
195 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
196 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
197 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
198 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
200 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
201 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
202 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
203 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
204 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
205 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
206 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
207 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
208 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
209 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
210 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
211 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
212 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.51
Rhizosphere 89.13
Stem 0
Stem Tuber 0
Unclassified 11.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501073_0292423 3300049589 Bacteria 1124
2 rootL2_10172264 3300003322 Unclassified 1089
3 rootH1_10274284 3300003323 Bacteria 1583
4 Ga0070676_10267576 3300005328 Bacteria 1147
5 Ga0070683_100134269 3300005329 Bacteria 2343
6 Ga0070690_100051857 3300005330 Bacteria 2620
7 Ga0070670_100076810 3300005331 Unclassified 2869
8 Ga0068868_100018429 3300005338 Bacteria 5221
9 Ga0070689_100001724 3300005340 Bacteria 13978
10 Ga0070687_100051854 3300005343 Unclassified 2127
11 Ga0070692_10014855 3300005345 Bacteria 3668
12 Ga0070668_100034621 3300005347 Bacteria 3849
13 Ga0070668_100364561 3300005347 Bacteria 1226
14 Ga0070675_100007780 3300005354 Bacteria 8301
15 Ga0070675_100325396 3300005354 Unclassified 1358
16 Ga0070671_100499552 3300005355 Bacteria 1046
17 Ga0070674_100105426 3300005356 Bacteria 2061
18 Ga0070674_100115293 3300005356 Bacteria 1980
19 Ga0070673_100015566 3300005364 Bacteria 5348
20 Ga0070688_100030293 3300005365 Unclassified 3246
21 Ga0070703_10042778 3300005406 Bacteria 1418
22 Ga0070701_10019540 3300005438 Bacteria 3201
23 Ga0070705_100033303 3300005440 Bacteria 2872
24 Ga0070705_100047755 3300005440 Bacteria 2476
25 Ga0070705_100115983 3300005440 Bacteria 1721
26 Ga0070700_100005053 3300005441 Bacteria 6957
27 Ga0070694_100022398 3300005444 Bacteria 4047
28 Ga0070694_100253350 3300005444 Bacteria 1332
29 Ga0070708_100016946 3300005445 Bacteria 6061
30 Ga0070708_100041776 3300005445 Bacteria 4022
31 Ga0070708_100324819 3300005445 Bacteria 1450
32 Ga0070663_100006543 3300005455 Bacteria 7019
33 Ga0070678_100012015 3300005456 Bacteria 5365
34 Ga0070678_100185019 3300005456 Bacteria 1709
35 Ga0070678_100247829 3300005456 Bacteria 1492
36 Ga0070662_100018125 3300005457 Bacteria 4758
37 Ga0070681_10439461 3300005458 Bacteria 1217
38 Ga0068867_100062309 3300005459 Bacteria 2771
39 Ga0070706_100043527 3300005467 Bacteria 4149
40 Ga0070706_100062078 3300005467 Bacteria 3452
41 Ga0070707_100000163 3300005468 Bacteria 63764
42 Ga0070698_100010336 3300005471 Bacteria 9963
43 Ga0070698_100150070 3300005471 Bacteria 2279
44 Ga0070698_100229636 3300005471 Bacteria 1789
45 Ga0070698_100300928 3300005471 Bacteria 1535
46 Ga0070699_100000999 3300005518 Bacteria 26314
47 Ga0070699_100013140 3300005518 Bacteria 7140
48 Ga0070699_100091962 3300005518 Bacteria 2653
49 Ga0070684_100054273 3300005535 Bacteria 3491
50 Ga0070697_100006742 3300005536 Bacteria 8906
51 Ga0070697_100018677 3300005536 Bacteria 5470
52 Ga0070686_100020120 3300005544 Bacteria 3946
53 Ga0070686_100105042 3300005544 Bacteria 1915
54 Ga0070695_100002947 3300005545 Bacteria 9920
55 Ga0070695_100181532 3300005545 Bacteria 1491
56 Ga0070696_100005748 3300005546 Bacteria 8279
57 Ga0070696_100021892 3300005546 Bacteria 4336
58 Ga0070696_100139095 3300005546 Bacteria 1773
