F424841

General Info

Members Datasets Scaffolds Average Seq Length
368 222 736 138

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0371687|Ga0501034_0371687_445_894
Length 149
Sequence MANETATAERGATASAGTESFRFLHTMLRVMDLDKSIDFYTRLLGMKLLRRRDFPTGKFTLAFVAYGEGNPGAAEIELTHNWEQKEPYNIGSAYGHIAIGVPDIYKTCERLAAEGVKIPRPPGPMAHGGSVIAFIEDPDGYKIELIEKK

Samples

Sample ID Description Type Environment
1 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
4 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
5 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
6 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
7 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
8 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
9 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
40 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
54 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
55 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
56 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
61 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
62 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
63 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
71 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
72 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
73 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
74 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
75 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
76 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
77 3300023672 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
78 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
79 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
80 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
85 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
86 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
88 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
113 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
114 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
115 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
116 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
117 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
118 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
119 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
121 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
122 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
123 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
124 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
125 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
126 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
127 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
128 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
129 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
130 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
131 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
132 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
133 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
134 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
137 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
138 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
139 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
140 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
141 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
142 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
143 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
144 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
145 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
146 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
147 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
148 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
149 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
150 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
151 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
152 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
153 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
154 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
155 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
156 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
157 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
158 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
159 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
160 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
161 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
162 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
163 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
164 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
