F424729

General Info

Members Datasets Scaffolds Average Seq Length
368 210 368 255

Family's Representative Sequence

Representative Sequence 3300025939|Ga0207665_10057430|Ga0207665_100574303
Length 277
Sequence MPFATAAGRQLAYEWVGEAGAGKPPLVFLHEGLGSIRQWREFPARVAAATGCRALVYDRYGYGQSEVLAEPRRTVRFMHDEATQALPELFASLGIVAPLLIGHSDGASIALIHAGAGHDVRGVVAMAPHVFIEPVCLTSIANAAHAFENTDLAEKLGRYHRDARKTFYGWADVWLDPEFKGWDIRDDYLPQIRCPVLAIQGTDDEYGTMAQLDDIARCVKASSTIRTWICRCLRPIGPAKSWQPGAVTASARPRCSRRQRARRACRRGSVTPMCAIT

Samples

Sample ID Description Type Environment
1 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
108 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
111 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
112 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
113 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
114 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
115 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
116 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
117 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
118 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
119 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
120 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
121 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
122 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
123 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
124 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
125 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
126 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
127 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
128 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
129 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
130 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
131 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
132 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
133 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
134 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
135 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
136 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
137 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
138 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
139 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
140 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
141 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
142 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
143 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
144 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
145 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
146 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
147 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
148 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
149 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
150 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
151 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
152 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
153 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
154 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
155 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
156 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
157 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
158 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
159 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
160 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
161 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
162 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
163 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
164 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
165 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
166 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
167 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
168 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
169 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
170 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
171 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
172 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
173 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
174 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
186 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
187 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
188 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
189 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
190 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
191 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
192 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
193 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
194 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
195 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
196 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
198 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
199 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
200 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
201 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
202 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
203 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
204 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
205 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
206 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
207 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
208 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
209 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
210 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.27
Rhizosphere 99.73
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10008641 3300005295 Bacteria 3128
2 Ga0070683_100063722 3300005329 Bacteria 3430
3 Ga0070690_100000460 3300005330 Bacteria 20510
4 Ga0070690_100179582 3300005330 Bacteria 1462
5 Ga0068869_100000660 3300005334 Bacteria 19521
6 Ga0068869_100191616 3300005334 Bacteria 1608
7 Ga0068869_100321075 3300005334 Unclassified 1256
8 Ga0070680_100044086 3300005336 Bacteria 3624
9 Ga0070680_100061267 3300005336 Bacteria 3080
10 Ga0070680_100139694 3300005336 Bacteria 2031
11 Ga0070682_100024917 3300005337 Bacteria 3566
12 Ga0068868_100001132 3300005338 Bacteria 18223
13 Ga0068868_100199177 3300005338 Bacteria 1669
14 Ga0070689_100003349 3300005340 Bacteria 10651
15 Ga0070689_100306171 3300005340 Bacteria 1324
16 Ga0070691_10001849 3300005341 Bacteria 9229
17 Ga0070687_100000096 3300005343 Bacteria 29017
18 Ga0070692_10003366 3300005345 Bacteria 6473
19 Ga0070692_10011130 3300005345 Bacteria 4122
20 Ga0070692_10142786 3300005345 Bacteria 1357
21 Ga0070668_100209698 3300005347 Unclassified 1602
22 Ga0070669_100005071 3300005353 Bacteria 9517
23 Ga0070673_100196311 3300005364 Bacteria 1736
24 Ga0070673_100273984 3300005364 Bacteria 1478
25 Ga0070688_100021320 3300005365 Bacteria 3784
26 Ga0070703_10008590 3300005406 Bacteria 2873
27 Ga0070703_10044498 3300005406 Bacteria 1396
28 Ga0070713_100859344 3300005436 Bacteria 871
29 Ga0070701_10000292 3300005438 Bacteria 16363
30 Ga0070701_10115984 3300005438 Unclassified 1503
31 Ga0070711_100165797 3300005439 Bacteria 1679
32 Ga0070705_100000745 3300005440 Bacteria 18486
33 Ga0070705_100191195 3300005440 Bacteria 1395
34 Ga0070700_100000224 3300005441 Bacteria 31445
35 Ga0070700_100017283 3300005441 Bacteria 4120
36 Ga0070694_100000465 3300005444 Bacteria 22152
37 Ga0070678_100117569 3300005456 Bacteria 2091
38 Ga0070678_100120898 3300005456 Bacteria 2065
39 Ga0070681_10002103 3300005458 Bacteria 18084
40 Ga0070681_10119607 3300005458 Bacteria 2570
41 Ga0068867_100000270 3300005459 Bacteria 34109
42 Ga0068867_100000280 3300005459 Bacteria 33658
43 Ga0070707_100430512 3300005468 Unclassified 1280