59 Ga0070704_100004039 3300005549 Bacteria 8476
60 Ga0070704_100057616 3300005549 Bacteria 2763
61 Ga0070704_100070426 3300005549 Bacteria 2537
62 Ga0068855_100123448 3300005563 Bacteria 2962
63 Ga0070664_100323970 3300005564 Bacteria 1397
64 Ga0068856_100103184 3300005614 Bacteria 2846
65 Ga0070702_100120233 3300005615 Bacteria 1643
66 Ga0068852_100218979 3300005616 Bacteria 1810
67 Ga0068852_100771813 3300005616 Unclassified 974
68 Ga0068859_100112574 3300005617 Unclassified 2785
69 Ga0068864_100353760 3300005618 Bacteria 1386
70 Ga0068866_10008621 3300005718 Bacteria 4306
71 Ga0068861_100138612 3300005719 Bacteria 1983
72 Ga0068870_10012570 3300005840 Bacteria 3959
73 Ga0068863_100597667 3300005841 Bacteria 1092
74 Ga0068858_100396498 3300005842 Bacteria 1326
75 Ga0068860_100052934 3300005843 Unclassified 3860
76 Ga0068860_100115001 3300005843 Bacteria 2573
77 Ga0081539_10005708 3300005985 Bacteria 12459
78 Ga0081539_10030030 3300005985 Bacteria 3383
79 Ga0097621_100446870 3300006237 Bacteria 1164
80 Ga0068871_100404163 3300006358 Bacteria 1217
81 Ga0075428_100056767 3300006844 Bacteria 4287
82 Ga0075430_100207239 3300006846 Bacteria 1627
83 Ga0068865_100023129 3300006881 Unclassified 4065
84 Ga0097620_100112572 3300006931 Unclassified 2785
85 Ga0111539_10123528 3300009094 Bacteria 3034
86 Ga0111539_10177874 3300009094 Bacteria 2485
87 Ga0111539_10253106 3300009094 Bacteria 2051
88 Ga0105245_10165624 3300009098 Bacteria 2101
89 Ga0105245_10254927 3300009098 Bacteria 1706
90 Ga0114129_10020285 3300009147 Bacteria 9459
91 Ga0114129_10020680 3300009147 Bacteria 9355
92 Ga0114129_10058066 3300009147 Bacteria 5413
93 Ga0105243_10015268 3300009148 Bacteria 5811
94 Ga0105243_10176680 3300009148 Bacteria 1854
95 Ga0105243_10562204 3300009148 Bacteria 1092
96 Ga0105242_10164797 3300009176 Bacteria 1943
97 Ga0105242_10254005 3300009176 Bacteria 1585
98 Ga0105248_10068812 3300009177 Unclassified 3975
99 Ga0105238_10097920 3300009551 Unclassified 2918
100 Ga0105249_10011950 3300009553 Bacteria 7637
101 Ga0105249_10058905 3300009553 Bacteria 3521
102 Ga0105249_10120445 3300009553 Bacteria 2493
103 Ga0105249_10124712 3300009553 Bacteria 2451
104 Ga0105249_10155383 3300009553 Bacteria 2206
105 Ga0105239_10003855 3300010375 Bacteria 18207
106 Ga0157374_10375421 3300013296 Bacteria 1416
107 Ga0157378_10024424 3300013297 Bacteria 5318
108 Ga0157375_10130543 3300013308 Bacteria 2631
109 Ga0157375_10874140 3300013308 Bacteria 1044
110 Ga0163163_10179124 3300014325 Bacteria 2167
111 Ga0163163_10187951 3300014325 Bacteria 2114
112 Ga0157380_10124610 3300014326 Unclassified 2188
113 Ga0157380_10449463 3300014326 Bacteria 1237
114 Ga0157377_10038137 3300014745 Bacteria 2651
115 Ga0157379_10026185 3300014968 Bacteria 5190
116 Ga0157379_10527903 3300014968 Bacteria 1096
117 Ga0163161_10221233 3300017792 Bacteria 1466
118 Ga0207653_10004742 3300025885 Bacteria 4254
119 Ga0207688_10043424 3300025901 Bacteria 2503
120 Ga0207684_10003680 3300025910 Bacteria 14866
121 Ga0207684_10052230 3300025910 Bacteria 3469
122 Ga0207684_10339449 3300025910 Unclassified 1294
123 Ga0207707_10015470 3300025912 Bacteria 6646
124 Ga0207707_10299754 3300025912 Bacteria 1390
125 Ga0207662_10001386 3300025918 Bacteria 11709
126 Ga0207657_10021838 3300025919 Bacteria 6011
127 Ga0207652_10072117 3300025921 Bacteria 3002
128 Ga0207646_10003054 3300025922 Bacteria 19269
129 Ga0207646_10007469 3300025922 Bacteria 11102
130 Ga0207681_10078709 3300025923 Bacteria 2321
131 Ga0207650_10266595 3300025925 Bacteria 1391
132 Ga0207659_10086441 3300025926 Bacteria 2332
133 Ga0207687_10081352 3300025927 Unclassified 2341
134 Ga0207644_10212018 3300025931 Bacteria 1532
135 Ga0207706_10011284 3300025933 Bacteria 8142
136 Ga0207686_10097194 3300025934 Bacteria 1958
137 Ga0207709_10034872 3300025935 Unclassified 2970
138 Ga0207709_10466357 3300025935 Bacteria 979
139 Ga0207670_10045035 3300025936 Unclassified 2922