165 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
166 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
167 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
168 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
169 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
170 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
171 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
172 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
173 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
174 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
186 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
187 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
188 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
189 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
190 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
191 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
192 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
193 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
194 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
195 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
196 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
199 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
200 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
201 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
202 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
203 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
204 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
205 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
206 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
207 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
208 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
209 3300059609 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 227R_SD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
212 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
213 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
214 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
215 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
216 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
217 2846540461 Photorhabdus luminescens HIM3 Isolate Rhizosphere
218 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
219 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
220 2919150387 Rahnella aceris 1817 Isolate Unclassified
221 2927143783 Rahnella sp. 2050 Isolate Unclassified
222 642555112 Paraburkholderia phymatum STM815 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.2
Metatranscriptomes 1.09
Isolates 2.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.43
Nodule 0.54
Rhizoplane 2.45
Rhizosphere 79.62
Stem 0
Stem Tuber 0.27
Unclassified 1.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501034_0371687 3300049571 Bacteria 1356
2 JGI25162J39368_1000112 3300002737 Bacteria 89231
3 JGI25163J39215_1000184 3300002771 Bacteria 24136
4 JGI25164J39214_1000094 3300002772 Bacteria 89231
5 Ga0055538_1000076 3300003751 Bacteria 89231
6 Ga0055539_1000115 3300003752 Bacteria 89231
7 Ga0055533_1000121 3300003756 Bacteria 89231
8 Ga0055525_1000159 3300003759 Bacteria 89231
9 Ga0055541_1000077 3300003841 Bacteria 89231
10 Ga0065704_10001991 3300005289 Bacteria 12017
11 Ga0065712_10758451 3300005290 Bacteria 526
12 Ga0065715_10111554 3300005293 Bacteria 2569
13 Ga0070683_100434139 3300005329 Bacteria 1253
14 Ga0070680_100707459 3300005336 Bacteria 867
15 Ga0068868_100530595 3300005338 Bacteria 1035
16 Ga0070689_100983940 3300005340 Bacteria 750
17 Ga0070671_100415633 3300005355 Bacteria 1152
18 Ga0070674_101429022 3300005356 Bacteria 620
19 Ga0070667_100278619 3300005367 Bacteria 1501
20 Ga0070709_10189093 3300005434 Bacteria 1451
21 Ga0070714_100014810 3300005435 Bacteria 6267
22 Ga0070714_100019208 3300005435 Bacteria 5563
23 Ga0070714_100299634 3300005435 Bacteria 1498
24 Ga0070714_100613192 3300005435 Bacteria 1046
25 Ga0070714_100997049 3300005435 Bacteria 815
26 Ga0070713_100042503 3300005436 Bacteria 3710
27 Ga0070713_100137942 3300005436 Bacteria 2157
28 Ga0070713_100142898 3300005436 Bacteria 2121
29 Ga0070710_10120150 3300005437 Bacteria 1589
30 Ga0070711_100096346 3300005439 Bacteria 2143
31 Ga0070711_100105909 3300005439 Bacteria 2055
32 Ga0070711_100167041 3300005439 Bacteria 1674
33 Ga0070705_100403423 3300005440 Bacteria 1013
34 Ga0070708_100037185 3300005445 Bacteria 4246
35 Ga0070708_100492632 3300005445 Bacteria 1156
36 Ga0070681_10224000 3300005458 Bacteria 1796
37 Ga0070681_10377578 3300005458 Bacteria 1328
38 Ga0070706_100193332 3300005467 Bacteria 1901
39 Ga0070707_100017443 3300005468 Bacteria 6749
40 Ga0070707_100071606 3300005468 Bacteria 3340