44 Ga0070699_100202163 3300005518 Bacteria 1767
45 Ga0070699_100542080 3300005518 Bacteria 1059
46 Ga0070699_100665776 3300005518 Unclassified 950
47 Ga0070679_100032533 3300005530 Bacteria 5160
48 Ga0070679_100131825 3300005530 Bacteria 2480
49 Ga0070684_100070885 3300005535 Bacteria 3068
50 Ga0070697_100001628 3300005536 Bacteria 17102
51 Ga0070697_100399913 3300005536 Bacteria 1192
52 Ga0070672_100086503 3300005543 Bacteria 2521
53 Ga0070686_100000761 3300005544 Bacteria 18685
54 Ga0070695_100000511 3300005545 Bacteria 20376
55 Ga0070695_100030444 3300005545 Bacteria 3361
56 Ga0070695_100118552 3300005545 Unclassified 1807
57 Ga0070696_100006739 3300005546 Bacteria 7672
58 Ga0070696_100015174 3300005546 Bacteria 5172
59 Ga0070696_100032634 3300005546 Bacteria 3572
60 Ga0070696_100040164 3300005546 Bacteria 3230
61 Ga0070696_100216791 3300005546 Unclassified 1434
62 Ga0070696_100330275 3300005546 Unclassified 1176
63 Ga0070693_100000066 3300005547 Bacteria 42739
64 Ga0070704_100000074 3300005549 Bacteria 33875
65 Ga0070704_100012755 3300005549 Bacteria 5197
66 Ga0068855_100001080 3300005563 Bacteria 33887
67 Ga0068854_100001473 3300005578 Bacteria 14255
68 Ga0070702_100000353 3300005615 Bacteria 16077
69 Ga0070702_100095668 3300005615 Unclassified 1811
70 Ga0070702_100315508 3300005615 Bacteria 1087
71 Ga0068859_100001496 3300005617 Bacteria 23799
72 Ga0068859_100336177 3300005617 Bacteria 1604
73 Ga0068861_100000220 3300005719 Bacteria 30851
74 Ga0068861_100000665 3300005719 Bacteria 20437
75 Ga0068861_100481865 3300005719 Bacteria 1118
76 Ga0068870_10077054 3300005840 Bacteria 1833
77 Ga0068870_10275825 3300005840 Bacteria 1052
78 Ga0068863_100567407 3300005841 Bacteria 1122
79 Ga0068858_100001547 3300005842 Bacteria 23620
80 Ga0068858_100208378 3300005842 Bacteria 1850
81 Ga0068860_100009752 3300005843 Bacteria 9534
82 Ga0068860_100145838 3300005843 Bacteria 2278
83 Ga0068862_100000812 3300005844 Bacteria 31007
84 Ga0068862_100004919 3300005844 Bacteria 11252
85 Ga0068862_100057401 3300005844 Bacteria 3338
86 Ga0081539_10000468 3300005985 Bacteria 85386
87 Ga0070716_100162367 3300006173 Bacteria 1449
88 Ga0097621_100001449 3300006237 Bacteria 16244
89 Ga0097621_100159809 3300006237 Bacteria 1936
90 Ga0068871_100001500 3300006358 Bacteria 15640
91 Ga0068871_100004571 3300006358 Bacteria 9651
92 Ga0075428_100000072 3300006844 Bacteria 82200
93 Ga0075428_100036720 3300006844 Bacteria 5395
94 Ga0075428_100085516 3300006844 Bacteria 3439
95 Ga0075430_100000209 3300006846 Bacteria 40052
96 Ga0075430_100284175 3300006846 Bacteria 1369
97 Ga0075430_100301158 3300006846 Bacteria 1326
98 Ga0075431_100034740 3300006847 Bacteria 5193
99 Ga0075431_100068509 3300006847 Bacteria 3662
100 Ga0075431_100200020 3300006847 Bacteria 2044
101 Ga0075431_100472103 3300006847 Bacteria 1248
102 Ga0075433_10000431 3300006852 Bacteria 26971
103 Ga0075434_100000010 3300006871 Bacteria 88105
104 Ga0075434_100000032 3300006871 Bacteria 63711
105 Ga0075434_100263007 3300006871 Bacteria 1744
106 Ga0075429_100000034 3300006880 Bacteria 63200
107 Ga0075429_100095072 3300006880 Bacteria 2599
108 Ga0075429_100130951 3300006880 Bacteria 2194
109 Ga0068865_100000480 3300006881 Bacteria 22335
110 Ga0068865_100013743 3300006881 Bacteria 5127
111 Ga0075436_100000223 3300006914 Bacteria 35328
112 Ga0075436_100001298 3300006914 Bacteria 17001
113 Ga0075436_100010042 3300006914 Bacteria 6478
114 Ga0075436_100023937 3300006914 Bacteria 4197
115 Ga0075436_100066784 3300006914 Bacteria 2486
116 Ga0075436_100160896 3300006914 Bacteria 1582
117 Ga0075436_100176324 3300006914 Bacteria 1510
118 Ga0097620_100001496 3300006931 Bacteria 23799
119 Ga0097620_100336160 3300006931 Bacteria 1604
120 Ga0075435_100000223 3300007076 Bacteria 34766
121 Ga0075435_100009874 3300007076 Bacteria 6946
122 Ga0075435_100084927 3300007076 Bacteria 2605
123 Ga0111539_10045347 3300009094 Bacteria 5263
124 Ga0111539_10053639 3300009094 Bacteria 4799
125 Ga0111539_10107303 3300009094 Bacteria 3276
126 Ga0111539_10206869 3300009094 Bacteria 2287
127 Ga0111539_10926096 3300009094 Bacteria 1013
128 Ga0105245_10004483 3300009098 Bacteria 12346
129 Ga0114129_10000015 3300009147 Bacteria 129075
130 Ga0114129_10376809 3300009147 Bacteria 1875
131 Ga0105243_10000540 3300009148 Bacteria 38371
132 Ga0105243_10009088 3300009148 Bacteria 7593
133 Ga0105241_10024483 3300009174 Bacteria 4482
134 Ga0105242_10022523 3300009176 Bacteria 4957
135 Ga0105249_10009741 3300009553 Bacteria 8418
136 Ga0105249_10016850 3300009553 Bacteria 6484
137 Ga0105239_10029016 3300010375 Bacteria 6082
138 Ga0157378_10000466 3300013297 Bacteria 38578
139 Ga0157380_10003378 3300014326 Bacteria 10954
140 Ga0157380_10017081 3300014326 Bacteria 5364
141 Ga0157376_10003862 3300014969 Bacteria 10357
142 Ga0157376_10064836 3300014969 Bacteria 3082
143 Ga0207653_10006051 3300025885 Bacteria 3772
144 Ga0207688_10279184 3300025901 Bacteria 1017
145 Ga0207643_10013505 3300025908 Bacteria 4425
146 Ga0207643_10031741 3300025908 Bacteria 2947
147 Ga0207643_10244441 3300025908 Unclassified 1104
148 Ga0207654_10030998 3300025911 Bacteria 2941
149 Ga0207707_10003773 3300025912 Bacteria 13429
150 Ga0207707_10105842 3300025912 Bacteria 2459
151 Ga0207660_10002936 3300025917 Bacteria 11139
152 Ga0207660_10118754 3300025917 Bacteria 2000
153 Ga0207662_10000493 3300025918 Bacteria 17642
154 Ga0207652_10017257 3300025921 Bacteria 5906
155 Ga0207681_10000804 3300025923 Bacteria 20670
156 Ga0207659_10086998 3300025926 Bacteria 2325
157 Ga0207687_10001489 3300025927 Bacteria 16039
158 Ga0207686_10002039 3300025934 Bacteria 11138
159 Ga0207709_10001417 3300025935 Bacteria 16787
160 Ga0207670_10016610 3300025936 Bacteria 4428
161 Ga0207670_10122026 3300025936 Unclassified 1896
162 Ga0207670_10273441 3300025936 Bacteria 1314
163 Ga0207704_10000350 3300025938 Bacteria 21466
164 Ga0207704_10002476 3300025938 Bacteria 8318
165 Ga0207665_10045358 3300025939 Bacteria 2944
166 Ga0207665_10057430 3300025939 Bacteria 2629
167 Ga0207691_10095947 3300025940 Bacteria 2652
168 Ga0207691_10413058 3300025940 Bacteria 1150
169 Ga0207689_10000411 3300025942 Bacteria 40047
170 Ga0207689_10022673 3300025942 Bacteria 5275
171 Ga0207689_10224820 3300025942 Bacteria 1551
172 Ga0207667_10013329 3300025949 Bacteria 9414
173 Ga0207712_10003033 3300025961 Bacteria 10720
174 Ga0207640_10050801 3300025981 Bacteria 2692
175 Ga0207677_10001326 3300026023 Bacteria 13272
176 Ga0207703_10143912 3300026035 Bacteria 2072
177 Ga0207708_10000876 3300026075 Bacteria 22666
178 Ga0207708_10003115 3300026075 Bacteria 12206
179 Ga0207708_10058108 3300026075 Unclassified 2951
180 Ga0207708_10312294 3300026075 Unclassified 1281
181 Ga0207708_10683383 3300026075 Bacteria 876
182 Ga0207702_10018553 3300026078 Bacteria 5757
183 Ga0207648_10000224 3300026089 Bacteria 60987
184 Ga0207648_10000639 3300026089 Bacteria 39306
185 Ga0207676_10096501 3300026095 Bacteria 2440
186 Ga0207675_100000173 3300026118 Bacteria 57923
187 Ga0207675_100004706 3300026118 Bacteria 13136
188 Ga0207683_10081507 3300026121 Bacteria 2872
189 Ga0207683_10117742 3300026121 Bacteria 2382
190 Ga0209969_1017739 3300027360 Bacteria 1049
191 Ga0209967_1000634 3300027364 Bacteria 4515
192 Ga0209995_1009656 3300027471 Bacteria 1562
193 Ga0209999_1001914 3300027543 Bacteria 3617
194 Ga0209999_1014886 3300027543 Bacteria 1413
195 Ga0209971_1013861 3300027682 Bacteria 1910
196 Ga0209966_1010073 3300027695 Bacteria 1698
197 Ga0207428_10000387 3300027907 Bacteria 55126
198 Ga0207428_10015093 3300027907 Bacteria 6689
199 Ga0207428_10052109 3300027907 Bacteria 3269
200 Ga0207428_10223655 3300027907 Bacteria 1410
201 Ga0268265_10001259 3300028380 Bacteria 21863
202 Ga0268265_10044193 3300028380 Bacteria 3316
203 Ga0268264_10006039 3300028381 Bacteria 10239
204 Ga0268264_10323253 3300028381 Bacteria 1460
205 Ga0307408_100102112 3300031548 Bacteria 2187
