F424844

General Info

Members Datasets Scaffolds Average Seq Length
368 215 736 81

Family's Representative Sequence

Representative Sequence 3300049580|Ga0501046_0694278|Ga0501046_0694278_145_429
Length 94
Sequence MTIGKKVTMYESDLTKFMREYLAAHPEEVESQKKGRAIWWDKTRDERAPAPSMRHAPRAGGNEHTFEPAGGYEWSFGVDDNAPPVAYDDPTKTP

Samples

Sample ID Description Type Environment
1 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
136 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
137 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
138 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
139 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
140 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
141 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
142 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
143 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
144 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
145 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
146 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
147 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
148 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
149 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
150 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
151 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
152 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
153 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
154 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
155 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
156 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
157 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
158 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
159 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
160 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
161 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
162 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
163 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
164 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
165 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
166 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
167 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
168 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
169 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
170 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
171 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
184 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
185 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
186 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
187 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
188 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
189 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
190 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
191 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
192 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
193 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
194 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
195 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
196 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
197 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
200 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
201 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
202 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
203 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
204 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
205 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
206 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
207 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
208 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
209 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
210 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
211 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
212 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
213 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
214 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
215 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.73
Metatranscriptomes 0.27
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.54
Rhizosphere 98.64
Stem 0
Stem Tuber 0
Unclassified 3.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501046_0694278 3300049580 Bacteria 717
2 JGI25406J46586_10054340 3300003203 Bacteria 1325
3 rootL2_10161258 3300003322 Unclassified 1071
4 Ga0058861_11343594 3300004800 Bacteria 633
5 Ga0065707_10008615 3300005295 Bacteria 3812
6 Ga0070676_10186160 3300005328 Bacteria 1353
7 Ga0070690_100000458 3300005330 Bacteria 20521
8 Ga0070690_100265125 3300005330 Bacteria 1220
9 Ga0070690_100855585 3300005330 Bacteria 709
10 Ga0068869_100000133 3300005334 Bacteria 35976
11 Ga0070680_100003336 3300005336 Bacteria 11978
12 Ga0070680_100209210 3300005336 Bacteria 1646
13 Ga0070680_100539188 3300005336 Bacteria 1000
14 Ga0070682_100036582 3300005337 Bacteria 3002
15 Ga0068868_100000565 3300005338 Bacteria 24833
16 Ga0070689_100024772 3300005340 Bacteria 4503
17 Ga0070689_100112081 3300005340 Bacteria 2171
18 Ga0070689_101101944 3300005340 Bacteria 710
19 Ga0070691_10003947 3300005341 Bacteria 6711
20 Ga0070687_100000158 3300005343 Bacteria 23450
21 Ga0070687_100789512 3300005343 Bacteria 672
22 Ga0070692_10015705 3300005345 Bacteria 3586
23 Ga0070692_10540685 3300005345 Bacteria 762
24 Ga0070668_100685575 3300005347 Bacteria 903
25 Ga0070669_100031946 3300005353 Bacteria 3802
26 Ga0070669_100053757 3300005353 Bacteria 2948
27 Ga0070675_100009521 3300005354 Bacteria 7562
28 Ga0070675_100117085 3300005354 Bacteria 2261
29 Ga0070671_100122570 3300005355 Bacteria 2188
30 Ga0070674_101144452 3300005356 Bacteria 689
31 Ga0070673_100155438 3300005364 Bacteria 1941
32 Ga0070673_102289058 3300005364 Bacteria 514
33 Ga0070673_102415463 3300005364 Bacteria 500
34 Ga0070688_100185472 3300005365 Bacteria 1446
35 Ga0070688_100453066 3300005365 Bacteria 960
36 Ga0070701_10005555 3300005438 Bacteria 5219
37 Ga0070705_100000421 3300005440 Bacteria 24411
38 Ga0070705_100205087 3300005440 Bacteria 1355
39 Ga0070705_100645356 3300005440 Bacteria 825
40 Ga0070705_101057420 3300005440 Bacteria 662
41 Ga0070705_101648673 3300005440 Bacteria 541
42 Ga0070700_100003916 3300005441 Bacteria 7734
43 Ga0070700_100035353 3300005441 Bacteria 3023
44 Ga0070694_100001193 3300005444 Bacteria 14958
45 Ga0070694_100005157 3300005444 Bacteria 7878
46 Ga0070694_100262006 3300005444 Bacteria 1312
47 Ga0070678_101265435 3300005456 Bacteria 686
48 Ga0070678_101841878 3300005456 Bacteria 571
49 Ga0070662_101574376 3300005457 Bacteria 567
50 Ga0070681_10211831 3300005458 Bacteria 1854
51 Ga0068867_100000270 3300005459 Bacteria 34109
52 Ga0068867_100001242 3300005459 Bacteria 17543
53 Ga0068867_100724976 3300005459 Bacteria 880
54 Ga0070685_10942261 3300005466 Bacteria 645
55 Ga0070699_100290954 3300005518 Bacteria 1465
56 Ga0070679_100008674 3300005530 Bacteria 9581
57 Ga0070679_100584008 3300005530 Bacteria 1061
58 Ga0070697_101235875 3300005536 Bacteria 666
59 Ga0070686_100000426 3300005544 Bacteria 26459
60 Ga0070686_100089960 3300005544 Bacteria 2051
61 Ga0070695_100000282 3300005545 Bacteria 25611
62 Ga0070695_101090568 3300005545 Bacteria 653
63 Ga0070696_100000760 3300005546 Bacteria 20690
64 Ga0070696_100016449 3300005546 Bacteria 4981
65 Ga0070696_100569775 3300005546 Bacteria 910
66 Ga0070696_101276921 3300005546 Bacteria 623
67 Ga0070693_100000211 3300005547 Bacteria 27097
68 Ga0070693_101050356 3300005547 Bacteria 619