41 Ga0070698_100001442 3300005471 Bacteria 26380
42 Ga0070698_100102594 3300005471 Bacteria 2831
43 Ga0070698_100291282 3300005471 Bacteria 1564
44 Ga0070699_100058448 3300005518 Bacteria 3340
45 Ga0070697_100029902 3300005536 Bacteria 4373
46 Ga0070697_100196297 3300005536 Bacteria 1714
47 Ga0070697_101131925 3300005536 Bacteria 697
48 Ga0070697_101288672 3300005536 Unclassified 652
49 Ga0070696_100124134 3300005546 Bacteria 1872
50 Ga0070696_101456321 3300005546 Bacteria 585
51 Ga0068855_100353659 3300005563 Bacteria 1618
52 Ga0070664_100070103 3300005564 Bacteria 3001
53 Ga0068856_100509513 3300005614 Bacteria 1224
54 Ga0068856_101343880 3300005614 Bacteria 729
55 Ga0068856_102079196 3300005614 Bacteria 578
56 Ga0068862_102573938 3300005844 Bacteria 521
57 Ga0081455_10021582 3300005937 Bacteria 6036
58 Ga0081538_10004145 3300005981 Bacteria 13449
59 Ga0081538_10025996 3300005981 Bacteria 4109
60 Ga0081538_10124389 3300005981 Bacteria 1230
61 Ga0081538_10145253 3300005981 Bacteria 1086
62 Ga0081540_1019372 3300005983 Bacteria 4139
63 Ga0081539_10066299 3300005985 Bacteria 1957
64 Ga0070717_10001562 3300006028 Bacteria 15852
65 Ga0070717_10154471 3300006028 Bacteria 1987
66 Ga0070717_10299938 3300006028 Bacteria 1428
67 Ga0070717_11183066 3300006028 Bacteria 696
68 Ga0070716_100234091 3300006173 Bacteria 1242
69 Ga0070712_100041305 3300006175 Bacteria 3166
70 Ga0070712_100300171 3300006175 Bacteria 1300
71 Ga0070712_100499174 3300006175 Bacteria 1020
72 Ga0070712_101145892 3300006175 Bacteria 676
73 Ga0075428_100008920 3300006844 Bacteria 11128
74 Ga0075431_100029827 3300006847 Bacteria 5617
75 Ga0075431_100185992 3300006847 Bacteria 2130
76 Ga0075433_10099240 3300006852 Bacteria 2578
77 Ga0075434_100311055 3300006871 Bacteria 1596
78 Ga0075434_100803583 3300006871 Bacteria 957
79 Ga0075429_100000015 3300006880 Bacteria 78823
80 Ga0075436_100110097 3300006914 Bacteria 1922
81 Ga0075436_100504115 3300006914 Bacteria 885
82 Ga0075436_101079670 3300006914 Bacteria 604
83 Ga0079104_1042619 3300006946 Bacteria 1050
84 Ga0075435_100042085 3300007076 Bacteria 3653
85 Ga0075435_100834555 3300007076 Bacteria 803
86 Ga0099795_10011126 3300007788 Bacteria 2676
87 Ga0099795_10164258 3300007788 Bacteria 918
88 Ga0105251_10455826 3300009011 Bacteria 593
89 Ga0105244_10000070 3300009036 Bacteria 119389
90 Ga0105244_10000515 3300009036 Bacteria 34521
91 Ga0105250_10000488 3300009092 Bacteria 27848
92 Ga0114129_10020688 3300009147 Bacteria 9353
93 Ga0105248_11284093 3300009177 Bacteria 828
94 Ga0105248_13167472 3300009177 Bacteria 523
95 Ga0105238_10084408 3300009551 Bacteria 3165
96 Ga0105148_111507 3300009978 Bacteria 679
97 Ga0105029_121691 3300009984 Bacteria 540
98 Ga0105028_101272 3300009993 Bacteria 2659
99 Ga0099796_10002776 3300010159 Bacteria 3930
100 Ga0099796_10016028 3300010159 Bacteria 2205
101 Ga0157371_10000099 3300013102 Bacteria 133829
102 Ga0157370_10005907 3300013104 Bacteria 13646
103 Ga0157370_11480157 3300013104 Bacteria 611
104 Ga0157369_10053002 3300013105 Bacteria 4386
105 Ga0163162_10096309 3300013306 Bacteria 3047
106 Ga0157372_11759800 3300013307 Bacteria 713
107 Ga0157380_12191038 3300014326 Bacteria 616
108 Ga0182008_10129638 3300014497 Bacteria 1257
109 Ga0157377_11563095 3300014745 Bacteria 527
110 Ga0213873_10024742 3300021358 Bacteria 1444
111 Ga0213873_10170739 3300021358 Bacteria 663
112 Ga0213873_10173413 3300021358 Bacteria 659
113 Ga0213874_10293802 3300021377 Bacteria 610
114 Ga0213876_10231013 3300021384 Bacteria 983
115 Ga0213875_10002268 3300021388 Bacteria 11662
116 Ga0213875_10006171 3300021388 Bacteria 6323
117 Ga0213875_10178551 3300021388 Bacteria 997
118 Ga0213875_10465200 3300021388 Bacteria 606
119 Ga0213871_10040475 3300021441 Bacteria 1250
120 Ga0213871_10258514 3300021441 Bacteria 554
121 Ga0247553_109027 3300023672 Unclassified 561
122 Ga0224572_1059395 3300024225 Bacteria 709
123 Ga0209760_100222 3300025207 Bacteria 24749
124 Ga0209784_100001 3300025224 Bacteria 3600592
125 Ga0209566_100001 3300025225 Bacteria 3600765
126 Ga0209674_100002 3300025226 Bacteria 3600592
127 Ga0209563_100008 3300025230 Bacteria 1554545
128 Ga0207427_100135 3300025231 Bacteria 89851
129 Ga0209437_100007 3300025233 Bacteria 938377
130 Ga0209677_100004 3300025253 Bacteria 1554545
131 Ga0209233_1007642 3300025261 Bacteria 3408
132 Ga0209673_1000905 3300025273 Bacteria 37932
133 Ga0209256_1006113 3300025299 Bacteria 6535
134 Ga0207696_1000235 3300025711 Bacteria 77526
135 Ga0207655_1000168 3300025728 Bacteria 119343
136 Ga0207655_1001548 3300025728 Bacteria 20769
137 Ga0207692_10010477 3300025898 Bacteria 3909
138 Ga0207692_10231205 3300025898 Bacteria 1100
139 Ga0207699_10224027 3300025906 Bacteria 1285
140 Ga0207699_10271762 3300025906 Bacteria 1175