206 Ga0307416_100091751 3300032002 Bacteria 2610
207 Ga0307411_10086867 3300032005 Bacteria 2171
208 Ga0373948_0040436 3300034817 Bacteria 974
209 Ga0373938_0002572 3300034957 Bacteria 2928
210 Ga0373928_0025125 3300035084 Unclassified 1282
211 Ga0373929_0031497 3300035085 Bacteria 1136
212 Ga0373944_0009635 3300035089 Bacteria 2623
213 Ga0373923_0034454 3300035111 Bacteria 2055
214 Ga0373932_0040176 3300035112 Bacteria 1345
215 Ga0373936_0037004 3300035113 Bacteria 1947
216 Ga0373939_0057476 3300035114 Bacteria 1227
217 Ga0373941_0024715 3300035115 Bacteria 1728
218 Ga0373941_0039688 3300035115 Bacteria 1448
219 Ga0373941_0063362 3300035115 Bacteria 1209
220 Ga0373945_0012430 3300035116 Bacteria 2828
221 Ga0373955_0035473 3300035172 Bacteria 2642
222 Ga0373942_0016225 3300035207 Bacteria 1824
223 Ga0373961_0030920 3300035241 Bacteria 1492
224 Ga0373962_0007650 3300035242 Bacteria 2649
225 Ga0373931_0000122 3300035691 Bacteria 35036
226 Ga0373931_0054338 3300035691 Bacteria 2140
227 Ga0373931_0064006 3300035691 Bacteria 1989
228 Ga0373931_0091743 3300035691 Bacteria 1693
229 Ga0373935_0121074 3300035692 Bacteria 1748
230 Ga0373935_0578084 3300035692 Bacteria 820
231 Ga0373927_0405419 3300035695 Bacteria 899
232 Ga0373927_0405424 3300035695 Bacteria 899
233 Ga0373947_0272627 3300035725 Bacteria 1123
234 Ga0373925_0208975 3300037068 Bacteria 1554
235 Ga0242420_034265 3300038996 Bacteria 952
236 Ga0436360_0580448 3300039438 Bacteria 1590
237 Ga0439439_0053813 3300041406 Bacteria 1059
238 Ga0439453_0013368 3300041408 Bacteria 1395
239 Ga0451804_0410913 3300041463 Bacteria 974
240 Ga0439441_011495 3300042001 Bacteria 1502
241 Ga0439435_0000085 3300042436 Bacteria 11385
242 Ga0439435_0006111 3300042436 Bacteria 2690
243 Ga0439444_0002881 3300042437 Bacteria 2390
244 Ga0439444_0023535 3300042437 Unclassified 1106
245 Ga0439460_0003693 3300042461 Bacteria 3710
246 Ga0451577_0036668 3300042876 Bacteria 4414
247 Ga0466964_0096747 3300044706 Bacteria 1294
248 Ga0466957_0058604 3300044842 Bacteria 2360
249 Ga0451576_0007589 3300045051 Bacteria 12921
250 Ga0451576_0028138 3300045051 Bacteria 6025
251 Ga0451576_0033206 3300045051 Bacteria 5486
252 Ga0451576_0145613 3300045051 Bacteria 2470
253 Ga0466967_0003628 3300045976 Bacteria 10142
254 Ga0495592_0001581 3300046454 Bacteria 15887
255 Ga0495603_0220105 3300046455 Bacteria 1095
256 Ga0495641_0089327 3300046461 Bacteria 1377
257 Ga0495580_0004625 3300046472 Bacteria 11557
258 Ga0495582_0094716 3300046473 Bacteria 1667
259 Ga0495582_0322957 3300046473 Bacteria 888
260 Ga0495662_0035600 3300046476 Bacteria 2402
261 Ga0495662_0141980 3300046476 Bacteria 1182
262 Ga0495608_0001149 3300046511 Bacteria 18746
263 Ga0495618_0027575 3300046514 Bacteria 3535
264 Ga0495628_0015804 3300046516 Bacteria 6299
265 Ga0495628_0043878 3300046516 Bacteria 3560
266 Ga0495630_0010491 3300046517 Bacteria 6692
267 Ga0495630_0311025 3300046517 Bacteria 1204
268 Ga0495652_0096501 3300046529 Bacteria 2407
269 Ga0495640_0004693 3300046533 Bacteria 10888
270 Ga0495640_0124166 3300046533 Unclassified 1675
271 Ga0495586_0000572 3300046535 Bacteria 21366
272 Ga0495586_0023555 3300046535 Bacteria 3289
273 Ga0495586_0033856 3300046535 Bacteria 2742
274 Ga0495667_0006355 3300046559 Bacteria 8015
275 Ga0495656_0178017 3300046615 Bacteria 1044
276 Ga0495634_0003062 3300046642 Bacteria 13607
277 Ga0495635_0063060 3300046663 Bacteria 2545
278 Ga0495647_0003836 3300046681 Bacteria 4839
279 Ga0495647_0062522 3300046681 Bacteria 1472
280 Ga0495658_0021272 3300046683 Bacteria 3418
281 Ga0495658_0138821 3300046683 Unclassified 1485
282 Ga0495613_0095016 3300046689 Bacteria 2156
283 Ga0495624_0040497 3300046690 Unclassified 2984
284 Ga0495600_0013461 3300046809 Bacteria 5140
285 Ga0495604_0005366 3300047317 Bacteria 10165
286 Ga0495604_0057613 3300047317 Bacteria 2987
287 Ga0495674_0178952 3300047319 Unclassified 1767
288 Ga0495680_0001126 3300047322 Bacteria 29477
289 Ga0495680_0068539 3300047322 Bacteria 2710
290 Ga0495684_0082371 3300047471 Bacteria 2441
291 Ga0501299_042639 3300049522 Bacteria 915
292 Ga0501033_0450676 3300049570 Unclassified 894
293 Ga0501036_0001189 3300049572 Bacteria 19832
294 Ga0501037_0055251 3300049573 Bacteria 2903
295 Ga0501038_0003779 3300049574 Bacteria 14088
296 Ga0501038_0221560 3300049574 Bacteria 1509
297 Ga0501039_0016171 3300049575 Bacteria 5715
298 Ga0501040_0001580 3300049576 Bacteria 14504
299 Ga0501040_0042996 3300049576 Bacteria 3079
300 Ga0501041_0000194 3300049577 Bacteria 27896
301 Ga0501041_0019456 3300049577 Bacteria 4055
302 Ga0501042_0001071 3300049578 Bacteria 15678
303 Ga0501042_0066420 3300049578 Bacteria 2578
304 Ga0501042_0712281 3300049578 Bacteria 730
305 Ga0501043_0023364 3300049579 Bacteria 4849
306 Ga0501046_0055598 3300049580 Bacteria 3109
307 Ga0501046_0132471 3300049580 Bacteria 1890
308 Ga0501048_0014716 3300049582 Bacteria 5788
309 Ga0501048_0141727 3300049582 Unclassified 1700
310 Ga0501048_0188593 3300049582 Unclassified 1461
311 Ga0501067_0035452 3300049583 Bacteria 2770
312 Ga0501071_0009077 3300049587 Bacteria 6600
313 Ga0501071_0029682 3300049587 Bacteria 3861
314 Ga0501071_0160168 3300049587 Bacteria 1682
315 Ga0501072_0012779 3300049588 Bacteria 6418
316 Ga0501072_0075091 3300049588 Bacteria 2673
317 Ga0501074_0045431 3300049590 Bacteria 3178
318 Ga0501075_0006612 3300049591 Bacteria 7988
319 Ga0501075_0118932 3300049591 Bacteria 2009
320 Ga0501075_0510582 3300049591 Bacteria 917
321 Ga0501076_0002190 3300049592 Bacteria 13380
322 Ga0501076_0006313 3300049592 Bacteria 8591
323 Ga0501077_0027224 3300049593 Bacteria 3630
324 Ga0501077_0094590 3300049593 Unclassified 1894
325 Ga0501079_0002188 3300049741 Bacteria 14094
326 Ga0501080_0020581 3300049742 Bacteria 6110
327 Ga0501081_0000530 3300049743 Bacteria 21493
328 Ga0501081_0226946 3300049743 Bacteria 1359
329 Ga0501083_0148447 3300049744 Bacteria 1535
330 Ga0501044_0188502 3300049823 Bacteria 2026
331 Ga0501045_0000467 3300049824 Bacteria 25098
332 Ga0501045_0067221 3300049824 Bacteria 2632
333 Ga0501045_0284729 3300049824 Bacteria 1230
334 nmdc:mga05p37_344932_c1 3300050507 Bacteria 1755
335 nmdc:mga05p37_506_c1 3300050507 Bacteria 42961
336 nmdc:mga09592_1091_c1 3300050508 Bacteria 21535
337 nmdc:mga0qj67_231_c1 3300050509 Bacteria 38092
338 nmdc:mga0qj67_50111_c1 3300050509 Bacteria 3301
339 nmdc:mga0qj67_94446_c1 3300050509 Bacteria 2405
340 nmdc:mga06r32_255411_c1 3300050510 Bacteria 1740
341 nmdc:mga06r32_28193_c1 3300050510 Bacteria 5251
342 nmdc:mga06r32_74504_c1 3300050510 Bacteria 3291
343 nmdc:mga06r32_89116_c1 3300050510 Bacteria 3012
344 nmdc:mga08y16_162781_c1 3300050511 Bacteria 2318
345 nmdc:mga08y16_244_c1 3300050511 Bacteria 48806
346 nmdc:mga08y16_283145_c1 3300050511 Bacteria 1710
347 nmdc:mga08y16_386196_c1 3300050511 Bacteria 1435
348 nmdc:mga0n895_11380_c1 3300050512 Bacteria 7935
349 nmdc:mga0n895_12272_c1 3300050512 Bacteria 7679
350 nmdc:mga0n895_252_c1 3300050512 Bacteria 34386
351 nmdc:mga0n895_321451_c1 3300050512 Bacteria 1568
352 nmdc:mga0rr50_139680_c1 3300050513 Bacteria 1948
353 nmdc:mga0rr50_3590_c1 3300050513 Bacteria 8967
354 nmdc:mga0rr50_829_c1 3300050513 Bacteria 16633
355 nmdc:mga08x19_232_c1 3300050514 Bacteria 42491
356 nmdc:mga08x19_3089_c1 3300050514 Bacteria 10004
357 nmdc:mga08x19_355393_c1 3300050514 Unclassified 1023
358 nmdc:mga08x19_57941_c1 3300050514 Bacteria 2505
359 nmdc:mga08x19_7360_c1 3300050514 Bacteria 6539
360 nmdc:mga0a205_181603_c1 3300050515 Bacteria 1998
361 nmdc:mga0a205_360_c1 3300050515 Bacteria 34323
362 Ga0495601_0022623 3300053077 Bacteria 3861
363 Ga0501084_0031487 3300054114 Bacteria 4434
364 Ga0501084_0122800 3300054114 Unclassified 2184
365 Ga0501082_0003221 3300060353 Bacteria 14228
366 Ga0530510_0003169 3300061734 Bacteria 11303
367 Ga0530510_0033001 3300061734 Bacteria 3726
368 Ga0530510_0150427 3300061734 Bacteria 1719