69 Ga0070704_100001172 3300005549 Bacteria 13680
70 Ga0070704_100121956 3300005549 Bacteria 2004
71 Ga0070704_100329680 3300005549 Bacteria 1282
72 Ga0070704_101145915 3300005549 Bacteria 708
73 Ga0068855_100012692 3300005563 Bacteria 10166
74 Ga0068857_100692757 3300005577 Bacteria 968
75 Ga0068857_100724974 3300005577 Bacteria 946
76 Ga0068854_100012306 3300005578 Bacteria 5600
77 Ga0068854_100995213 3300005578 Bacteria 742
78 Ga0068856_100135002 3300005614 Bacteria 2473
79 Ga0068856_101674068 3300005614 Bacteria 649
80 Ga0070702_100000556 3300005615 Bacteria 13599
81 Ga0070702_100032160 3300005615 Bacteria 2877
82 Ga0068852_100015177 3300005616 Bacteria 5962
83 Ga0068859_100001117 3300005617 Bacteria 27391
84 Ga0068859_100189560 3300005617 Bacteria 2140
85 Ga0068864_100940619 3300005618 Bacteria 855
86 Ga0068866_10000424 3300005718 Bacteria 19624
87 Ga0068866_10050795 3300005718 Bacteria 2108
88 Ga0068861_100003181 3300005719 Bacteria 10863
89 Ga0068861_100014308 3300005719 Bacteria 5565
90 Ga0068870_10201141 3300005840 Bacteria 1208
91 Ga0068870_10317421 3300005840 Bacteria 989
92 Ga0068858_100022438 3300005842 Bacteria 5891
93 Ga0068858_100451618 3300005842 Bacteria 1239
94 Ga0068860_100000774 3300005843 Bacteria 35963
95 Ga0068860_100281367 3300005843 Bacteria 1626
96 Ga0068862_100001587 3300005844 Bacteria 20706
97 Ga0068862_100012365 3300005844 Bacteria 7057
98 Ga0068862_100151058 3300005844 Bacteria 2067
99 Ga0081539_10000468 3300005985 Bacteria 85386
100 Ga0097621_100034298 3300006237 Bacteria 4048
101 Ga0068871_100000501 3300006358 Bacteria 26716
102 Ga0075428_102391554 3300006844 Unclassified 542
103 Ga0075430_100000209 3300006846 Bacteria 40052
104 Ga0075430_100056378 3300006846 Bacteria 3303
105 Ga0075431_100300150 3300006847 Bacteria 1623
106 Ga0075431_100326170 3300006847 Bacteria 1547
107 Ga0075431_100358403 3300006847 Bacteria 1465
108 Ga0075431_100846764 3300006847 Bacteria 886
109 Ga0075433_10004999 3300006852 Bacteria 10388
110 Ga0075434_100003117 3300006871 Bacteria 14763
111 Ga0075434_101049013 3300006871 Bacteria 829
112 Ga0068865_100001477 3300006881 Bacteria 13684
113 Ga0068865_100088510 3300006881 Bacteria 2240
114 Ga0075436_100003313 3300006914 Bacteria 11018
115 Ga0097620_100001117 3300006931 Bacteria 27391
116 Ga0097620_100189564 3300006931 Bacteria 2140
117 Ga0075435_100001973 3300007076 Bacteria 13386
118 Ga0111539_10049177 3300009094 Bacteria 5031
119 Ga0111539_10985217 3300009094 Bacteria 980
120 Ga0105245_10001115 3300009098 Bacteria 24281
121 Ga0114129_11507930 3300009147 Bacteria 826
122 Ga0114129_12550681 3300009147 Bacteria 611
123 Ga0114129_13027231 3300009147 Bacteria 552
124 Ga0105243_10003375 3300009148 Bacteria 12957
125 Ga0105243_10039500 3300009148 Bacteria 3679
126 Ga0105241_10027574 3300009174 Bacteria 4230
127 Ga0105242_10003119 3300009176 Bacteria 12931
128 Ga0105242_10832654 3300009176 Bacteria 916
129 Ga0105248_10373504 3300009177 Bacteria 1605
130 Ga0105249_10001448 3300009553 Bacteria 20779
131 Ga0105249_10014654 3300009553 Bacteria 6929
132 Ga0105246_12173096 3300011119 Bacteria 539
133 Ga0157378_10002635 3300013297 Bacteria 15985
134 Ga0163162_10407726 3300013306 Bacteria 1492
135 Ga0163162_11362430 3300013306 Bacteria 807
136 Ga0157372_12730971 3300013307 Bacteria 566
137 Ga0157375_10915968 3300013308 Bacteria 1020
138 Ga0157380_10018111 3300014326 Bacteria 5224
139 Ga0157380_10036105 3300014326 Bacteria 3822
140 Ga0157377_11678752 3300014745 Bacteria 512
141 Ga0157379_10188679 3300014968 Bacteria 1863
142 Ga0157376_10019634 3300014969 Bacteria 5214
143 Ga0163161_11343747 3300017792 Bacteria 622
144 Ga0207697_10033070 3300025315 Bacteria 2117
145 Ga0207697_10065489 3300025315 Bacteria 1516
146 Ga0207682_10287381 3300025893 Bacteria 770
147 Ga0207642_10014869 3300025899 Bacteria 2884