141 Ga0207684_10320893 3300025910 Bacteria 1335
142 Ga0207707_10188970 3300025912 Bacteria 1797
143 Ga0207707_10305212 3300025912 Bacteria 1376
144 Ga0207693_10043734 3300025915 Bacteria 3522
145 Ga0207693_10075315 3300025915 Bacteria 2643
146 Ga0207693_10075383 3300025915 Bacteria 2641
147 Ga0207693_10099636 3300025915 Bacteria 2278
148 Ga0207693_10907809 3300025915 Bacteria 676
149 Ga0207663_10864044 3300025916 Bacteria 722
150 Ga0207646_10020068 3300025922 Bacteria 6197
151 Ga0207646_11057579 3300025922 Bacteria 715
152 Ga0207700_10097623 3300025928 Bacteria 2335
153 Ga0207700_10330498 3300025928 Bacteria 1323
154 Ga0207700_10569846 3300025928 Bacteria 1006
155 Ga0207664_10034808 3300025929 Bacteria 3882
156 Ga0207664_10087633 3300025929 Bacteria 2545
157 Ga0207664_10206473 3300025929 Bacteria 1698
158 Ga0207644_10481448 3300025931 Bacteria 1022
159 Ga0207690_10536307 3300025932 Bacteria 950
160 Ga0207670_10811864 3300025936 Bacteria 780
161 Ga0207665_10127061 3300025939 Bacteria 1806
162 Ga0207661_10464009 3300025944 Bacteria 1155
163 Ga0207667_10366756 3300025949 Bacteria 1468
164 Ga0207667_10384989 3300025949 Bacteria 1429
165 Ga0207668_10964540 3300025972 Bacteria 761
166 Ga0207703_10989058 3300026035 Bacteria 807
167 Ga0207708_10104014 3300026075 Bacteria 2200
168 Ga0207702_10231437 3300026078 Bacteria 1727
169 Ga0207702_11464773 3300026078 Bacteria 676
170 Ga0207641_11183440 3300026088 Bacteria 764
171 Ga0265325_10121257 3300031241 Bacteria 1260
172 Ga0307408_100045775 3300031548 Bacteria 3127
173 Ga0316579_10415262 3300031691 Bacteria 651
174 Ga0316576_10263847 3300031727 Bacteria 1292
175 Ga0316578_10072513 3300031728 Bacteria 2040
176 Ga0307414_10072503 3300032004 Bacteria 2488
177 Ga0307411_10143650 3300032005 Bacteria 1763
178 Ga0307411_10512098 3300032005 Bacteria 1017
179 Ga0316053_105317 3300032120 Bacteria 814
180 Ga0373926_0026434 3300035083 Bacteria 2031
181 Ga0373929_0107276 3300035085 Bacteria 710
182 Ga0373936_0296887 3300035113 Bacteria 729
183 Ga0373945_0073033 3300035116 Bacteria 1302
184 Ga0373953_0057648 3300035117 Bacteria 1582
185 Ga0373954_0107531 3300035118 Bacteria 1348
186 Ga0373956_0012293 3300035119 Bacteria 3547
187 Ga0373956_0018918 3300035119 Bacteria 2918
188 Ga0373943_0120833 3300035170 Bacteria 1392
189 Ga0373943_0325553 3300035170 Bacteria 877
190 Ga0316574_0080521 3300035398 Bacteria 2067
191 Ga0316574_0311175 3300035398 Bacteria 1001
192 Ga0373931_0037536 3300035691 Bacteria 2530
193 Ga0373935_0229988 3300035692 Bacteria 1291
194 Ga0373935_0658001 3300035692 Unclassified 769
195 Ga0373927_0225801 3300035695 Bacteria 1230
196 Ga0373927_0255963 3300035695 Bacteria 1151
197 Ga0373927_0490918 3300035695 Bacteria 811
198 Ga0373933_0017674 3300035724 Bacteria 4000
199 Ga0373933_0135252 3300035724 Bacteria 1553
200 Ga0373947_0312016 3300035725 Bacteria 1050
201 Ga0373937_0007156 3300036401 Bacteria 9647
202 Ga0373937_0062586 3300036401 Bacteria 3421
203 Ga0373937_0276102 3300036401 Bacteria 1586
204 Ga0373925_0123014 3300037068 Bacteria 2016
205 Ga0373925_1239530 3300037068 Bacteria 613
206 Ga0395905_0466297 3300037471 Bacteria 1162
207 Ga0436364_0223731 3300037853 Bacteria 59268
208 Ga0436364_0342995 3300037853 Bacteria 1029
209 Ga0436364_0539873 3300037853 Bacteria 1099
210 Ga0436364_0622480 3300037853 Bacteria 604
211 Ga0436364_0663275 3300037853 Bacteria 97909
212 Ga0436364_0779024 3300037853 Bacteria 1334
213 Ga0436364_0905132 3300037853 Bacteria 2190
214 Ga0436364_0939920 3300037853 Bacteria 28920
215 Ga0436364_0959451 3300037853 Bacteria 2260
216 Ga0436364_1314736 3300037853 Bacteria 564
217 Ga0436365_0120707 3300039437 Bacteria 1612
218 Ga0436365_0368170 3300039437 Bacteria 3097
219 Ga0436365_0404733 3300039437 Bacteria 760
220 Ga0436365_0465228 3300039437 Bacteria 1424
221 Ga0436365_0627290 3300039437 Unclassified 1082
222 Ga0436365_0825549 3300039437 Bacteria 973
223 Ga0436365_0839294 3300039437 Bacteria 3021
224 Ga0436365_1189869 3300039437 Bacteria 1159
225 Ga0436365_1837174 3300039437 Bacteria 2099
226 Ga0436360_0174380 3300039438 Bacteria 1114
227 Ga0436360_0415284 3300039438 Bacteria 554
228 Ga0436360_0427712 3300039438 Bacteria 2647
229 Ga0436360_0457277 3300039438 Bacteria 509
230 Ga0436360_0547386 3300039438 Bacteria 2268
231 Ga0436360_0622097 3300039438 Bacteria 753
232 Ga0436360_0806679 3300039438 Bacteria 1883
233 Ga0436360_1369183 3300039438 Bacteria 1029
234 Ga0436361_0051871 3300039447 Bacteria 4635
235 Ga0436361_0711022 3300039447 Bacteria 980
236 Ga0436363_0073625 3300039450 Bacteria 566
237 Ga0436363_0491477 3300039450 Bacteria 4531
238 Ga0436363_1125596 3300039450 Bacteria 1954
239 Ga0436363_1541239 3300039450 Bacteria 617
240 Ga0436362_0005006 3300039453 Bacteria 1984
241 Ga0436362_0162549 3300039453 Bacteria 1308