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049578 Ga0501042_0712281 Ga0501042_0712281_19_714 231
2 3300046473 Ga0495582_0322957 Ga0495582_0322957_110_838 242
3 3300046476 Ga0495662_0141980 Ga0495662_0141980_151_879 242
4 3300046516 Ga0495628_0043878 Ga0495628_0043878_1740_2468 242
5 3300046517 Ga0495630_0311025 Ga0495630_0311025_427_1155 242
6 3300046533 Ga0495640_0124166 Ga0495640_0124166_452_1180 242
7 3300046535 Ga0495586_0023555 Ga0495586_0023555_1690_2418 242
8 3300046681 Ga0495647_0062522 Ga0495647_0062522_352_1080 242
9 3300046683 Ga0495658_0138821 Ga0495658_0138821_715_1443 242
10 3300046690 Ga0495624_0040497 Ga0495624_0040497_1051_1779 242
11 3300047317 Ga0495604_0057613 Ga0495604_0057613_410_1138 242
12 3300050507 nmdc:mga05p37_344932_c1 nmdc:mga05p37_344932_c1_727_1458 243
13 3300006844 Ga0075428_100036720 Ga0075428_1000367203 244
14 3300006847 Ga0075431_100068509 Ga0075431_1000685093 244
15 3300006880 Ga0075429_100095072 Ga0075429_1000950723 244
16 3300050510 nmdc:mga06r32_89116_c1 nmdc:mga06r32_89116_c1_2231_2965 244
17 3300027543 Ga0209999_1014886 Ga0209999_10148862 248
18 3300049587 Ga0501071_0160168 Ga0501071_0160168_860_1609 248
19 3300005436 Ga0070713_100859344 Ga0070713_1008593441 251
20 3300005468 Ga0070707_100430512 Ga0070707_1004305121 251
21 3300005536 Ga0070697_100399913 Ga0070697_1003999131 251
22 3300005546 Ga0070696_100216791 Ga0070696_1002167911 251
23 3300005546 Ga0070696_100330275 Ga0070696_1003302752 251
24 3300005615 Ga0070702_100095668 Ga0070702_1000956682 251
25 3300005617 Ga0068859_100336177 Ga0068859_1003361772 251
26 3300006871 Ga0075434_100263007 Ga0075434_1002630072 251
27 3300006914 Ga0075436_100160896 Ga0075436_1001608962 251
28 3300006931 Ga0097620_100336160 Ga0097620_1003361602 251
29 3300025936 Ga0207670_10122026 Ga0207670_101220262 251
30 3300026075 Ga0207708_10312294 Ga0207708_103122942 251
31 3300041463 Ga0451804_0410913 Ga0451804_0410913_73_831 251
32 3300046454 Ga0495592_0001581 Ga0495592_0001581_4930_5685 251
33 3300046461 Ga0495641_0089327 Ga0495641_0089327_95_850 251
34 3300046476 Ga0495662_0035600 Ga0495662_0035600_461_1216 251
35 3300046511 Ga0495608_0001149 Ga0495608_0001149_12974_13729 251
36 3300046514 Ga0495618_0027575 Ga0495618_0027575_1864_2619 251
37 3300046516 Ga0495628_0015804 Ga0495628_0015804_1125_1880 251
38 3300046517 Ga0495630_0010491 Ga0495630_0010491_4001_4756 251
39 3300046529 Ga0495652_0096501 Ga0495652_0096501_769_1524 251
40 3300046533 Ga0495640_0004693 Ga0495640_0004693_7926_8681 251
41 3300046535 Ga0495586_0000572 Ga0495586_0000572_18804_19559 251
42 3300046559 Ga0495667_0006355 Ga0495667_0006355_3099_3854 251
43 3300046642 Ga0495634_0003062 Ga0495634_0003062_8735_9490 251
44 3300046663 Ga0495635_0063060 Ga0495635_0063060_811_1566 251
45 3300046683 Ga0495658_0021272 Ga0495658_0021272_680_1435 251
46 3300046689 Ga0495613_0095016 Ga0495613_0095016_805_1560 251
47 3300046809 Ga0495600_0013461 Ga0495600_0013461_1255_2010 251
48 3300047317 Ga0495604_0005366 Ga0495604_0005366_3334_4089 251
49 3300047319 Ga0495674_0178952 Ga0495674_0178952_81_836 251
50 3300047322 Ga0495680_0001126 Ga0495680_0001126_9518_10273 251
51 3300047471 Ga0495684_0082371 Ga0495684_0082371_885_1640 251
52 3300049824 Ga0501045_0284729 Ga0501045_0284729_354_1115 251
53 3300050512 nmdc:mga0n895_11380_c1 nmdc:mga0n895_11380_c1_6935_7693 251
54 3300050513 nmdc:mga0rr50_139680_c1 nmdc:mga0rr50_139680_c1_115_873 251
55 3300053077 Ga0495601_0022623 Ga0495601_0022623_1101_1856 251
56 3300005329 Ga0070683_100063722 Ga0070683_1000637223 252
57 3300005535 Ga0070684_100070885 Ga0070684_1000708854 252
58 3300005615 Ga0070702_100315508 Ga0070702_1003155082 252
59 3300006237 Ga0097621_100159809 Ga0097621_1001598092 252
60 3300006358 Ga0068871_100001500 Ga0068871_1000015002 252
61 3300014969 Ga0157376_10064836 Ga0157376_100648362 252
62 3300025936 Ga0207670_10273441 Ga0207670_102734411 252
63 3300035172 Ga0373955_0035473 Ga0373955_0035473_415_1188 252
64 3300047322 Ga0495680_0068539 Ga0495680_0068539_1325_2098 252
65 3300049572 Ga0501036_0001189 Ga0501036_0001189_3521_4279 252
66 3300049573 Ga0501037_0055251 Ga0501037_0055251_799_1557 252
67 3300049574 Ga0501038_0003779 Ga0501038_0003779_10231_10989 252
68 3300049575 Ga0501039_0016171 Ga0501039_0016171_3371_4129 252
69 3300049576 Ga0501040_0001580 Ga0501040_0001580_11128_11886 252
70 3300049577 Ga0501041_0000194 Ga0501041_0000194_23144_23902 252
71 3300049578 Ga0501042_0001071 Ga0501042_0001071_12913_13671 252
72 3300049579 Ga0501043_0023364 Ga0501043_0023364_2224_2982 252
73 3300049582 Ga0501048_0014716 Ga0501048_0014716_914_1672 252
74 3300049587 Ga0501071_0029682 Ga0501071_0029682_1685_2443 252
75 3300049590 Ga0501074_0045431 Ga0501074_0045431_1430_2188 252
76 3300049591 Ga0501075_0118932 Ga0501075_0118932_493_1251 252
77 3300049592 Ga0501076_0002190 Ga0501076_0002190_11588_12346 252
78 3300049741 Ga0501079_0002188 Ga0501079_0002188_9626_10384 252
79 3300049743 Ga0501081_0000530 Ga0501081_0000530_20276_21034 252
80 3300049744 Ga0501083_0148447 Ga0501083_0148447_469_1227 252
81 3300049823 Ga0501044_0188502 Ga0501044_0188502_412_1170 252
82 3300049824 Ga0501045_0000467 Ga0501045_0000467_13982_14740 252
83 3300054114 Ga0501084_0031487 Ga0501084_0031487_2824_3582 252
84 3300060353 Ga0501082_0003221 Ga0501082_0003221_10298_11056 252
85 3300061734 Ga0530510_0033001 Ga0530510_0033001_1033_1791 252
86 3300005438 Ga0070701_10115984 Ga0070701_101159842 253
87 3300005439 Ga0070711_100165797 Ga0070711_1001657972 253
88 3300005844 Ga0068862_100057401 Ga0068862_1000574012 253
89 3300006173 Ga0070716_100162367 Ga0070716_1001623672 253
90 3300006844 Ga0075428_100085516 Ga0075428_1000855163 253
91 3300006871 Ga0075434_100000032 Ga0075434_1000000324 253
