F424686
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 368 | 165 | 368 | 276 |
Family's Representative Sequence
| Representative Sequence | 3300009148|Ga0105243_10096796|Ga0105243_100967962 |
| Length | 297 |
| Sequence | MRLGGEPESGNFEDRTGQGSSGLGGMGGGNALGCLIPLVMSRFGLGGVVVLVIGYFLLSSLGVLGSGGGVLPGGSGQQQAVPAGKSTLDPNMREFLLRVLGSTEQTWGEIFAKSGARYEPTTMVAYSGGTQTACGLGQAAAGPFYCPNDTRVYIDPSFFNELSQRFGAPGDAAAAYVIAHEVGHHVQDLQGTLNQAHDLQARASKTEGNAVQVRVELQADCYAGVWAASAHDSQGSILEPGDAQEALRAAEAVGDDTLQKQAQGYVVPDSFTHGTSAERMAAFQRGLKGASLAACKF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 2 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 3 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 29 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 36 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 38 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 39 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 40 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 41 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 42 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 43 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 44 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 45 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 46 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 47 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 48 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 49 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 50 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 52 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 115 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 116 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 117 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 118 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 119 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 120 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 121 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 122 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 123 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 124 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 125 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 126 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 127 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 128 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 129 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 130 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 131 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 132 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 133 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 134 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 135 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 136 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 137 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 149 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 150 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 151 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 152 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 153 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 154 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 155 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 156 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 157 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 158 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 159 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 160 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 161 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 162 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 163 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 164 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 165 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.54 |