148 Ga0207642_10129988 3300025899 Bacteria 1313
149 Ga0207688_10011489 3300025901 Bacteria 4820
150 Ga0207688_10398066 3300025901 Bacteria 854
151 Ga0207688_10430911 3300025901 Bacteria 820
152 Ga0207680_11135983 3300025903 Bacteria 558
153 Ga0207645_10020761 3300025907 Bacteria 4294
154 Ga0207645_10287580 3300025907 Bacteria 1093
155 Ga0207643_10058575 3300025908 Bacteria 2196
156 Ga0207643_10103358 3300025908 Bacteria 1672
157 Ga0207643_10285011 3300025908 Bacteria 1025
158 Ga0207654_10023283 3300025911 Bacteria 3315
159 Ga0207707_10196251 3300025912 Bacteria 1761
160 Ga0207660_10004473 3300025917 Bacteria 9113
161 Ga0207660_10027541 3300025917 Bacteria 3880
162 Ga0207660_10199184 3300025917 Bacteria 1563
163 Ga0207660_10335927 3300025917 Bacteria 1209
164 Ga0207662_10000242 3300025918 Bacteria 25153
165 Ga0207662_10079245 3300025918 Bacteria 2001
166 Ga0207662_10517407 3300025918 Bacteria 823
167 Ga0207652_10260618 3300025921 Bacteria 1564
168 Ga0207652_10322125 3300025921 Bacteria 1395
169 Ga0207681_10024436 3300025923 Bacteria 3878
170 Ga0207681_10162097 3300025923 Bacteria 1687
171 Ga0207650_10624961 3300025925 Bacteria 907
172 Ga0207659_10143494 3300025926 Bacteria 1856
173 Ga0207659_10808558 3300025926 Bacteria 805
174 Ga0207687_10001204 3300025927 Bacteria 17702
175 Ga0207687_11914434 3300025927 Bacteria 507
176 Ga0207644_10395141 3300025931 Bacteria 1129
177 Ga0207690_11578430 3300025932 Bacteria 548
178 Ga0207706_10475877 3300025933 Bacteria 1079
179 Ga0207706_10654077 3300025933 Bacteria 900
180 Ga0207686_10009989 3300025934 Bacteria 5161
181 Ga0207709_10000713 3300025935 Bacteria 26743
182 Ga0207709_10834651 3300025935 Bacteria 746
183 Ga0207670_10001133 3300025936 Bacteria 14036
184 Ga0207670_10086612 3300025936 Bacteria 2205
185 Ga0207670_10279007 3300025936 Bacteria 1302
186 Ga0207670_10756640 3300025936 Bacteria 807
187 Ga0207669_10028143 3300025937 Bacteria 3088
188 Ga0207704_10001473 3300025938 Bacteria 10537
189 Ga0207704_10007476 3300025938 Bacteria 5164
190 Ga0207665_10992884 3300025939 Bacteria 668
191 Ga0207691_10110023 3300025940 Bacteria 2451
192 Ga0207691_10623821 3300025940 Bacteria 912
193 Ga0207711_10287476 3300025941 Bacteria 1515
194 Ga0207689_10001310 3300025942 Bacteria 23998
195 Ga0207689_10128608 3300025942 Bacteria 2084
196 Ga0207667_10005710 3300025949 Bacteria 15177
197 Ga0207651_10132143 3300025960 Bacteria 1913
198 Ga0207712_10001602 3300025961 Bacteria 15219
199 Ga0207712_10001744 3300025961 Bacteria 14538
200 Ga0207668_10012280 3300025972 Bacteria 5237
201 Ga0207640_10001897 3300025981 Bacteria 11227
202 Ga0207677_10003037 3300026023 Bacteria 8871
203 Ga0207677_10697025 3300026023 Bacteria 901
204 Ga0207703_10004053 3300026035 Bacteria 12102
205 Ga0207703_12406221 3300026035 Bacteria 502
206 Ga0207708_10005708 3300026075 Bacteria 9200
207 Ga0207708_10032101 3300026075 Bacteria 3988
208 Ga0207708_10215564 3300026075 Bacteria 1536
209 Ga0207708_11247262 3300026075 Bacteria 651
210 Ga0207702_10030465 3300026078 Bacteria 4497
211 Ga0207702_10970680 3300026078 Bacteria 843
212 Ga0207648_10000639 3300026089 Bacteria 39306
213 Ga0207648_10003046 3300026089 Bacteria 17713
214 Ga0207674_10523662 3300026116 Bacteria 1145
215 Ga0207674_10633418 3300026116 Bacteria 1032
216 Ga0207675_100000127 3300026118 Bacteria 63431
217 Ga0207675_100018072 3300026118 Bacteria 6576
218 Ga0207683_10343089 3300026121 Bacteria 1370
219 Ga0207683_10431048 3300026121 Bacteria 1215
220 Ga0207698_10008104 3300026142 Bacteria 6622
221 Ga0209996_1018262 3300027395 Bacteria 973
222 Ga0209996_1080184 3300027395 Bacteria 512
223 Ga0210000_1015896 3300027462 Bacteria 1135
224 Ga0209999_1094541 3300027543 Bacteria 580
225 Ga0209970_1005592 3300027614 Bacteria 2072
226 Ga0209966_1173604 3300027695 Bacteria 505
227 Ga0209998_10045533 3300027717 Bacteria 1005
228 Ga0207428_10140385 3300027907 Bacteria 1844