92 3300006914 Ga0075436_100066784 Ga0075436_1000667843 253
93 3300007076 Ga0075435_100009874 Ga0075435_1000098745 253
94 3300007076 Ga0075435_100084927 Ga0075435_1000849273 253
95 3300009094 Ga0111539_10926096 Ga0111539_109260962 253
96 3300025939 Ga0207665_10045358 Ga0207665_100453583 253
97 3300025940 Ga0207691_10413058 Ga0207691_104130582 253
98 3300026075 Ga0207708_10683383 Ga0207708_106833831 253
99 3300027360 Ga0209969_1017739 Ga0209969_10177392 253
100 3300027364 Ga0209967_1000634 Ga0209967_10006342 253
101 3300027471 Ga0209995_1009656 Ga0209995_10096562 253
102 3300027543 Ga0209999_1001914 Ga0209999_10019143 253
103 3300027907 Ga0207428_10223655 Ga0207428_102236552 253
104 3300039438 Ga0436360_0580448 Ga0436360_0580448_22_786 253
105 3300049580 Ga0501046_0132471 Ga0501046_0132471_1002_1766 253
106 3300049824 Ga0501045_0067221 Ga0501045_0067221_225_989 253
107 3300050511 nmdc:mga08y16_283145_c1 nmdc:mga08y16_283145_c1_555_1316 253
108 3300050512 nmdc:mga0n895_12272_c1 nmdc:mga0n895_12272_c1_6641_7405 253
109 3300050513 nmdc:mga0rr50_3590_c1 nmdc:mga0rr50_3590_c1_3805_4569 253
110 3300050514 nmdc:mga08x19_57941_c1 nmdc:mga08x19_57941_c1_411_1175 253
111 3300050515 nmdc:mga0a205_181603_c1 nmdc:mga0a205_181603_c1_876_1640 253
112 3300061734 Ga0530510_0150427 Ga0530510_0150427_502_1266 253
113 3300005330 Ga0070690_100179582 Ga0070690_1001795822 254
114 3300005334 Ga0068869_100321075 Ga0068869_1003210752 254
115 3300005336 Ga0070680_100061267 Ga0070680_1000612673 254
116 3300005345 Ga0070692_10003366 Ga0070692_100033664 254
117 3300005347 Ga0070668_100209698 Ga0070668_1002096982 254
118 3300005353 Ga0070669_100005071 Ga0070669_1000050711 254
119 3300005364 Ga0070673_100273984 Ga0070673_1002739842 254
120 3300005365 Ga0070688_100021320 Ga0070688_1000213202 254
121 3300005406 Ga0070703_10044498 Ga0070703_100444981 254
122 3300005441 Ga0070700_100000224 Ga0070700_10000022414 254
123 3300005456 Ga0070678_100117569 Ga0070678_1001175692 254
124 3300005458 Ga0070681_10002103 Ga0070681_100021035 254
125 3300005459 Ga0068867_100000270 Ga0068867_10000027022 254
126 3300005518 Ga0070699_100542080 Ga0070699_1005420801 254
127 3300005518 Ga0070699_100665776 Ga0070699_1006657761 254
128 3300005530 Ga0070679_100131825 Ga0070679_1001318252 254
129 3300005536 Ga0070697_100001628 Ga0070697_1000016284 254
130 3300005543 Ga0070672_100086503 Ga0070672_1000865032 254
131 3300005545 Ga0070695_100030444 Ga0070695_1000304444 254
132 3300005545 Ga0070695_100118552 Ga0070695_1001185522 254
133 3300005546 Ga0070696_100040164 Ga0070696_1000401642 254
134 3300005719 Ga0068861_100000220 Ga0068861_10000022019 254
135 3300005840 Ga0068870_10275825 Ga0068870_102758251 254
136 3300005844 Ga0068862_100000812 Ga0068862_10000081219 254
137 3300005985 Ga0081539_10000468 Ga0081539_1000046848 254
138 3300006846 Ga0075430_100000209 Ga0075430_10000020918 254
139 3300006847 Ga0075431_100034740 Ga0075431_1000347402 254
140 3300006847 Ga0075431_100472103 Ga0075431_1004721032 254
141 3300006880 Ga0075429_100130951 Ga0075429_1001309513 254
142 3300006881 Ga0068865_100013743 Ga0068865_1000137433 254
143 3300006914 Ga0075436_100001298 Ga0075436_10000129816 254
144 3300006914 Ga0075436_100010042 Ga0075436_1000100423 254
145 3300006914 Ga0075436_100023937 Ga0075436_1000239372 254
146 3300006914 Ga0075436_100176324 Ga0075436_1001763242 254
147 3300009094 Ga0111539_10053639 Ga0111539_100536393 254
148 3300009094 Ga0111539_10206869 Ga0111539_102068693 254
149 3300009147 Ga0114129_10376809 Ga0114129_103768092 254
150 3300009148 Ga0105243_10009088 Ga0105243_100090885 254
151 3300009553 Ga0105249_10009741 Ga0105249_100097415 254
152 3300014326 Ga0157380_10003378 Ga0157380_100033789 254
153 3300025901 Ga0207688_10279184 Ga0207688_102791842 254
154 3300025908 Ga0207643_10013505 Ga0207643_100135053 254
155 3300025908 Ga0207643_10244441 Ga0207643_102444412 254
156 3300025912 Ga0207707_10003773 Ga0207707_1000377312 254
157 3300025917 Ga0207660_10118754 Ga0207660_101187542 254
158 3300025923 Ga0207681_10000804 Ga0207681_100008042 254
159 3300025926 Ga0207659_10086998 Ga0207659_100869983 254
160 3300025938 Ga0207704_10002476 Ga0207704_100024763 254
161 3300025939 Ga0207665_10057430 Ga0207665_100574303 254
162 3300025940 Ga0207691_10095947 Ga0207691_100959472 254
163 3300025942 Ga0207689_10022673 Ga0207689_100226735 254
164 3300025961 Ga0207712_10003033 Ga0207712_100030333 254
165 3300026075 Ga0207708_10000876 Ga0207708_100008766 254
166 3300026075 Ga0207708_10058108 Ga0207708_100581082 254
167 3300026089 Ga0207648_10000639 Ga0207648_1000063919 254
168 3300026118 Ga0207675_100004706 Ga0207675_1000047066 254
169 3300026121 Ga0207683_10081507 Ga0207683_100815073 254
170 3300027682 Ga0209971_1013861 Ga0209971_10138612 254
171 3300027695 Ga0209966_1010073 Ga0209966_10100732 254
172 3300027907 Ga0207428_10015093 Ga0207428_100150932 254
173 3300028380 Ga0268265_10001259 Ga0268265_1000125913 254
174 3300031548 Ga0307408_100102112 Ga0307408_1001021122 254
175 3300032002 Ga0307416_100091751 Ga0307416_1000917512 254
176 3300032005 Ga0307411_10086867 Ga0307411_100868671 254
177 3300034957 Ga0373938_0002572 Ga0373938_0002572_1611_2375 254
178 3300035115 Ga0373941_0024715 Ga0373941_0024715_175_939 254
179 3300035115 Ga0373941_0063362 Ga0373941_0063362_310_1074 254
180 3300035691 Ga0373931_0064006 Ga0373931_0064006_598_1362 254
181 3300041406 Ga0439439_0053813 Ga0439439_0053813_246_1013 254
182 3300041408 Ga0439453_0013368 Ga0439453_0013368_506_1273 254
183 3300042001 Ga0439441_011495 Ga0439441_011495_548_1315 254
184 3300042436 Ga0439435_0006111 Ga0439435_0006111_1032_1802 254
185 3300042437 Ga0439444_0002881 Ga0439444_0002881_568_1335 254