140 Ga0207669_10198373 3300025937 Bacteria 1454
141 Ga0207704_10292843 3300025938 Bacteria 1243
142 Ga0207711_10453325 3300025941 Bacteria 1194
143 Ga0207711_10594626 3300025941 Unclassified 1032
144 Ga0207661_10135677 3300025944 Bacteria 2113
145 Ga0207667_10097227 3300025949 Bacteria 3039
146 Ga0207651_10038069 3300025960 Bacteria 3157
147 Ga0207651_10117789 3300025960 Bacteria 2008
148 Ga0207712_10019009 3300025961 Bacteria 4482
149 Ga0207668_10016005 3300025972 Bacteria 4672
150 Ga0207668_10434374 3300025972 Bacteria 1117
151 Ga0207668_10484854 3300025972 Bacteria 1061
152 Ga0207677_10020091 3300026023 Bacteria 4048
153 Ga0207677_10040996 3300026023 Bacteria 3058
154 Ga0207703_10611854 3300026035 Bacteria 1031
155 Ga0207678_10052171 3300026067 Bacteria 3529
156 Ga0207708_10009280 3300026075 Bacteria 7284
157 Ga0207708_10028210 3300026075 Bacteria 4250
158 Ga0207702_10124236 3300026078 Bacteria 2314
159 Ga0207641_10223352 3300026088 Bacteria 1748
160 Ga0207648_10008987 3300026089 Bacteria 9608
161 Ga0207676_10052089 3300026095 Unclassified 3198
162 Ga0207676_10263750 3300026095 Unclassified 1557
163 Ga0207674_10015686 3300026116 Bacteria 8315
164 Ga0207675_100039021 3300026118 Bacteria 4432
165 Ga0207683_10011586 3300026121 Bacteria 7528
166 Ga0207683_10182841 3300026121 Bacteria 1901
167 Ga0207683_10205775 3300026121 Bacteria 1790
168 Ga0207698_10264616 3300026142 Bacteria 1581
169 Ga0207698_10454041 3300026142 Bacteria 1238
170 Ga0268265_10236195 3300028380 Bacteria 1610
171 Ga0268264_10028643 3300028381 Bacteria 4558
172 Ga0265326_10003559 3300028558 Bacteria 5092
173 Ga0265326_10029818 3300028558 Bacteria 1554
174 Ga0265319_1009023 3300028563 Bacteria 4299
175 Ga0265318_10019628 3300028577 Bacteria 2739
176 Ga0265318_10019918 3300028577 Bacteria 2716
177 Ga0265323_10014054 3300028653 Bacteria 3180
178 Ga0265322_10011899 3300028654 Bacteria 2516
179 Ga0265322_10014935 3300028654 Bacteria 2244
180 Ga0265322_10017693 3300028654 Bacteria 2052
181 Ga0265336_10047322 3300028666 Bacteria 1305
182 Ga0265338_10057063 3300028800 Bacteria 3457
183 Ga0265338_10155878 3300028800 Bacteria 1769
184 Ga0265324_10002591 3300029957 Bacteria 9090
185 Ga0265324_10033835 3300029957 Bacteria 1782
186 Ga0265324_10090730 3300029957 Bacteria 1039
187 Ga0265332_10054429 3300031238 Bacteria 1717
188 Ga0265332_10091696 3300031238 Bacteria 1284
189 Ga0265320_10016621 3300031240 Bacteria 4117
190 Ga0265320_10148249 3300031240 Bacteria 1060
191 Ga0265325_10032356 3300031241 Bacteria 2792
192 Ga0265325_10079008 3300031241 Bacteria 1638
193 Ga0265329_10008131 3300031242 Bacteria 4002
194 Ga0265329_10039932 3300031242 Bacteria 1506
195 Ga0265329_10044772 3300031242 Bacteria 1415
196 Ga0265340_10046772 3300031247 Bacteria 2109
197 Ga0265339_10034821 3300031249 Bacteria 2828
198 Ga0265339_10114076 3300031249 Bacteria 1395
199 Ga0265331_10051660 3300031250 Bacteria 1967
200 Ga0265316_10012640 3300031344 Bacteria 7557
201 Ga0265316_10112832 3300031344 Bacteria 2057
202 Ga0307408_100046495 3300031548 Bacteria 3105
203 Ga0265342_10011557 3300031712 Bacteria 6033
204 Ga0316576_10050340 3300031727 Bacteria 3029
205 Ga0316577_10002203 3300031733 Bacteria 9571
206 Ga0307406_10110486 3300031901 Unclassified 1892
207 Ga0307407_10123239 3300031903 Bacteria 1647
208 Ga0307409_100003354 3300031995 Bacteria 8679
209 Ga0307416_100000452 3300032002 Bacteria 21051
210 Ga0307416_100004467 3300032002 Bacteria 8437
211 Ga0307411_10051719 3300032005 Bacteria 2682
212 Ga0307415_100013399 3300032126 Bacteria 4787
213 Ga0373946_0044611 3300035171 Bacteria 1831
214 Ga0373961_0034611 3300035241 Bacteria 1429
215 Ga0373931_0109991 3300035691 Bacteria 1562
216 Ga0316582_0044401 3300036647 Bacteria 2793
217 Ga0316584_0103667 3300036712 Bacteria 2129
218 Ga0316584_0662276 3300036712 Unclassified 719
219 Ga0373925_0323962 3300037068 Bacteria 1247