242 Ga0436362_0315575 3300039453 Bacteria 665
243 Ga0436362_0917194 3300039453 Bacteria 2169
244 Ga0436362_0935205 3300039453 Bacteria 2223
245 Ga0436362_0971861 3300039453 Bacteria 803
246 Ga0436362_1006138 3300039453 Bacteria 884
247 Ga0453683_0000348 3300044673 Bacteria 56032
248 Ga0466963_0250771 3300044694 Bacteria 1242
249 Ga0466963_0251268 3300044694 Bacteria 1241
250 Ga0466967_0241047 3300045976 Bacteria 1725
251 Ga0466967_0531934 3300045976 Bacteria 1156
252 Ga0495650_0000090 3300046471 Bacteria 232897
253 Ga0495662_0225740 3300046476 Bacteria 923
254 Ga0495594_0584985 3300046499 Bacteria 633
255 Ga0495632_0189054 3300046519 Bacteria 941
256 Ga0495632_0224017 3300046519 Bacteria 850
257 Ga0495667_0002650 3300046559 Bacteria 11950
258 Ga0495634_0050902 3300046642 Bacteria 2780
259 Ga0495657_0566489 3300046675 Bacteria 659
260 Ga0495613_0832699 3300046689 Bacteria 601
261 Ga0495600_0411918 3300046809 Bacteria 840
262 Ga0495660_0000028 3300046810 Bacteria 244534
263 Ga0495680_0199272 3300047322 Bacteria 1437
264 Ga0495680_0597181 3300047322 Bacteria 739
265 Ga0495684_0550862 3300047471 Bacteria 785
266 Ga0496104_0005228 3300048907 Bacteria 11355
267 Ga0496104_0708404 3300048907 Bacteria 914
268 Ga0496106_0811635 3300048909 Bacteria 742
269 Ga0496110_0150292 3300048913 Bacteria 2109
270 Ga0496111_0508517 3300048914 Bacteria 886
271 Ga0496112_0031555 3300048915 Bacteria 5141
272 Ga0496112_1725170 3300048915 Bacteria 539
273 Ga0496113_0145125 3300048916 Bacteria 1869
274 Ga0496116_0000277 3300048919 Bacteria 89271
275 Ga0496117_0006968 3300048920 Bacteria 11205
276 Ga0496118_0003542 3300048921 Bacteria 19523
277 Ga0496118_0006573 3300048921 Bacteria 12707
278 Ga0496119_0019099 3300048922 Bacteria 5065
279 Ga0496120_0015318 3300048923 Bacteria 5063
280 Ga0496122_0000058 3300048925 Bacteria 248805
281 Ga0496123_0000044 3300048926 Bacteria 253396
282 Ga0496124_0000105 3300048927 Bacteria 176783
283 Ga0496125_0000103 3300048928 Bacteria 201675
284 Ga0496126_0000399 3300048929 Bacteria 89026
285 Ga0501032_0412711 3300049569 Bacteria 867
286 Ga0501036_0640757 3300049572 Bacteria 880
287 Ga0501037_0554751 3300049573 Bacteria 775
288 Ga0501038_0312060 3300049574 Bacteria 1232
289 Ga0501038_0427091 3300049574 Bacteria 1022
290 Ga0501039_0035375 3300049575 Bacteria 3854
291 Ga0501039_1102209 3300049575 Bacteria 615
292 Ga0501040_0127770 3300049576 Bacteria 1786
293 Ga0501040_0647653 3300049576 Bacteria 764
294 Ga0501041_0347421 3300049577 Bacteria 937
295 Ga0501042_0426165 3300049578 Bacteria 961
296 Ga0501042_0441033 3300049578 Bacteria 944
297 Ga0501042_0686095 3300049578 Bacteria 745
298 Ga0501042_0691267 3300049578 Bacteria 742
299 Ga0501043_0187886 3300049579 Bacteria 1608
300 Ga0501046_0555803 3300049580 Bacteria 818
301 Ga0501048_0009474 3300049582 Bacteria 7310
302 Ga0501048_0096986 3300049582 Bacteria 2080
303 Ga0501070_0185946 3300049586 Bacteria 1709
304 Ga0501071_0236130 3300049587 Bacteria 1378
305 Ga0501071_0332231 3300049587 Bacteria 1155
306 Ga0501071_0744034 3300049587 Bacteria 755
307 Ga0501072_0000646 3300049588 Bacteria 25037
308 Ga0501072_0178401 3300049588 Bacteria 1694
309 Ga0501072_0505104 3300049588 Bacteria 956
310 Ga0501074_0176860 3300049590 Bacteria 1523
311 Ga0501074_0480072 3300049590 Bacteria 881
312 Ga0501075_0008550 3300049591 Bacteria 7136
313 Ga0501075_0315998 3300049591 Bacteria 1190
314 Ga0501075_0385081 3300049591 Bacteria 1069
315 Ga0501076_0133388 3300049592 Bacteria 2015
316 Ga0501076_0624970 3300049592 Bacteria 889
317 Ga0501077_0029991 3300049593 Bacteria 3460
318 Ga0501079_0093460 3300049741 Bacteria 2330
319 Ga0501079_1003255 3300049741 Bacteria 658
320 Ga0501080_0407337 3300049742 Bacteria 1223
321 Ga0501080_0435657 3300049742 Bacteria 1176
322 Ga0501080_0441292 3300049742 Bacteria 1168
323 Ga0501080_1102581 3300049742 Bacteria 685
324 Ga0501081_0264095 3300049743 Bacteria 1258
325 Ga0501083_0589958 3300049744 Bacteria 723
326 Ga0501035_0281650 3300049822 Bacteria 1405
327 Ga0501035_0848262 3300049822 Bacteria 727
328 Ga0501044_0335432 3300049823 Bacteria 1434
329 Ga0501044_0436602 3300049823 Bacteria 1218
330 Ga0501044_1248599 3300049823 Bacteria 610
331 Ga0501045_0005740 3300049824 Bacteria 8596
332 Ga0501045_0134172 3300049824 Bacteria 1841
333 Ga0501045_0152199 3300049824 Bacteria 1721
334 Ga0501045_0693300 3300049824 Bacteria 752
335 nmdc:mga05p37_91181_c1 3300050507 Bacteria 3755
336 nmdc:mga06r32_230196_c1 3300050510 Bacteria 1841
337 nmdc:mga06r32_518099_c1 3300050510 Bacteria 1168
338 nmdc:mga0n895_1067137_c1 3300050512 Bacteria 786
339 nmdc:mga0rr50_1301926_c1 3300050513 Bacteria 616
340 nmdc:mga0rr50_45824_c1 3300050513 Bacteria 3216
341 nmdc:mga08x19_185605_c1 3300050514 Bacteria 1421