229 Ga0207428_10453972 3300027907 Bacteria 934
230 Ga0268265_10000718 3300028380 Bacteria 32453
231 Ga0268265_10005188 3300028380 Bacteria 8926
232 Ga0268265_10384624 3300028380 Bacteria 1292
233 Ga0268265_10536630 3300028380 Bacteria 1108
234 Ga0268264_10000553 3300028381 Bacteria 46486
235 Ga0268264_11782926 3300028381 Bacteria 626
236 Ga0268264_12357283 3300028381 Bacteria 539
237 Ga0307408_100467205 3300031548 Bacteria 1098
238 Ga0307408_102232455 3300031548 Bacteria 529
239 Ga0307405_10294954 3300031731 Bacteria 1227
240 Ga0307405_11195376 3300031731 Bacteria 657
241 Ga0307413_10881385 3300031824 Bacteria 759
242 Ga0307406_10388388 3300031901 Bacteria 1103
243 Ga0307407_10360699 3300031903 Bacteria 1032
244 Ga0307412_10334804 3300031911 Bacteria 1209
245 Ga0307412_10710975 3300031911 Bacteria 863
246 Ga0307409_101637572 3300031995 Bacteria 672
247 Ga0307416_100117828 3300032002 Bacteria 2358
248 Ga0307416_100820014 3300032002 Bacteria 1027
249 Ga0307416_102355201 3300032002 Bacteria 632
250 Ga0307416_102466256 3300032002 Bacteria 619
251 Ga0307411_10077742 3300032005 Bacteria 2273
252 Ga0307411_10086559 3300032005 Bacteria 2174
253 Ga0307411_11478351 3300032005 Bacteria 624
254 Ga0307415_101377167 3300032126 Bacteria 671
255 Ga0373950_0062897 3300034818 Bacteria 748
256 Ga0373928_0087865 3300035084 Bacteria 794
257 Ga0373928_0187123 3300035084 Bacteria 591
258 Ga0373940_0206016 3300035088 Bacteria 648
259 Ga0373939_0041050 3300035114 Bacteria 1393
260 Ga0373941_0422566 3300035115 Bacteria 555
261 Ga0373956_0385616 3300035119 Bacteria 668
262 Ga0373960_0095337 3300035121 Bacteria 957
263 Ga0373962_0104124 3300035242 Bacteria 888
264 Ga0373924_0551759 3300035410 Bacteria 519
265 Ga0439439_0149170 3300041406 Bacteria 663
266 Ga0451807_0500862 3300041486 Bacteria 1709
267 Ga0451835_0489679 3300041492 Bacteria 576
268 Ga0451839_0130560 3300041496 Bacteria 676
269 Ga0450921_005508 3300042123 Bacteria 959
270 Ga0450896_009631 3300042133 Bacteria 1348
271 Ga0466965_0303574 3300044683 Bacteria 867
272 Ga0451576_0055506 3300045051 Bacteria 4144
273 Ga0466967_0027955 3300045976 Bacteria 4700
274 Ga0495603_0207891 3300046455 Bacteria 1131
275 Ga0495608_0523352 3300046511 Bacteria 717
276 Ga0495642_0049785 3300046528 Bacteria 1722
277 Ga0495659_0058864 3300046664 Bacteria 1415
278 Ga0496101_1601180 3300048904 Bacteria 506
279 Ga0501291_024137 3300049514 Bacteria 987
280 Ga0501291_063103 3300049514 Unclassified 702
281 Ga0501298_104185 3300049521 Bacteria 651
282 Ga0501299_181351 3300049522 Bacteria 550
283 Ga0501031_0960501 3300049568 Unclassified 546
284 Ga0501032_0409269 3300049569 Unclassified 871
285 Ga0501033_0282819 3300049570 Bacteria 1171
286 Ga0501034_1027681 3300049571 Bacteria 707
287 Ga0501036_0135463 3300049572 Bacteria 2079
288 Ga0501036_1006216 3300049572 Bacteria 682
289 Ga0501036_1223138 3300049572 Bacteria 612
290 Ga0501038_0063096 3300049574 Bacteria 3164
291 Ga0501038_0145209 3300049574 Bacteria 1938
292 Ga0501038_0403072 3300049574 Unclassified 1058
293 Ga0501038_0997398 3300049574 Bacteria 615
294 Ga0501039_0015203 3300049575 Bacteria 5891
295 Ga0501040_0003268 3300049576 Bacteria 10474
296 Ga0501040_0108885 3300049576 Bacteria 1937
297 Ga0501040_0893447 3300049576 Bacteria 643
298 Ga0501041_0003516 3300049577 Bacteria 9016
299 Ga0501041_0487410 3300049577 Unclassified 784
300 Ga0501042_0043055 3300049578 Bacteria 3214
301 Ga0501042_0498294 3300049578 Bacteria 884
302 Ga0501043_0735976 3300049579 Unclassified 718
303 Ga0501043_0856435 3300049579 Bacteria 654
304 Ga0501046_0027392 3300049580 Bacteria 4649
305 Ga0501046_0522392 3300049580 Unclassified 849
306 Ga0501046_0559529 3300049580 Bacteria 815
307 Ga0501046_0812932 3300049580 Bacteria 655
308 Ga0501048_0060989 3300049582 Bacteria 2672
309 Ga0501048_0210417 3300049582 Bacteria 1379