186 3300042437 Ga0439444_0023535 Ga0439444_0023535_63_833 254
187 3300042461 Ga0439460_0003693 Ga0439460_0003693_2527_3294 254
188 3300044706 Ga0466964_0096747 Ga0466964_0096747_514_1281 254
189 3300044842 Ga0466957_0058604 Ga0466957_0058604_1463_2230 254
190 3300045976 Ga0466967_0003628 Ga0466967_0003628_1590_2357 254
191 3300049570 Ga0501033_0450676 Ga0501033_0450676_88_852 254
192 3300049574 Ga0501038_0221560 Ga0501038_0221560_397_1161 254
193 3300049576 Ga0501040_0042996 Ga0501040_0042996_763_1533 254
194 3300049577 Ga0501041_0019456 Ga0501041_0019456_518_1282 254
195 3300049578 Ga0501042_0066420 Ga0501042_0066420_1722_2489 254
196 3300049580 Ga0501046_0055598 Ga0501046_0055598_1123_1887 254
197 3300049582 Ga0501048_0188593 Ga0501048_0188593_562_1332 254
198 3300049583 Ga0501067_0035452 Ga0501067_0035452_1375_2142 254
199 3300049587 Ga0501071_0009077 Ga0501071_0009077_984_1754 254
200 3300049588 Ga0501072_0012779 Ga0501072_0012779_5070_5840 254
201 3300049591 Ga0501075_0006612 Ga0501075_0006612_1147_1917 254
202 3300049592 Ga0501076_0006313 Ga0501076_0006313_149_919 254
203 3300049593 Ga0501077_0094590 Ga0501077_0094590_990_1760 254
204 3300049742 Ga0501080_0020581 Ga0501080_0020581_4194_4964 254
205 3300049743 Ga0501081_0226946 Ga0501081_0226946_336_1103 254
206 3300050509 nmdc:mga0qj67_231_c1 nmdc:mga0qj67_231_c1_29226_29999 254
207 3300050509 nmdc:mga0qj67_50111_c1 nmdc:mga0qj67_50111_c1_932_1696 254
208 3300050510 nmdc:mga06r32_255411_c1 nmdc:mga06r32_255411_c1_477_1241 254
209 3300050510 nmdc:mga06r32_28193_c1 nmdc:mga06r32_28193_c1_34_807 254
210 3300050511 nmdc:mga08y16_162781_c1 nmdc:mga08y16_162781_c1_1426_2190 254
211 3300050511 nmdc:mga08y16_386196_c1 nmdc:mga08y16_386196_c1_516_1280 254
212 3300050514 nmdc:mga08x19_3089_c1 nmdc:mga08x19_3089_c1_2574_3341 254
213 3300050514 nmdc:mga08x19_355393_c1 nmdc:mga08x19_355393_c1_41_817 254
214 3300050514 nmdc:mga08x19_7360_c1 nmdc:mga08x19_7360_c1_4627_5403 254
215 3300054114 Ga0501084_0122800 Ga0501084_0122800_1052_1822 254
216 3300061734 Ga0530510_0003169 Ga0530510_0003169_741_1511 254
217 3300005334 Ga0068869_100191616 Ga0068869_1001916162 255
218 3300005440 Ga0070705_100191195 Ga0070705_1001911952 255
219 3300005546 Ga0070696_100015174 Ga0070696_1000151742 255
220 3300009094 Ga0111539_10045347 Ga0111539_100453473 255
221 3300009098 Ga0105245_10004483 Ga0105245_100044836 255
222 3300009148 Ga0105243_10000540 Ga0105243_100005404 255
223 3300009553 Ga0105249_10016850 Ga0105249_100168503 255
224 3300013297 Ga0157378_10000466 Ga0157378_100004664 255
225 3300014326 Ga0157380_10017081 Ga0157380_100170813 255
226 3300014969 Ga0157376_10003862 Ga0157376_100038629 255
227 3300034817 Ga0373948_0040436 Ga0373948_0040436_115_885 255
228 3300035084 Ga0373928_0025125 Ga0373928_0025125_344_1111 255
229 3300035085 Ga0373929_0031497 Ga0373929_0031497_131_898 255
230 3300035089 Ga0373944_0009635 Ga0373944_0009635_357_1124 255
231 3300035111 Ga0373923_0034454 Ga0373923_0034454_984_1751 255
232 3300035112 Ga0373932_0040176 Ga0373932_0040176_34_801 255
233 3300035113 Ga0373936_0037004 Ga0373936_0037004_676_1443 255
234 3300035114 Ga0373939_0057476 Ga0373939_0057476_180_947 255
235 3300035115 Ga0373941_0039688 Ga0373941_0039688_12_779 255
236 3300035116 Ga0373945_0012430 Ga0373945_0012430_1975_2742 255
237 3300035207 Ga0373942_0016225 Ga0373942_0016225_674_1444 255
238 3300035241 Ga0373961_0030920 Ga0373961_0030920_93_860 255
239 3300035242 Ga0373962_0007650 Ga0373962_0007650_1825_2592 255
240 3300035691 Ga0373931_0000122 Ga0373931_0000122_25233_26000 255
241 3300035691 Ga0373931_0054338 Ga0373931_0054338_956_1726 255
242 3300035691 Ga0373931_0091743 Ga0373931_0091743_366_1136 255
243 3300035692 Ga0373935_0121074 Ga0373935_0121074_962_1729 255
244 3300035692 Ga0373935_0578084 Ga0373935_0578084_34_801 255
245 3300035695 Ga0373927_0405419 Ga0373927_0405419_113_880 255
246 3300035695 Ga0373927_0405424 Ga0373927_0405424_20_787 255
247 3300035725 Ga0373947_0272627 Ga0373947_0272627_244_1011 255
248 3300037068 Ga0373925_0208975 Ga0373925_0208975_112_879 255
249 3300038996 Ga0242420_034265 Ga0242420_034265_34_801 255
250 3300042876 Ga0451577_0036668 Ga0451577_0036668_1538_2305 255
251 3300045051 Ga0451576_0007589 Ga0451576_0007589_1628_2395 255
252 3300045051 Ga0451576_0028138 Ga0451576_0028138_5206_5973 255
253 3300045051 Ga0451576_0033206 Ga0451576_0033206_1491_2258 255
254 3300045051 Ga0451576_0145613 Ga0451576_0145613_54_821 255
255 3300046455 Ga0495603_0220105 Ga0495603_0220105_243_1010 255
256 3300046472 Ga0495580_0004625 Ga0495580_0004625_3557_4324 255
257 3300046473 Ga0495582_0094716 Ga0495582_0094716_61_828 255
258 3300046535 Ga0495586_0033856 Ga0495586_0033856_1799_2566 255
259 3300046615 Ga0495656_0178017 Ga0495656_0178017_37_804 255
260 3300046681 Ga0495647_0003836 Ga0495647_0003836_612_1379 255
261 3300049582 Ga0501048_0141727 Ga0501048_0141727_154_921 255
262 3300049588 Ga0501072_0075091 Ga0501072_0075091_1866_2633 255
263 3300049591 Ga0501075_0510582 Ga0501075_0510582_106_873 255
264 3300049593 Ga0501077_0027224 Ga0501077_0027224_1066_1875 255
265 3300050507 nmdc:mga05p37_506_c1 nmdc:mga05p37_506_c1_39656_40423 255
266 3300050508 nmdc:mga09592_1091_c1 nmdc:mga09592_1091_c1_9906_10673 255
267 3300050509 nmdc:mga0qj67_94446_c1 nmdc:mga0qj67_94446_c1_1210_1977 255
268 3300050510 nmdc:mga06r32_74504_c1 nmdc:mga06r32_74504_c1_1886_2653 255
269 3300050511 nmdc:mga08y16_244_c1 nmdc:mga08y16_244_c1_47504_48271 255
270 3300050512 nmdc:mga0n895_252_c1 nmdc:mga0n895_252_c1_10705_11472 255
271 3300050512 nmdc:mga0n895_321451_c1 nmdc:mga0n895_321451_c1_255_1022 255
272 3300050513 nmdc:mga0rr50_829_c1 nmdc:mga0rr50_829_c1_14528_15295 255