342 nmdc:mga08x19_509705_c1 3300050514 Bacteria 850
343 nmdc:mga08x19_72468_c1 3300050514 Bacteria 2247
344 nmdc:mga0a205_37453_c1 3300050515 Bacteria 4663
345 Ga0495601_0018612 3300053077 Bacteria 4228
346 Ga0495601_0526266 3300053077 Bacteria 762
347 Ga0495619_0017957 3300053085 Bacteria 4485
348 Ga0495619_0540920 3300053085 Unclassified 799
349 Ga0500622_0117828 3300053156 Bacteria 1291
350 Ga0501084_0006880 3300054114 Bacteria 9360
351 Ga0501084_0450028 3300054114 Bacteria 1089
352 Ga0587131_014133 3300059609 Bacteria 605
353 Ga0587071_069834 3300060344 Bacteria 763
354 Ga0501082_1952520 3300060353 Bacteria 512
355 Ga0501082_2018117 3300060353 Bacteria 503
356 Ga0530510_0063808 3300061734 Bacteria 2667
357 Ga0530510_0142722 3300061734 Bacteria 1765
358 Ga0530510_1318733 3300061734 Bacteria 554
359 2585825466 2585427591 Bacteria 5482980
360 2585832052 2585427592 Bacteria 5370892
361 2671109845 2667528173 Bacteria 5375747
362 2707100458 2706794495 Bacteria 4536932
363 2846544428 2846540461 Bacteria 5471451
364 2854604501 2854601825 Bacteria 4797592
365 2904478154 2904474040 Bacteria 5504324
366 2919155328 2919150387 Bacteria 5500879
367 2927148006 2927143783 Bacteria 5504251
368 642592165 642555112 Bacteria 8676562
369 Ga0501034_0371687
370 JGI25162J39368_1000112
371 JGI25163J39215_1000184
372 JGI25164J39214_1000094
373 Ga0055538_1000076
374 Ga0055539_1000115
375 Ga0055533_1000121
376 Ga0055525_1000159
377 Ga0055541_1000077
378 Ga0065704_10001991
379 Ga0065712_10758451
380 Ga0065715_10111554
381 Ga0070683_100434139
382 Ga0070680_100707459
383 Ga0068868_100530595
384 Ga0070689_100983940
385 Ga0070671_100415633
386 Ga0070674_101429022
387 Ga0070667_100278619
388 Ga0070709_10189093
389 Ga0070714_100014810
390 Ga0070714_100019208
391 Ga0070714_100299634
392 Ga0070714_100613192
393 Ga0070714_100997049
394 Ga0070713_100042503
395 Ga0070713_100137942
396 Ga0070713_100142898
397 Ga0070710_10120150
398 Ga0070711_100096346
399 Ga0070711_100105909
400 Ga0070711_100167041
401 Ga0070705_100403423
402 Ga0070708_100037185
403 Ga0070708_100492632
404 Ga0070681_10224000
405 Ga0070681_10377578
406 Ga0070706_100193332
407 Ga0070707_100017443
408 Ga0070707_100071606
409 Ga0070698_100001442
410 Ga0070698_100102594
411 Ga0070698_100291282
412 Ga0070699_100058448
413 Ga0070697_100029902
414 Ga0070697_100196297
415 Ga0070697_101131925
416 Ga0070697_101288672
417 Ga0070696_100124134
418 Ga0070696_101456321
419 Ga0068855_100353659
420 Ga0070664_100070103
421 Ga0068856_100509513
422 Ga0068856_101343880
423 Ga0068856_102079196
424 Ga0068862_102573938
425 Ga0081455_10021582
426 Ga0081538_10004145
427 Ga0081538_10025996
428 Ga0081538_10124389
429 Ga0081538_10145253
430 Ga0081540_1019372
431 Ga0081539_10066299
432 Ga0070717_10001562
433 Ga0070717_10154471
434 Ga0070717_10299938
435 Ga0070717_11183066
436 Ga0070716_100234091
437 Ga0070712_100041305
438 Ga0070712_100300171
439 Ga0070712_100499174
440 Ga0070712_101145892
441 Ga0075428_100008920
442 Ga0075431_100029827
443 Ga0075431_100185992
444 Ga0075433_10099240
445 Ga0075434_100311055
446 Ga0075434_100803583
447 Ga0075429_100000015
448 Ga0075436_100110097
449 Ga0075436_100504115
450 Ga0075436_101079670
451 Ga0079104_1042619
452 Ga0075435_100042085
453 Ga0075435_100834555
454 Ga0099795_10011126
455 Ga0099795_10164258
456 Ga0105251_10455826
457 Ga0105244_10000070
458 Ga0105244_10000515
459 Ga0105250_10000488
460 Ga0114129_10020688
461 Ga0105248_11284093
462 Ga0105248_13167472
463 Ga0105238_10084408
464 Ga0105148_111507
465 Ga0105029_121691
466 Ga0105028_101272
467 Ga0099796_10002776
468 Ga0099796_10016028
469 Ga0157371_10000099
470 Ga0157370_10005907
471 Ga0157370_11480157
472 Ga0157369_10053002
473 Ga0163162_10096309
474 Ga0157372_11759800
475 Ga0157380_12191038
476 Ga0182008_10129638
477 Ga0157377_11563095
478 Ga0213873_10024742
479 Ga0213873_10170739
480 Ga0213873_10173413
481 Ga0213874_10293802
482 Ga0213876_10231013
483 Ga0213875_10002268
484 Ga0213875_10006171
485 Ga0213875_10178551
486 Ga0213875_10465200
487 Ga0213871_10040475
488 Ga0213871_10258514
489 Ga0247553_109027
490 Ga0224572_1059395
491 Ga0209760_100222
492 Ga0209784_100001
493 Ga0209566_100001
494 Ga0209674_100002
495 Ga0209563_100008
496 Ga0207427_100135
497 Ga0209437_100007
498 Ga0209677_100004
499 Ga0209233_1007642
500 Ga0209673_1000905
501 Ga0209256_1006113
502 Ga0207696_1000235
503 Ga0207655_1000168
504 Ga0207655_1001548
505 Ga0207692_10010477
506 Ga0207692_10231205
507 Ga0207699_10224027
508 Ga0207699_10271762
509 Ga0207684_10320893
510 Ga0207707_10188970
511 Ga0207707_10305212
512 Ga0207693_10043734
513 Ga0207693_10075315
514 Ga0207693_10075383
515 Ga0207693_10099636
516 Ga0207693_10907809
517 Ga0207663_10864044
518 Ga0207646_10020068
519 Ga0207646_11057579
520 Ga0207700_10097623