220 Ga0316581_0011497 3300037588 Bacteria 2477
221 Ga0436365_0484199 3300039437 Bacteria 1418
222 Ga0439465_0064916 3300041413 Bacteria 1215
223 Ga0451853_2104375 3300041512 Bacteria 1241
224 Ga0451853_3825048 3300041512 Bacteria 1532
225 Ga0453684_0415065 3300044712 Bacteria 1505
226 Ga0451576_0242729 3300045051 Bacteria 1882
227 Ga0495603_0261915 3300046455 Bacteria 995
228 Ga0495629_0238574 3300046459 Bacteria 1252
229 Ga0495653_0161351 3300046463 Bacteria 1556
230 Ga0495639_0143193 3300046475 Bacteria 1150
231 Ga0495608_0138255 3300046511 Bacteria 1556
232 Ga0495630_0150817 3300046517 Bacteria 1769
233 Ga0495630_0234049 3300046517 Bacteria 1404
234 Ga0495587_0237512 3300046536 Bacteria 1026
235 Ga0495599_0106225 3300046678 Bacteria 1750
236 Ga0495674_0124533 3300047319 Bacteria 2176
237 Ga0495674_0229686 3300047319 Bacteria 1532
238 Ga0495676_0158567 3300047321 Bacteria 1603
239 Ga0496100_0034650 3300048903 Bacteria 3170
240 Ga0496102_0020910 3300048905 Bacteria 5785
241 Ga0496102_0491183 3300048905 Bacteria 1149
242 Ga0496102_0547508 3300048905 Bacteria 1080
243 Ga0496103_0002928 3300048906 Bacteria 10571
244 Ga0496104_0027211 3300048907 Bacteria 5291
245 Ga0496104_0085919 3300048907 Bacteria 3003
246 Ga0496105_0021373 3300048908 Bacteria 5237
247 Ga0496105_0100578 3300048908 Bacteria 2387
248 Ga0496105_0128118 3300048908 Bacteria 2093
249 Ga0496105_0489200 3300048908 Bacteria 967
250 Ga0496106_0010680 3300048909 Bacteria 6786
251 Ga0496108_0004301 3300048911 Bacteria 11456
252 Ga0496108_0076375 3300048911 Unclassified 2831
253 Ga0496108_0124524 3300048911 Bacteria 2212
254 Ga0496108_0205885 3300048911 Bacteria 1707
255 Ga0496108_0213775 3300048911 Bacteria 1674
256 Ga0496108_0457536 3300048911 Bacteria 1115
257 Ga0496109_0004430 3300048912 Bacteria 11727
258 Ga0496109_0019479 3300048912 Bacteria 5987
259 Ga0496109_0027774 3300048912 Bacteria 5056
260 Ga0496109_0098620 3300048912 Bacteria 2709
261 Ga0496110_0045651 3300048913 Bacteria 3831
262 Ga0496110_0129798 3300048913 Bacteria 2275
263 Ga0496111_0016590 3300048914 Bacteria 5078
264 Ga0496111_0058639 3300048914 Bacteria 2787
265 Ga0496111_0265428 3300048914 Bacteria 1274
266 Ga0496112_0014501 3300048915 Bacteria 7317
267 Ga0496112_0421888 3300048915 Bacteria 1273
268 Ga0496112_0443607 3300048915 Bacteria 1236
269 Ga0496113_0002005 3300048916 Bacteria 11676
270 Ga0496113_0056308 3300048916 Bacteria 2951
271 Ga0496113_0612737 3300048916 Unclassified 871
272 Ga0496114_0110521 3300048917 Unclassified 2355
273 Ga0496114_0300524 3300048917 Bacteria 1417
274 Ga0501031_0006431 3300049568 Bacteria 7661
275 Ga0501031_0128981 3300049568 Bacteria 1652
276 Ga0501031_0141270 3300049568 Bacteria 1574
277 Ga0501036_0024379 3300049572 Bacteria 5099
278 Ga0501036_0067122 3300049572 Bacteria 3034
279 Ga0501036_0153190 3300049572 Bacteria 1944
280 Ga0501038_0035659 3300049574 Bacteria 4367
281 Ga0501038_0103403 3300049574 Bacteria 2369
282 Ga0501038_0258809 3300049574 Bacteria 1376
283 Ga0501039_0050262 3300049575 Bacteria 3225
284 Ga0501039_0402828 3300049575 Bacteria 1074
285 Ga0501040_0022585 3300049576 Bacteria 4212
286 Ga0501040_0041054 3300049576 Bacteria 3150
287 Ga0501040_0045762 3300049576 Bacteria 2986
288 Ga0501040_0054057 3300049576 Bacteria 2752
289 Ga0501041_0013133 3300049577 Bacteria 4907
290 Ga0501041_0058706 3300049577 Bacteria 2354
291 Ga0501041_0227927 3300049577 Unclassified 1170
292 Ga0501041_0339290 3300049577 Unclassified 949
293 Ga0501042_0020946 3300049578 Bacteria 4553
294 Ga0501042_0056399 3300049578 Bacteria 2804
295 Ga0501042_0318868 3300049578 Bacteria 1123
296 Ga0501043_0456175 3300049579 Unclassified 960
297 Ga0501046_0140653 3300049580 Bacteria 1827
298 Ga0501046_0253138 3300049580 Bacteria 1296
299 Ga0501046_0301694 3300049580 Bacteria 1170
300 Ga0501048_0312032 3300049582 Bacteria 1120
301 Ga0501067_0009812 3300049583 Bacteria 5299