310 Ga0501048_0644527 3300049582 Bacteria 761
311 Ga0501048_0835260 3300049582 Unclassified 662
312 Ga0501067_0367221 3300049583 Bacteria 802
313 Ga0501068_0252995 3300049584 Bacteria 1123
314 Ga0501071_0055540 3300049587 Bacteria 2858
315 Ga0501071_0566363 3300049587 Bacteria 873
316 Ga0501071_0777122 3300049587 Bacteria 738
317 Ga0501071_1584907 3300049587 Bacteria 505
318 Ga0501072_0006749 3300049588 Bacteria 8719
319 Ga0501072_0274628 3300049588 Bacteria 1341
320 Ga0501073_1120642 3300049589 Bacteria 541
321 Ga0501074_0112716 3300049590 Bacteria 1946
322 Ga0501075_0012067 3300049591 Bacteria 6134
323 Ga0501075_0076064 3300049591 Bacteria 2539
324 Ga0501076_0000642 3300049592 Bacteria 22358
325 Ga0501076_0666083 3300049592 Bacteria 859
326 Ga0501077_0071658 3300049593 Bacteria 2196
327 Ga0501077_0766066 3300049593 Unclassified 620
328 Ga0501202_123293 3300049652 Bacteria 654
329 Ga0501249_178934 3300049679 Unclassified 547
330 Ga0501079_0012338 3300049741 Bacteria 6520
331 Ga0501079_0238726 3300049741 Bacteria 1420
332 Ga0501079_0950273 3300049741 Bacteria 677
333 Ga0501080_0018483 3300049742 Bacteria 6450
334 Ga0501081_0005654 3300049743 Bacteria 8087
335 Ga0501081_0238739 3300049743 Bacteria 1325
336 Ga0501081_0806131 3300049743 Bacteria 707
337 Ga0501035_0560685 3300049822 Bacteria 935
338 Ga0501035_0584224 3300049822 Bacteria 912
339 Ga0501035_0782963 3300049822 Bacteria 763
340 Ga0501035_0832380 3300049822 Unclassified 735
341 Ga0501044_1516206 3300049823 Bacteria 535
342 Ga0501045_0148772 3300049824 Bacteria 1742
343 nmdc:mga05p37_259062_c1 3300050507 Bacteria 2082
344 nmdc:mga09592_459076_c1 3300050508 Bacteria 1099
345 nmdc:mga0qj67_189330_c1 3300050509 Bacteria 1672
346 nmdc:mga0qj67_2078_c1 3300050509 Bacteria 14287
347 nmdc:mga0qj67_584452_c1 3300050509 Bacteria 894
348 nmdc:mga06r32_672758_c1 3300050510 Bacteria 1002
349 nmdc:mga06r32_8872_c1 3300050510 Bacteria 9061
350 nmdc:mga08y16_1058367_c1 3300050511 Bacteria 788
351 nmdc:mga08y16_180371_c1 3300050511 Bacteria 2193
352 nmdc:mga08y16_492994_c1 3300050511 Bacteria 1246
353 nmdc:mga0n895_1139_c1 3300050512 Bacteria 19440
354 nmdc:mga0n895_1851058_c1 3300050512 Bacteria 563
355 nmdc:mga0rr50_2309_c1 3300050513 Bacteria 10699
356 nmdc:mga08x19_2730_c1 3300050514 Bacteria 10668
357 nmdc:mga0a205_8054_c1 3300050515 Bacteria 9580
358 Ga0501084_0130178 3300054114 Bacteria 2118
359 Ga0501084_1491468 3300054114 Bacteria 566
360 Ga0590074_084280 3300059423 Bacteria 609
361 Ga0590075_145160 3300059424 Bacteria 625
362 Ga0590077_024743 3300059426 Bacteria 1291
363 Ga0590077_161159 3300059426 Bacteria 538
364 Ga0501082_0008753 3300060353 Bacteria 8725
365 Ga0466962_0354932 3300061719 Bacteria 730
366 Ga0530510_0000825 3300061734 Bacteria 20335
367 Ga0530510_0283507 3300061734 Unclassified 1238
368 Ga0530510_0738192 3300061734 Bacteria 751
369 Ga0501046_0694278
370 JGI25406J46586_10054340
371 rootL2_10161258
372 Ga0058861_11343594
373 Ga0065707_10008615
374 Ga0070676_10186160
375 Ga0070690_100000458
376 Ga0070690_100265125
377 Ga0070690_100855585
378 Ga0068869_100000133
379 Ga0070680_100003336
380 Ga0070680_100209210
381 Ga0070680_100539188
382 Ga0070682_100036582
383 Ga0068868_100000565
384 Ga0070689_100024772
385 Ga0070689_100112081
386 Ga0070689_101101944
387 Ga0070691_10003947
388 Ga0070687_100000158
389 Ga0070687_100789512
390 Ga0070692_10015705
391 Ga0070692_10540685
392 Ga0070668_100685575
393 Ga0070669_100031946
394 Ga0070669_100053757
395 Ga0070675_100009521
396 Ga0070675_100117085
397 Ga0070671_100122570
398 Ga0070674_101144452
399 Ga0070673_100155438
400 Ga0070673_102289058
401 Ga0070673_102415463
402 Ga0070688_100185472
403 Ga0070688_100453066
404 Ga0070701_10005555
405 Ga0070705_100000421
406 Ga0070705_100205087
407 Ga0070705_100645356
408 Ga0070705_101057420
409 Ga0070705_101648673