273 3300050514 nmdc:mga08x19_232_c1 nmdc:mga08x19_232_c1_30425_31192 255
274 3300050515 nmdc:mga0a205_360_c1 nmdc:mga0a205_360_c1_18264_19031 255
275 3300049522 Ga0501299_042639 Ga0501299_042639_13_786 256
276 3300005336 Ga0070680_100139694 Ga0070680_1001396942 259
277 3300005345 Ga0070692_10011130 Ga0070692_100111303 259
278 3300005546 Ga0070696_100032634 Ga0070696_1000326344 259
279 3300005549 Ga0070704_100012755 Ga0070704_1000127555 259
280 3300042436 Ga0439435_0000085 Ga0439435_0000085_3922_4713 259
281 3300005295 Ga0065707_10008641 Ga0065707_100086412 260
282 3300005330 Ga0070690_100000460 Ga0070690_1000004603 260
283 3300005334 Ga0068869_100000660 Ga0068869_10000066016 260
284 3300005336 Ga0070680_100044086 Ga0070680_1000440863 260
285 3300005337 Ga0070682_100024917 Ga0070682_1000249172 260
286 3300005338 Ga0068868_100001132 Ga0068868_10000113218 260
287 3300005338 Ga0068868_100199177 Ga0068868_1001991772 260
288 3300005340 Ga0070689_100003349 Ga0070689_1000033497 260
289 3300005340 Ga0070689_100306171 Ga0070689_1003061712 260
290 3300005341 Ga0070691_10001849 Ga0070691_100018495 260
291 3300005343 Ga0070687_100000096 Ga0070687_1000000966 260
292 3300005345 Ga0070692_10142786 Ga0070692_101427862 260
293 3300005364 Ga0070673_100196311 Ga0070673_1001963112 260
294 3300005406 Ga0070703_10008590 Ga0070703_100085902 260
295 3300005438 Ga0070701_10000292 Ga0070701_100002922 260
296 3300005440 Ga0070705_100000745 Ga0070705_1000007454 260
297 3300005441 Ga0070700_100017283 Ga0070700_1000172834 260
298 3300005444 Ga0070694_100000465 Ga0070694_1000004654 260
299 3300005456 Ga0070678_100120898 Ga0070678_1001208982 260
300 3300005458 Ga0070681_10119607 Ga0070681_101196072 260
301 3300005459 Ga0068867_100000280 Ga0068867_10000028033 260
302 3300005518 Ga0070699_100202163 Ga0070699_1002021632 260
303 3300005530 Ga0070679_100032533 Ga0070679_1000325332 260
304 3300005544 Ga0070686_100000761 Ga0070686_10000076114 260
305 3300005545 Ga0070695_100000511 Ga0070695_1000005114 260
306 3300005546 Ga0070696_100006739 Ga0070696_1000067394 260
307 3300005547 Ga0070693_100000066 Ga0070693_1000000666 260
308 3300005549 Ga0070704_100000074 Ga0070704_10000007434 260
309 3300005563 Ga0068855_100001080 Ga0068855_1000010804 260
310 3300005578 Ga0068854_100001473 Ga0068854_10000147311 260
311 3300005615 Ga0070702_100000353 Ga0070702_10000035312 260
312 3300005617 Ga0068859_100001496 Ga0068859_10000149622 260
313 3300005719 Ga0068861_100000665 Ga0068861_10000066518 260
314 3300005719 Ga0068861_100481865 Ga0068861_1004818652 260
315 3300005840 Ga0068870_10077054 Ga0068870_100770542 260
316 3300005841 Ga0068863_100567407 Ga0068863_1005674072 260
317 3300005842 Ga0068858_100001547 Ga0068858_10000154712 260
318 3300005842 Ga0068858_100208378 Ga0068858_1002083782 260
319 3300005843 Ga0068860_100009752 Ga0068860_1000097523 260
320 3300005843 Ga0068860_100145838 Ga0068860_1001458382 260
321 3300005844 Ga0068862_100004919 Ga0068862_1000049194 260
322 3300006237 Ga0097621_100001449 Ga0097621_1000014494 260
323 3300006358 Ga0068871_100004571 Ga0068871_1000045717 260
324 3300006844 Ga0075428_100000072 Ga0075428_10000007239 260
325 3300006846 Ga0075430_100284175 Ga0075430_1002841752 260
326 3300006846 Ga0075430_100301158 Ga0075430_1003011582 260
327 3300006847 Ga0075431_100200020 Ga0075431_1002000202 260
328 3300006852 Ga0075433_10000431 Ga0075433_1000043115 260
329 3300006871 Ga0075434_100000010 Ga0075434_10000001080 260
330 3300006880 Ga0075429_100000034 Ga0075429_10000003454 260
331 3300006881 Ga0068865_100000480 Ga0068865_1000004804 260
332 3300006914 Ga0075436_100000223 Ga0075436_10000022325 260
333 3300006931 Ga0097620_100001496 Ga0097620_10000149622 260
334 3300007076 Ga0075435_100000223 Ga0075435_10000022335 260
335 3300009094 Ga0111539_10107303 Ga0111539_101073033 260
336 3300009147 Ga0114129_10000015 Ga0114129_1000001598 260
337 3300009174 Ga0105241_10024483 Ga0105241_100244833 260
338 3300009176 Ga0105242_10022523 Ga0105242_100225233 260
339 3300010375 Ga0105239_10029016 Ga0105239_100290163 260
340 3300025885 Ga0207653_10006051 Ga0207653_100060512 260
341 3300025908 Ga0207643_10031741 Ga0207643_100317413 260
342 3300025911 Ga0207654_10030998 Ga0207654_100309982 260
343 3300025912 Ga0207707_10105842 Ga0207707_101058423 260
344 3300025917 Ga0207660_10002936 Ga0207660_100029363 260
345 3300025918 Ga0207662_10000493 Ga0207662_100004939 260
346 3300025921 Ga0207652_10017257 Ga0207652_100172574 260
347 3300025927 Ga0207687_10001489 Ga0207687_100014898 260
348 3300025934 Ga0207686_10002039 Ga0207686_100020397 260
349 3300025935 Ga0207709_10001417 Ga0207709_100014175 260
350 3300025936 Ga0207670_10016610 Ga0207670_100166104 260
351 3300025938 Ga0207704_10000350 Ga0207704_1000035016 260
352 3300025942 Ga0207689_10000411 Ga0207689_100004115 260
353 3300025942 Ga0207689_10224820 Ga0207689_102248201 260
354 3300025949 Ga0207667_10013329 Ga0207667_100133292 260
355 3300025981 Ga0207640_10050801 Ga0207640_100508012 260
356 3300026023 Ga0207677_10001326 Ga0207677_100013268 260
357 3300026035 Ga0207703_10143912 Ga0207703_101439122 260
358 3300026075 Ga0207708_10003115 Ga0207708_100031155 260
359 3300026078 Ga0207702_10018553 Ga0207702_100185534 260
360 3300026089 Ga0207648_10000224 Ga0207648_1000022412 260
361 3300026095 Ga0207676_10096501 Ga0207676_100965012 260
362 3300026118 Ga0207675_100000173 Ga0207675_10000017354 260
363 3300026121 Ga0207683_10117742 Ga0207683_101177422 260
364 3300027907 Ga0207428_10000387 Ga0207428_100003878 260
365 3300027907 Ga0207428_10052109 Ga0207428_100521092 260
366 3300028380 Ga0268265_10044193 Ga0268265_100441933 260
367 3300028381 Ga0268264_10006039 Ga0268264_100060393 260
368 3300028381 Ga0268264_10323253 Ga0268264_103232532 260