302 Ga0501067_0200035 3300049583 Bacteria 1113
303 Ga0501068_0049604 3300049584 Bacteria 2536
304 Ga0501068_0170910 3300049584 Bacteria 1372
305 Ga0501068_0360666 3300049584 Bacteria 935
306 Ga0501069_0002545 3300049585 Bacteria 9313
307 Ga0501069_0073709 3300049585 Bacteria 1915
308 Ga0501071_0113796 3300049587 Bacteria 2001
309 Ga0501071_0423577 3300049587 Unclassified 1017
310 Ga0501072_0020397 3300049588 Bacteria 5135
311 Ga0501072_0044492 3300049588 Bacteria 3491
312 Ga0501074_0038620 3300049590 Bacteria 3459
313 Ga0501074_0129963 3300049590 Bacteria 1802
314 Ga0501074_0164713 3300049590 Bacteria 1583
315 Ga0501074_0334283 3300049590 Unclassified 1075
316 Ga0501074_0436039 3300049590 Unclassified 929
317 Ga0501075_0003439 3300049591 Bacteria 10592
318 Ga0501075_0006080 3300049591 Bacteria 8285
319 Ga0501075_0011084 3300049591 Bacteria 6365
320 Ga0501075_0016192 3300049591 Bacteria 5366
321 Ga0501075_0052311 3300049591 Bacteria 3071
322 Ga0501076_0008330 3300049592 Bacteria 7598
323 Ga0501076_0053254 3300049592 Bacteria 3206
324 Ga0501076_0081640 3300049592 Bacteria 2595
325 Ga0501076_0235981 3300049592 Bacteria 1495
326 Ga0501076_0297122 3300049592 Unclassified 1324
327 Ga0501077_0192407 3300049593 Bacteria 1296
328 Ga0501077_0267006 3300049593 Unclassified 1088
329 Ga0501079_0016756 3300049741 Bacteria 5597
330 Ga0501079_0058059 3300049741 Bacteria 2986
331 Ga0501079_0189513 3300049741 Unclassified 1605
332 Ga0501079_0196591 3300049741 Unclassified 1574
333 Ga0501079_0328609 3300049741 Bacteria 1197
334 Ga0501081_0399019 3300049743 Bacteria 1018
335 Ga0501081_0430491 3300049743 Unclassified 979
336 Ga0501083_0123108 3300049744 Bacteria 1701
337 Ga0501035_0064199 3300049822 Bacteria 3264
338 Ga0501035_0164353 3300049822 Unclassified 1920
339 Ga0501045_0003385 3300049824 Bacteria 10918
340 Ga0501045_0061180 3300049824 Bacteria 2762
341 Ga0501045_0124036 3300049824 Unclassified 1918
342 nmdc:mga05p37_184832_c1 3300050507 Bacteria 2534
343 nmdc:mga05p37_2790_c1 3300050507 Bacteria 20308
344 nmdc:mga05p37_71345_c1 3300050507 Bacteria 4272
345 nmdc:mga09592_367109_c1 3300050508 Bacteria 1245
346 nmdc:mga08y16_353618_c1 3300050511 Bacteria 1509
347 nmdc:mga0n895_33944_c1 3300050512 Bacteria 4907
348 nmdc:mga0n895_521383_c1 3300050512 Bacteria 1196
349 nmdc:mga0n895_92012_c1 3300050512 Unclassified 3036
350 Ga0495601_0081820 3300053077 Bacteria 2073
351 Ga0495601_0161961 3300053077 Bacteria 1462
352 Ga0495612_0000203 3300053078 Bacteria 25447
353 Ga0495619_0202246 3300053085 Bacteria 1375
354 Ga0501084_0019566 3300054114 Bacteria 5641
355 Ga0501084_0045101 3300054114 Bacteria 3692
356 Ga0501084_0071266 3300054114 Bacteria 2910
357 Ga0501084_0097957 3300054114 Bacteria 2462
358 Ga0590071_000811 3300059421 Bacteria 8733
359 Ga0590075_003072 3300059424 Bacteria 3961
360 Ga0590077_019944 3300059426 Bacteria 1421
361 Ga0501082_0021680 3300060353 Bacteria 5539
362 Ga0501082_0037788 3300060353 Bacteria 4164
363 Ga0501082_0042701 3300060353 Bacteria 3908
364 Ga0501082_0053822 3300060353 Unclassified 3469
365 Ga0530510_0000065 3300061734 Bacteria 52458
366 Ga0530510_0200150 3300061734 Unclassified 1483
367 Ga0530510_0293765 3300061734 Bacteria 1215
368 Ga0530510_0374147 3300061734 Unclassified 1072
369 Ga0501073_0292423
370 rootL2_10172264
371 rootH1_10274284
372 Ga0070676_10267576
373 Ga0070683_100134269
374 Ga0070690_100051857
375 Ga0070670_100076810
376 Ga0068868_100018429
377 Ga0070689_100001724
378 Ga0070687_100051854
379 Ga0070692_10014855
380 Ga0070668_100034621
381 Ga0070668_100364561
382 Ga0070675_100007780
383 Ga0070675_100325396
384 Ga0070671_100499552
385 Ga0070674_100105426
386 Ga0070674_100115293
387 Ga0070673_100015566
388 Ga0070688_100030293
389 Ga0070703_10042778
390 Ga0070701_10019540
391 Ga0070705_100033303
392 Ga0070705_100047755
393 Ga0070705_100115983
394 Ga0070700_100005053
395 Ga0070694_100022398
396 Ga0070694_100253350