521 Ga0207700_10330498
522 Ga0207700_10569846
523 Ga0207664_10034808
524 Ga0207664_10087633
525 Ga0207664_10206473
526 Ga0207644_10481448
527 Ga0207690_10536307
528 Ga0207670_10811864
529 Ga0207665_10127061
530 Ga0207661_10464009
531 Ga0207667_10366756
532 Ga0207667_10384989
533 Ga0207668_10964540
534 Ga0207703_10989058
535 Ga0207708_10104014
536 Ga0207702_10231437
537 Ga0207702_11464773
538 Ga0207641_11183440
539 Ga0265325_10121257
540 Ga0307408_100045775
541 Ga0316579_10415262
542 Ga0316576_10263847
543 Ga0316578_10072513
544 Ga0307414_10072503
545 Ga0307411_10143650
546 Ga0307411_10512098
547 Ga0316053_105317
548 Ga0373926_0026434
549 Ga0373929_0107276
550 Ga0373936_0296887
551 Ga0373945_0073033
552 Ga0373953_0057648
553 Ga0373954_0107531
554 Ga0373956_0012293
555 Ga0373956_0018918
556 Ga0373943_0120833
557 Ga0373943_0325553
558 Ga0316574_0080521
559 Ga0316574_0311175
560 Ga0373931_0037536
561 Ga0373935_0229988
562 Ga0373935_0658001
563 Ga0373927_0225801
564 Ga0373927_0255963
565 Ga0373927_0490918
566 Ga0373933_0017674
567 Ga0373933_0135252
568 Ga0373947_0312016
569 Ga0373937_0007156
570 Ga0373937_0062586
571 Ga0373937_0276102
572 Ga0373925_0123014
573 Ga0373925_1239530
574 Ga0395905_0466297
575 Ga0436364_0223731
576 Ga0436364_0342995
577 Ga0436364_0539873
578 Ga0436364_0622480
579 Ga0436364_0663275
580 Ga0436364_0779024
581 Ga0436364_0905132
582 Ga0436364_0939920
583 Ga0436364_0959451
584 Ga0436364_1314736
585 Ga0436365_0120707
586 Ga0436365_0368170
587 Ga0436365_0404733
588 Ga0436365_0465228
589 Ga0436365_0627290
590 Ga0436365_0825549
591 Ga0436365_0839294
592 Ga0436365_1189869
593 Ga0436365_1837174
594 Ga0436360_0174380
595 Ga0436360_0415284
596 Ga0436360_0427712
597 Ga0436360_0457277
598 Ga0436360_0547386
599 Ga0436360_0622097
600 Ga0436360_0806679
601 Ga0436360_1369183
602 Ga0436361_0051871
603 Ga0436361_0711022
604 Ga0436363_0073625
605 Ga0436363_0491477
606 Ga0436363_1125596
607 Ga0436363_1541239
608 Ga0436362_0005006
609 Ga0436362_0162549
610 Ga0436362_0315575
611 Ga0436362_0917194
612 Ga0436362_0935205
613 Ga0436362_0971861
614 Ga0436362_1006138
615 Ga0453683_0000348
616 Ga0466963_0250771
617 Ga0466963_0251268
618 Ga0466967_0241047
619 Ga0466967_0531934
620 Ga0495650_0000090
621 Ga0495662_0225740
622 Ga0495594_0584985
623 Ga0495632_0189054
624 Ga0495632_0224017
625 Ga0495667_0002650
626 Ga0495634_0050902
627 Ga0495657_0566489
628 Ga0495613_0832699
629 Ga0495600_0411918
630 Ga0495660_0000028
631 Ga0495680_0199272
632 Ga0495680_0597181
633 Ga0495684_0550862
634 Ga0496104_0005228
635 Ga0496104_0708404
636 Ga0496106_0811635
637 Ga0496110_0150292
638 Ga0496111_0508517
639 Ga0496112_0031555
640 Ga0496112_1725170
641 Ga0496113_0145125
642 Ga0496116_0000277
643 Ga0496117_0006968
644 Ga0496118_0003542
645 Ga0496118_0006573
646 Ga0496119_0019099
647 Ga0496120_0015318
648 Ga0496122_0000058
649 Ga0496123_0000044
650 Ga0496124_0000105
651 Ga0496125_0000103
652 Ga0496126_0000399
653 Ga0501032_0412711
654 Ga0501036_0640757
655 Ga0501037_0554751
656 Ga0501038_0312060
657 Ga0501038_0427091
658 Ga0501039_0035375
659 Ga0501039_1102209
660 Ga0501040_0127770
661 Ga0501040_0647653
662 Ga0501041_0347421
663 Ga0501042_0426165
664 Ga0501042_0441033
665 Ga0501042_0686095
666 Ga0501042_0691267
667 Ga0501043_0187886
668 Ga0501046_0555803
669 Ga0501048_0009474
670 Ga0501048_0096986
671 Ga0501070_0185946
672 Ga0501071_0236130
673 Ga0501071_0332231
674 Ga0501071_0744034
675 Ga0501072_0000646
676 Ga0501072_0178401
677 Ga0501072_0505104
678 Ga0501074_0176860
679 Ga0501074_0480072
680 Ga0501075_0008550
681 Ga0501075_0315998
682 Ga0501075_0385081
683 Ga0501076_0133388
684 Ga0501076_0624970
685 Ga0501077_0029991
686 Ga0501079_0093460
687 Ga0501079_1003255
688 Ga0501080_0407337
689 Ga0501080_0435657
690 Ga0501080_0441292
691 Ga0501080_1102581
692 Ga0501081_0264095
693 Ga0501083_0589958
694 Ga0501035_0281650
695 Ga0501035_0848262
696 Ga0501044_0335432
697 Ga0501044_0436602
698 Ga0501044_1248599
699 Ga0501045_0005740
700 Ga0501045_0134172
701 Ga0501045_0152199
702 Ga0501045_0693300
703 nmdc:mga05p37_91181_c1
704 nmdc:mga06r32_230196_c1
705 nmdc:mga06r32_518099_c1
706 nmdc:mga0n895_1067137_c1
707 nmdc:mga0rr50_1301926_c1
708 nmdc:mga0rr50_45824_c1
709 nmdc:mga08x19_185605_c1
710 nmdc:mga08x19_509705_c1
711 nmdc:mga08x19_72468_c1
712 nmdc:mga0a205_37453_c1
713 Ga0495601_0018612
714 Ga0495601_0526266
715 Ga0495619_0017957
716 Ga0495619_0540920
717 Ga0500622_0117828
718 Ga0501084_0006880
719 Ga0501084_0450028
720 Ga0587131_014133
721 Ga0587071_069834
722 Ga0501082_1952520
723 Ga0501082_2018117
724 Ga0530510_0063808
725 Ga0530510_0142722
726 Ga0530510_1318733
727 2585825466
728 2585832052
729 2671109845
730 2707100458
731 2846544428
732 2854604501
733 2904478154
734 2919155328
735 2927148006
736 642592165