| Nodule | 0 |
| Rhizoplane | 5.43 |
| Rhizosphere | 94.02 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24752J21851_1003129 | 3300001976 | Bacteria | 2183 |
| 2 | Ga0065712_10069297 | 3300005290 | Bacteria | 7578 |
| 3 | Ga0065715_10110657 | 3300005293 | Bacteria | 2609 |
| 4 | Ga0070658_10021651 | 3300005327 | Bacteria | 5152 |
| 5 | Ga0070658_10126755 | 3300005327 | Bacteria | 2125 |
| 6 | Ga0070676_10089495 | 3300005328 | Bacteria | 1883 |
| 7 | Ga0070670_100035826 | 3300005331 | Bacteria | 4272 |
| 8 | Ga0070677_10000547 | 3300005333 | Bacteria | 12846 |
| 9 | Ga0070680_100173188 | 3300005336 | Bacteria | 1817 |
| 10 | Ga0070680_100383079 | 3300005336 | Bacteria | 1197 |
| 11 | Ga0070682_100138535 | 3300005337 | Bacteria | 1656 |
| 12 | Ga0068868_100071434 | 3300005338 | Bacteria | 2768 |
| 13 | Ga0068868_100375728 | 3300005338 | Bacteria | 1222 |
| 14 | Ga0070660_100029516 | 3300005339 | Bacteria | 4110 |
| 15 | Ga0070660_100198540 | 3300005339 | Bacteria | 1627 |
| 16 | Ga0070661_100036822 | 3300005344 | Bacteria | 3556 |
| 17 | Ga0070661_100178520 | 3300005344 | Bacteria | 1615 |
| 18 | Ga0070661_100203364 | 3300005344 | Bacteria | 1514 |
| 19 | Ga0070661_100375362 | 3300005344 | Bacteria | 1120 |
| 20 | Ga0070669_100015137 | 3300005353 | Bacteria | 5495 |
| 21 | Ga0070669_100068031 | 3300005353 | Bacteria | 2628 |
| 22 | Ga0070669_100123649 | 3300005353 | Bacteria | 1977 |
| 23 | Ga0070675_100000380 | 3300005354 | Bacteria | 30037 |
| 24 | Ga0070675_100014114 | 3300005354 | Bacteria | 6295 |
| 25 | Ga0070675_100179332 | 3300005354 | Bacteria | 1831 |
| 26 | Ga0070671_100002491 | 3300005355 | Bacteria | 14250 |
| 27 | Ga0070671_100004296 | 3300005355 | Bacteria | 11277 |
| 28 | Ga0070671_100006923 | 3300005355 | Bacteria | 9082 |
| 29 | Ga0070671_100040797 | 3300005355 | Bacteria | 3856 |
| 30 | Ga0070671_100071986 | 3300005355 | Bacteria | 2886 |
| 31 | Ga0070671_100074520 | 3300005355 | Bacteria | 2835 |
| 32 | Ga0070674_100019243 | 3300005356 | Bacteria | 4335 |
| 33 | Ga0070673_100003514 | 3300005364 | Bacteria | 9767 |
| 34 | Ga0070673_100076910 | 3300005364 | Bacteria | 2696 |
| 35 | Ga0070673_100303492 | 3300005364 | Bacteria | 1406 |
| 36 | Ga0070667_100006124 | 3300005367 | Bacteria | 9995 |
| 37 | Ga0070667_100014701 | 3300005367 | Bacteria | 6465 |
| 38 | Ga0070667_100016074 | 3300005367 | Bacteria | 6190 |
| 39 | Ga0070667_100018347 | 3300005367 | Bacteria | 5802 |
| 40 | Ga0070667_100038001 | 3300005367 | Bacteria | 4037 |
| 41 | Ga0070667_100099763 | 3300005367 | Bacteria | 2507 |
| 42 | Ga0070694_100347886 | 3300005444 | Bacteria | 1147 |
| 43 | Ga0070663_100073024 | 3300005455 | Bacteria | 2502 |
| 44 | Ga0070663_100363558 | 3300005455 | Bacteria | 1174 |
| 45 | Ga0070678_100132660 | 3300005456 | Bacteria | 1982 |
| 46 | Ga0070662_100163717 | 3300005457 | Bacteria | 1741 |
| 47 | Ga0070662_100204855 | 3300005457 | Bacteria | 1567 |
| 48 | Ga0070681_10117278 | 3300005458 | Bacteria | 2598 |
| 49 | Ga0070706_100506810 | 3300005467 | Bacteria | 1123 |
| 50 | Ga0070698_100028180 | 3300005471 | Bacteria | 5836 |
| 51 | Ga0070679_100093391 | 3300005530 | Bacteria | 2996 |
| 52 | Ga0070679_100456446 | 3300005530 | Bacteria | 1222 |
| 53 | Ga0070684_100433725 | 3300005535 | Bacteria | 1214 |
| 54 | Ga0068853_100000814 | 3300005539 | Bacteria | 21767 |
| 55 | Ga0068853_100001065 | 3300005539 | Bacteria | 19364 |
| 56 | Ga0068853_100307453 | 3300005539 | Bacteria | 1467 |
| 57 | Ga0070672_100000401 | 3300005543 | Bacteria | 25012 |
| 58 | Ga0070672_100049508 | 3300005543 | Bacteria | 3269 |
| 59 | Ga0070695_100013514 | 3300005545 | Bacteria | 4907 |