397 Ga0070708_100016946
398 Ga0070708_100041776
399 Ga0070708_100324819
400 Ga0070663_100006543
401 Ga0070678_100012015
402 Ga0070678_100185019
403 Ga0070678_100247829
404 Ga0070662_100018125
405 Ga0070681_10439461
406 Ga0068867_100062309
407 Ga0070706_100043527
408 Ga0070706_100062078
409 Ga0070707_100000163
410 Ga0070698_100010336
411 Ga0070698_100150070
412 Ga0070698_100229636
413 Ga0070698_100300928
414 Ga0070699_100000999
415 Ga0070699_100013140
416 Ga0070699_100091962
417 Ga0070684_100054273
418 Ga0070697_100006742
419 Ga0070697_100018677
420 Ga0070686_100020120
421 Ga0070686_100105042
422 Ga0070695_100002947
423 Ga0070695_100181532
424 Ga0070696_100005748
425 Ga0070696_100021892
426 Ga0070696_100139095
427 Ga0070704_100004039
428 Ga0070704_100057616
429 Ga0070704_100070426
430 Ga0068855_100123448
431 Ga0070664_100323970
432 Ga0068856_100103184
433 Ga0070702_100120233
434 Ga0068852_100218979
435 Ga0068852_100771813
436 Ga0068859_100112574
437 Ga0068864_100353760
438 Ga0068866_10008621
439 Ga0068861_100138612
440 Ga0068870_10012570
441 Ga0068863_100597667
442 Ga0068858_100396498
443 Ga0068860_100052934
444 Ga0068860_100115001
445 Ga0081539_10005708
446 Ga0081539_10030030
447 Ga0097621_100446870
448 Ga0068871_100404163
449 Ga0075428_100056767
450 Ga0075430_100207239
451 Ga0068865_100023129
452 Ga0097620_100112572
453 Ga0111539_10123528
454 Ga0111539_10177874
455 Ga0111539_10253106
456 Ga0105245_10165624
457 Ga0105245_10254927
458 Ga0114129_10020285
459 Ga0114129_10020680
460 Ga0114129_10058066
461 Ga0105243_10015268
462 Ga0105243_10176680
463 Ga0105243_10562204
464 Ga0105242_10164797
465 Ga0105242_10254005
466 Ga0105248_10068812
467 Ga0105238_10097920
468 Ga0105249_10011950
469 Ga0105249_10058905
470 Ga0105249_10120445
471 Ga0105249_10124712
472 Ga0105249_10155383
473 Ga0105239_10003855
474 Ga0157374_10375421
475 Ga0157378_10024424
476 Ga0157375_10130543
477 Ga0157375_10874140
478 Ga0163163_10179124
479 Ga0163163_10187951
480 Ga0157380_10124610
481 Ga0157380_10449463
482 Ga0157377_10038137
483 Ga0157379_10026185
484 Ga0157379_10527903
485 Ga0163161_10221233
486 Ga0207653_10004742
487 Ga0207688_10043424
488 Ga0207684_10003680
489 Ga0207684_10052230
490 Ga0207684_10339449
491 Ga0207707_10015470
492 Ga0207707_10299754
493 Ga0207662_10001386
494 Ga0207657_10021838
495 Ga0207652_10072117
496 Ga0207646_10003054
497 Ga0207646_10007469
498 Ga0207681_10078709
499 Ga0207650_10266595
500 Ga0207659_10086441
501 Ga0207687_10081352
502 Ga0207644_10212018
503 Ga0207706_10011284
504 Ga0207686_10097194
505 Ga0207709_10034872
506 Ga0207709_10466357
507 Ga0207670_10045035
508 Ga0207669_10198373
509 Ga0207704_10292843
510 Ga0207711_10453325
511 Ga0207711_10594626
512 Ga0207661_10135677
513 Ga0207667_10097227
514 Ga0207651_10038069
515 Ga0207651_10117789
516 Ga0207712_10019009
517 Ga0207668_10016005
518 Ga0207668_10434374
519 Ga0207668_10484854
520 Ga0207677_10020091
521 Ga0207677_10040996
522 Ga0207703_10611854
523 Ga0207678_10052171
524 Ga0207708_10009280
525 Ga0207708_10028210
526 Ga0207702_10124236
527 Ga0207641_10223352
528 Ga0207648_10008987
529 Ga0207676_10052089
530 Ga0207676_10263750
531 Ga0207674_10015686
532 Ga0207675_100039021
533 Ga0207683_10011586
534 Ga0207683_10182841
535 Ga0207683_10205775
536 Ga0207698_10264616
537 Ga0207698_10454041
538 Ga0268265_10236195
539 Ga0268264_10028643
540 Ga0265326_10003559
541 Ga0265326_10029818
542 Ga0265319_1009023
543 Ga0265318_10019628
544 Ga0265318_10019918
545 Ga0265323_10014054
546 Ga0265322_10011899
547 Ga0265322_10014935
548 Ga0265322_10017693
549 Ga0265336_10047322
550 Ga0265338_10057063
551 Ga0265338_10155878
552 Ga0265324_10002591
553 Ga0265324_10033835
554 Ga0265324_10090730
555 Ga0265332_10054429
556 Ga0265332_10091696
557 Ga0265320_10016621
558 Ga0265320_10148249
559 Ga0265325_10032356
560 Ga0265325_10079008
561 Ga0265329_10008131
562 Ga0265329_10039932