410 Ga0070700_100003916
411 Ga0070700_100035353
412 Ga0070694_100001193
413 Ga0070694_100005157
414 Ga0070694_100262006
415 Ga0070678_101265435
416 Ga0070678_101841878
417 Ga0070662_101574376
418 Ga0070681_10211831
419 Ga0068867_100000270
420 Ga0068867_100001242
421 Ga0068867_100724976
422 Ga0070685_10942261
423 Ga0070699_100290954
424 Ga0070679_100008674
425 Ga0070679_100584008
426 Ga0070697_101235875
427 Ga0070686_100000426
428 Ga0070686_100089960
429 Ga0070695_100000282
430 Ga0070695_101090568
431 Ga0070696_100000760
432 Ga0070696_100016449
433 Ga0070696_100569775
434 Ga0070696_101276921
435 Ga0070693_100000211
436 Ga0070693_101050356
437 Ga0070704_100001172
438 Ga0070704_100121956
439 Ga0070704_100329680
440 Ga0070704_101145915
441 Ga0068855_100012692
442 Ga0068857_100692757
443 Ga0068857_100724974
444 Ga0068854_100012306
445 Ga0068854_100995213
446 Ga0068856_100135002
447 Ga0068856_101674068
448 Ga0070702_100000556
449 Ga0070702_100032160
450 Ga0068852_100015177
451 Ga0068859_100001117
452 Ga0068859_100189560
453 Ga0068864_100940619
454 Ga0068866_10000424
455 Ga0068866_10050795
456 Ga0068861_100003181
457 Ga0068861_100014308
458 Ga0068870_10201141
459 Ga0068870_10317421
460 Ga0068858_100022438
461 Ga0068858_100451618
462 Ga0068860_100000774
463 Ga0068860_100281367
464 Ga0068862_100001587
465 Ga0068862_100012365
466 Ga0068862_100151058
467 Ga0081539_10000468
468 Ga0097621_100034298
469 Ga0068871_100000501
470 Ga0075428_102391554
471 Ga0075430_100000209
472 Ga0075430_100056378
473 Ga0075431_100300150
474 Ga0075431_100326170
475 Ga0075431_100358403
476 Ga0075431_100846764
477 Ga0075433_10004999
478 Ga0075434_100003117
479 Ga0075434_101049013
480 Ga0068865_100001477
481 Ga0068865_100088510
482 Ga0075436_100003313
483 Ga0097620_100001117
484 Ga0097620_100189564
485 Ga0075435_100001973
486 Ga0111539_10049177
487 Ga0111539_10985217
488 Ga0105245_10001115
489 Ga0114129_11507930
490 Ga0114129_12550681
491 Ga0114129_13027231
492 Ga0105243_10003375
493 Ga0105243_10039500
494 Ga0105241_10027574
495 Ga0105242_10003119
496 Ga0105242_10832654
497 Ga0105248_10373504
498 Ga0105249_10001448
499 Ga0105249_10014654
500 Ga0105246_12173096
501 Ga0157378_10002635
502 Ga0163162_10407726
503 Ga0163162_11362430
504 Ga0157372_12730971
505 Ga0157375_10915968
506 Ga0157380_10018111
507 Ga0157380_10036105
508 Ga0157377_11678752
509 Ga0157379_10188679
510 Ga0157376_10019634
511 Ga0163161_11343747
512 Ga0207697_10033070
513 Ga0207697_10065489
514 Ga0207682_10287381
515 Ga0207642_10014869
516 Ga0207642_10129988
517 Ga0207688_10011489
518 Ga0207688_10398066
519 Ga0207688_10430911
520 Ga0207680_11135983
521 Ga0207645_10020761
522 Ga0207645_10287580
523 Ga0207643_10058575
524 Ga0207643_10103358
525 Ga0207643_10285011
526 Ga0207654_10023283
527 Ga0207707_10196251
528 Ga0207660_10004473
529 Ga0207660_10027541
530 Ga0207660_10199184
531 Ga0207660_10335927
532 Ga0207662_10000242
533 Ga0207662_10079245
534 Ga0207662_10517407
535 Ga0207652_10260618
536 Ga0207652_10322125
537 Ga0207681_10024436
538 Ga0207681_10162097
539 Ga0207650_10624961
540 Ga0207659_10143494
541 Ga0207659_10808558
542 Ga0207687_10001204
543 Ga0207687_11914434
544 Ga0207644_10395141
545 Ga0207690_11578430
546 Ga0207706_10475877
547 Ga0207706_10654077
548 Ga0207686_10009989
549 Ga0207709_10000713
550 Ga0207709_10834651
551 Ga0207670_10001133
552 Ga0207670_10086612
553 Ga0207670_10279007
554 Ga0207670_10756640
555 Ga0207669_10028143
556 Ga0207704_10001473
557 Ga0207704_10007476
558 Ga0207665_10992884
559 Ga0207691_10110023
560 Ga0207691_10623821
561 Ga0207711_10287476
562 Ga0207689_10001310
563 Ga0207689_10128608
564 Ga0207667_10005710
565 Ga0207651_10132143
566 Ga0207712_10001602
567 Ga0207712_10001744
568 Ga0207668_10012280
569 Ga0207640_10001897
570 Ga0207677_10003037
571 Ga0207677_10697025
572 Ga0207703_10004053
573 Ga0207703_12406221