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13669

Glyoxalase_4

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

24

134

0.93

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

22

145

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6bnz-assembly1.cif.gz_A crystal structure of e144q-glyoxalase i mutant from zea mays in space group p4(1)2(1)2 0.9843 2 126
6bnx-assembly1.cif.gz_A crystal structure of v278e-glyoxalase i mutant from zea mays in space group p6(3) 0.9767 2 126
5d7z-assembly1.cif.gz_A crystal structure of glyoxalase i from zea mays 0.9755 2 126
4mtr-assembly1.cif.gz_A zn-bound gloa2 0.9659 1 124
4mtr-assembly1.cif.gz_B zn-bound gloa2 0.9649 1 124
ID Description Score Start End Superfamily
af_A0A1X7YDR8_31_97_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.983 1 59 3.10.180.10
af_Q948T6_1_150_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9829 1 126 3.10.180.10
4mtrB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9649 1 124 3.10.180.10
af_A0A0R0LFH0_212_347_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9522 1 124 3.10.180.10
4mtrB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9329 1 124 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A1E2V8L2-F1-model_v4 Lactoylglutathione lyase (EC 4.4.1.5) (Glyoxalase I) 1.003 1 127 GO:0004462
GO:0005737
GO:0019243
GO:0046872
AF-A0A5Y3M6J7-F1-model_v4 Lactoylglutathione lyase (EC 4.4.1.5) (Glyoxalase I) 1.002 1 92 GO:0004462
GO:0005737
GO:0019243
GO:0046872
AF-A0A8A7VSE1-F1-model_v4 deleted 1.001 1 126
AF-A0A6S6XWX3-F1-model_v4 Lactoylglutathione lyase (EC 4.4.1.5) (Glyoxalase I) 1 1 127 GO:0004462
GO:0005737
GO:0019243
GO:0046872
AF-A0A2E0EBB5-F1-model_v4 deleted 0.9996 1 125

Map