563 Ga0265329_10044772
564 Ga0265340_10046772
565 Ga0265339_10034821
566 Ga0265339_10114076
567 Ga0265331_10051660
568 Ga0265316_10012640
569 Ga0265316_10112832
570 Ga0307408_100046495
571 Ga0265342_10011557
572 Ga0316576_10050340
573 Ga0316577_10002203
574 Ga0307406_10110486
575 Ga0307407_10123239
576 Ga0307409_100003354
577 Ga0307416_100000452
578 Ga0307416_100004467
579 Ga0307411_10051719
580 Ga0307415_100013399
581 Ga0373946_0044611
582 Ga0373961_0034611
583 Ga0373931_0109991
584 Ga0316582_0044401
585 Ga0316584_0103667
586 Ga0316584_0662276
587 Ga0373925_0323962
588 Ga0316581_0011497
589 Ga0436365_0484199
590 Ga0439465_0064916
591 Ga0451853_2104375
592 Ga0451853_3825048
593 Ga0453684_0415065
594 Ga0451576_0242729
595 Ga0495603_0261915
596 Ga0495629_0238574
597 Ga0495653_0161351
598 Ga0495639_0143193
599 Ga0495608_0138255
600 Ga0495630_0150817
601 Ga0495630_0234049
602 Ga0495587_0237512
603 Ga0495599_0106225
604 Ga0495674_0124533
605 Ga0495674_0229686
606 Ga0495676_0158567
607 Ga0496100_0034650
608 Ga0496102_0020910
609 Ga0496102_0491183
610 Ga0496102_0547508
611 Ga0496103_0002928
612 Ga0496104_0027211
613 Ga0496104_0085919
614 Ga0496105_0021373
615 Ga0496105_0100578
616 Ga0496105_0128118
617 Ga0496105_0489200
618 Ga0496106_0010680
619 Ga0496108_0004301
620 Ga0496108_0076375
621 Ga0496108_0124524
622 Ga0496108_0205885
623 Ga0496108_0213775
624 Ga0496108_0457536
625 Ga0496109_0004430
626 Ga0496109_0019479
627 Ga0496109_0027774
628 Ga0496109_0098620
629 Ga0496110_0045651
630 Ga0496110_0129798
631 Ga0496111_0016590
632 Ga0496111_0058639
633 Ga0496111_0265428
634 Ga0496112_0014501
635 Ga0496112_0421888
636 Ga0496112_0443607
637 Ga0496113_0002005
638 Ga0496113_0056308
639 Ga0496113_0612737
640 Ga0496114_0110521
641 Ga0496114_0300524
642 Ga0501031_0006431
643 Ga0501031_0128981
644 Ga0501031_0141270
645 Ga0501036_0024379
646 Ga0501036_0067122
647 Ga0501036_0153190
648 Ga0501038_0035659
649 Ga0501038_0103403
650 Ga0501038_0258809
651 Ga0501039_0050262
652 Ga0501039_0402828
653 Ga0501040_0022585
654 Ga0501040_0041054
655 Ga0501040_0045762
656 Ga0501040_0054057
657 Ga0501041_0013133
658 Ga0501041_0058706
659 Ga0501041_0227927
660 Ga0501041_0339290
661 Ga0501042_0020946
662 Ga0501042_0056399
663 Ga0501042_0318868
664 Ga0501043_0456175
665 Ga0501046_0140653
666 Ga0501046_0253138
667 Ga0501046_0301694
668 Ga0501048_0312032
669 Ga0501067_0009812
670 Ga0501067_0200035
671 Ga0501068_0049604
672 Ga0501068_0170910
673 Ga0501068_0360666
674 Ga0501069_0002545
675 Ga0501069_0073709
676 Ga0501071_0113796
677 Ga0501071_0423577
678 Ga0501072_0020397
679 Ga0501072_0044492
680 Ga0501074_0038620
681 Ga0501074_0129963
682 Ga0501074_0164713
683 Ga0501074_0334283
684 Ga0501074_0436039
685 Ga0501075_0003439
686 Ga0501075_0006080
687 Ga0501075_0011084
688 Ga0501075_0016192
689 Ga0501075_0052311
690 Ga0501076_0008330
691 Ga0501076_0053254
692 Ga0501076_0081640
693 Ga0501076_0235981
694 Ga0501076_0297122
695 Ga0501077_0192407
696 Ga0501077_0267006
697 Ga0501079_0016756
698 Ga0501079_0058059
699 Ga0501079_0189513
700 Ga0501079_0196591
701 Ga0501079_0328609
702 Ga0501081_0399019
703 Ga0501081_0430491
704 Ga0501083_0123108
705 Ga0501035_0064199
706 Ga0501035_0164353
707 Ga0501045_0003385
708 Ga0501045_0061180
709 Ga0501045_0124036
710 nmdc:mga05p37_184832_c1
711 nmdc:mga05p37_2790_c1
712 nmdc:mga05p37_71345_c1
713 nmdc:mga09592_367109_c1
714 nmdc:mga08y16_353618_c1
715 nmdc:mga0n895_33944_c1
716 nmdc:mga0n895_521383_c1
717 nmdc:mga0n895_92012_c1
718 Ga0495601_0081820
719 Ga0495601_0161961
720 Ga0495612_0000203
721 Ga0495619_0202246
722 Ga0501084_0019566
723 Ga0501084_0045101
724 Ga0501084_0071266
725 Ga0501084_0097957
726 Ga0590071_000811
727 Ga0590075_003072
728 Ga0590077_019944
729 Ga0501082_0021680
730 Ga0501082_0037788
731 Ga0501082_0042701
732 Ga0501082_0053822
733 Ga0530510_0000065
734 Ga0530510_0200150
735 Ga0530510_0293765
736 Ga0530510_0374147