574 Ga0207708_10005708
575 Ga0207708_10032101
576 Ga0207708_10215564
577 Ga0207708_11247262
578 Ga0207702_10030465
579 Ga0207702_10970680
580 Ga0207648_10000639
581 Ga0207648_10003046
582 Ga0207674_10523662
583 Ga0207674_10633418
584 Ga0207675_100000127
585 Ga0207675_100018072
586 Ga0207683_10343089
587 Ga0207683_10431048
588 Ga0207698_10008104
589 Ga0209996_1018262
590 Ga0209996_1080184
591 Ga0210000_1015896
592 Ga0209999_1094541
593 Ga0209970_1005592
594 Ga0209966_1173604
595 Ga0209998_10045533
596 Ga0207428_10140385
597 Ga0207428_10453972
598 Ga0268265_10000718
599 Ga0268265_10005188
600 Ga0268265_10384624
601 Ga0268265_10536630
602 Ga0268264_10000553
603 Ga0268264_11782926
604 Ga0268264_12357283
605 Ga0307408_100467205
606 Ga0307408_102232455
607 Ga0307405_10294954
608 Ga0307405_11195376
609 Ga0307413_10881385
610 Ga0307406_10388388
611 Ga0307407_10360699
612 Ga0307412_10334804
613 Ga0307412_10710975
614 Ga0307409_101637572
615 Ga0307416_100117828
616 Ga0307416_100820014
617 Ga0307416_102355201
618 Ga0307416_102466256
619 Ga0307411_10077742
620 Ga0307411_10086559
621 Ga0307411_11478351
622 Ga0307415_101377167
623 Ga0373950_0062897
624 Ga0373928_0087865
625 Ga0373928_0187123
626 Ga0373940_0206016
627 Ga0373939_0041050
628 Ga0373941_0422566
629 Ga0373956_0385616
630 Ga0373960_0095337
631 Ga0373962_0104124
632 Ga0373924_0551759
633 Ga0439439_0149170
634 Ga0451807_0500862
635 Ga0451835_0489679
636 Ga0451839_0130560
637 Ga0450921_005508
638 Ga0450896_009631
639 Ga0466965_0303574
640 Ga0451576_0055506
641 Ga0466967_0027955
642 Ga0495603_0207891
643 Ga0495608_0523352
644 Ga0495642_0049785
645 Ga0495659_0058864
646 Ga0496101_1601180
647 Ga0501291_024137
648 Ga0501291_063103
649 Ga0501298_104185
650 Ga0501299_181351
651 Ga0501031_0960501
652 Ga0501032_0409269
653 Ga0501033_0282819
654 Ga0501034_1027681
655 Ga0501036_0135463
656 Ga0501036_1006216
657 Ga0501036_1223138
658 Ga0501038_0063096
659 Ga0501038_0145209
660 Ga0501038_0403072
661 Ga0501038_0997398
662 Ga0501039_0015203
663 Ga0501040_0003268
664 Ga0501040_0108885
665 Ga0501040_0893447
666 Ga0501041_0003516
667 Ga0501041_0487410
668 Ga0501042_0043055
669 Ga0501042_0498294
670 Ga0501043_0735976
671 Ga0501043_0856435
672 Ga0501046_0027392
673 Ga0501046_0522392
674 Ga0501046_0559529
675 Ga0501046_0812932
676 Ga0501048_0060989
677 Ga0501048_0210417
678 Ga0501048_0644527
679 Ga0501048_0835260
680 Ga0501067_0367221
681 Ga0501068_0252995
682 Ga0501071_0055540
683 Ga0501071_0566363
684 Ga0501071_0777122
685 Ga0501071_1584907
686 Ga0501072_0006749
687 Ga0501072_0274628
688 Ga0501073_1120642
689 Ga0501074_0112716
690 Ga0501075_0012067
691 Ga0501075_0076064
692 Ga0501076_0000642
693 Ga0501076_0666083
694 Ga0501077_0071658
695 Ga0501077_0766066
696 Ga0501202_123293
697 Ga0501249_178934
698 Ga0501079_0012338
699 Ga0501079_0238726
700 Ga0501079_0950273
701 Ga0501080_0018483
702 Ga0501081_0005654
703 Ga0501081_0238739
704 Ga0501081_0806131
705 Ga0501035_0560685
706 Ga0501035_0584224
707 Ga0501035_0782963
708 Ga0501035_0832380
709 Ga0501044_1516206
710 Ga0501045_0148772
711 nmdc:mga05p37_259062_c1
712 nmdc:mga09592_459076_c1
713 nmdc:mga0qj67_189330_c1
714 nmdc:mga0qj67_2078_c1
715 nmdc:mga0qj67_584452_c1
716 nmdc:mga06r32_672758_c1
717 nmdc:mga06r32_8872_c1
718 nmdc:mga08y16_1058367_c1
719 nmdc:mga08y16_180371_c1
720 nmdc:mga08y16_492994_c1
721 nmdc:mga0n895_1139_c1
722 nmdc:mga0n895_1851058_c1
723 nmdc:mga0rr50_2309_c1
724 nmdc:mga08x19_2730_c1
725 nmdc:mga0a205_8054_c1
726 Ga0501084_0130178
727 Ga0501084_1491468
728 Ga0590074_084280
729 Ga0590075_145160
730 Ga0590077_024743
731 Ga0590077_161159
732 Ga0501082_0008753
733 Ga0466962_0354932
734 Ga0530510_0000825
735 Ga0530510_0283507
736 Ga0530510_0738192

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11943

DUF3460

Protein of unknown function (DUF3460)

9

55

0.93

Map