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

24

183

0.75

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

26

252

0.58

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ock-assembly1.cif.gz_A crystal structure of valacyclovir hydrolase d123n mutant 0.8247 8 256
2oci-assembly1.cif.gz_A crystal structure of valacyclovir hydrolase complexed with a product analogue 0.8241 8 256
2ocl-assembly1.cif.gz_A crystal structure of valacyclovir hydrolase s122a mutant 0.815 8 256
3bdi-assembly1.cif.gz_A crystal structure of predicted cib-like hydrolase (np_393672.1) from thermoplasma acidophilum at 1.45 a resolution 0.8109 7 258
2ock-assembly1.cif.gz_A crystal structure of valacyclovir hydrolase d123n mutant 0.8037 8 256
ID Description Score Start End Superfamily
af_I1K6A2_1_89_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.845 199 238 3.40.50.1820
af_Q9VD00_21_274_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8278 8 255 3.40.50.1820
af_Q9N366_39_241_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8175 8 258 3.40.50.1820
af_A0A0R0KMM0_94_302_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8156 197 258 3.40.50.1820
af_Q86WA6_38_290_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8076 8 260 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A7Y3DQ11-F1-model_v4 Alpha/beta hydrolase 0.9634 84 258 GO:0016787
AF-A0A2J6HE75-F1-model_v4 Alpha/beta hydrolase 0.946 81 260 GO:0016020
GO:0016787
AF-A0A7V2DFM8-F1-model_v4 Alpha/beta hydrolase 0.942 102 258 GO:0016020
GO:0016787
AF-A0A354UZP7-F1-model_v4 Alpha/beta hydrolase 0.9402 127 256
AF-A0A2W6RHN1-F1-model_v4 Alpha/beta hydrolase 0.9396 91 258 GO:0016020
GO:0016787

Feature Viewer

pLDDT pTM Quality
87.01 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map