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

57

185

0.87

PF12146

Hydrolase_4

Serine aminopeptidase, S33

53

267

0.75

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

59

290

0.66

Structural Annotation

Top 5 Hits

ID Description Score Start End
8boz-assembly5.cif.gz_I structure of the adherent-invasive escherichia coli tle3/tli3 t6ss effector/immunity complex 0.8368 106 152
8boz-assembly1.cif.gz_A structure of the adherent-invasive escherichia coli tle3/tli3 t6ss effector/immunity complex 0.7884 106 158
1brt-assembly1.cif.gz_A bromoperoxidase a2 mutant m99t 0.7872 38 291
1a8q-assembly1.cif.gz_A bromoperoxidase a1 0.7743 29 291
8b6p-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 154-156 (cphalotag7_154-156) 0.7678 25 146
ID Description Score Start End Superfamily
af_F4JRA6_1_133_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8445 52 157 3.40.50.1820
af_A0A0P0WIT7_2_163_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7876 47 149 3.40.50.1820
af_I1N5B6_61_316_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7767 46 270 3.40.50.1820
1a8qA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7743 29 291 3.40.50.1820
af_Q922Q6_49_247_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.771 38 291 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A535VVM8-F1-model_v4 Alpha/beta hydrolase 0.9579 10 295 GO:0016787
AF-A0A535VVM8-F1-model_v4 Alpha/beta hydrolase 0.9513 10 295 GO:0016787
AF-A0A2A4T975-F1-model_v4 AB hydrolase-1 domain-containing protein 0.9282 27 295
AF-A0A535IKG9-F1-model_v4 Alpha/beta hydrolase 0.927 9 221 GO:0016787
AF-A0A2A4T975-F1-model_v4 AB hydrolase-1 domain-containing protein 0.9216 27 295

Map