| 60 | Ga0070696_100010639 | 3300005546 | Bacteria | 6161 |
| 61 | Ga0070696_100081711 | 3300005546 | Bacteria | 2290 |
| 62 | Ga0070696_100282808 | 3300005546 | Bacteria | 1265 |
| 63 | Ga0070693_100110580 | 3300005547 | Bacteria | 1690 |
| 64 | Ga0070665_100000024 | 3300005548 | Bacteria | 374559 |
| 65 | Ga0070665_100008011 | 3300005548 | Bacteria | 10703 |
| 66 | Ga0070704_100408558 | 3300005549 | Bacteria | 1160 |
| 67 | Ga0068855_100076372 | 3300005563 | Bacteria | 3888 |
| 68 | Ga0068855_100354011 | 3300005563 | Bacteria | 1617 |
| 69 | Ga0070664_100001285 | 3300005564 | Bacteria | 20077 |
| 70 | Ga0070664_100027045 | 3300005564 | Bacteria | 4765 |
| 71 | Ga0070664_100245768 | 3300005564 | Bacteria | 1607 |
| 72 | Ga0068857_100008055 | 3300005577 | Bacteria | 9088 |
| 73 | Ga0068857_100043351 | 3300005577 | Bacteria | 3991 |
| 74 | Ga0068857_100070189 | 3300005577 | Bacteria | 3120 |
| 75 | Ga0068857_100308596 | 3300005577 | Bacteria | 1459 |
| 76 | Ga0068857_100424847 | 3300005577 | Bacteria | 1239 |
| 77 | Ga0068857_100474732 | 3300005577 | Bacteria | 1171 |
| 78 | Ga0068854_100068743 | 3300005578 | Bacteria | 2583 |
| 79 | Ga0068854_100285809 | 3300005578 | Bacteria | 1330 |
| 80 | Ga0068856_100192820 | 3300005614 | Bacteria | 2051 |
| 81 | Ga0068856_100267674 | 3300005614 | Bacteria | 1725 |
| 82 | Ga0068852_100120637 | 3300005616 | Bacteria | 2400 |
| 83 | Ga0068852_100325354 | 3300005616 | Bacteria | 1494 |
| 84 | Ga0068859_100044585 | 3300005617 | Bacteria | 4456 |
| 85 | Ga0068859_100062592 | 3300005617 | Bacteria | 3751 |
| 86 | Ga0068859_100093335 | 3300005617 | Bacteria | 3061 |
| 87 | Ga0068864_100000152 | 3300005618 | Bacteria | 64211 |
| 88 | Ga0068864_100007919 | 3300005618 | Bacteria | 8754 |
| 89 | Ga0068864_100009524 | 3300005618 | Bacteria | 8015 |
| 90 | Ga0068851_10069742 | 3300005834 | Bacteria | 1816 |
| 91 | Ga0068863_100011024 | 3300005841 | Bacteria | 8768 |
| 92 | Ga0068863_100039595 | 3300005841 | Bacteria | 4484 |
| 93 | Ga0068863_100070983 | 3300005841 | Bacteria | 3294 |
| 94 | Ga0068863_100284247 | 3300005841 | Bacteria | 1603 |
| 95 | Ga0068858_100002589 | 3300005842 | Bacteria | 18214 |
| 96 | Ga0068858_100015237 | 3300005842 | Bacteria | 7232 |
| 97 | Ga0068858_100053586 | 3300005842 | Bacteria | 3731 |
| 98 | Ga0068858_100151542 | 3300005842 | Bacteria | 2180 |
| 99 | Ga0068860_100006380 | 3300005843 | Bacteria | 11838 |
| 100 | Ga0068860_100065858 | 3300005843 | Bacteria | 3440 |
| 101 | Ga0068862_100045490 | 3300005844 | Bacteria | 3745 |
| 102 | Ga0068862_100123182 | 3300005844 | Bacteria | 2287 |
| 103 | Ga0068862_100265378 | 3300005844 | Bacteria | 1568 |
| 104 | Ga0081539_10005679 | 3300005985 | Bacteria | 12518 |
| 105 | Ga0075436_100125941 | 3300006914 | Bacteria | 1795 |
| 106 | Ga0097620_100044585 | 3300006931 | Bacteria | 4456 |
| 107 | Ga0097620_100062593 | 3300006931 | Bacteria | 3751 |
| 108 | Ga0097620_100093337 | 3300006931 | Bacteria | 3061 |
| 109 | Ga0075435_100277370 | 3300007076 | Bacteria | 1431 |
| 110 | Ga0105250_10012615 | 3300009092 | Bacteria | 3484 |
| 111 | Ga0105240_10016799 | 3300009093 | Bacteria | 9898 |
| 112 | Ga0111539_10014044 | 3300009094 | Bacteria | 10007 |
| 113 | Ga0105245_10200777 | 3300009098 | Bacteria | 1915 |
| 114 | Ga0105247_10125397 | 3300009101 | Bacteria | 1668 |
| 115 | Ga0105243_10096796 | 3300009148 | Bacteria | 2442 |
| 116 | Ga0105242_10041396 | 3300009176 | Bacteria | 3716 |
| 117 | Ga0105248_10004459 | 3300009177 | Bacteria | 15494 |
| 118 | Ga0105248_10008414 | 3300009177 | Bacteria | 11324 |
| 119 | Ga0105248_10011081 | 3300009177 | Bacteria | 9946 |
| 120 | Ga0105248_10079091 | 3300009177 | Bacteria | 3695 |
| 121 | Ga0105248_10162882 | 3300009177 | Bacteria | 2515 |
| 122 | Ga0105237_10169421 | 3300009545 | Bacteria | 2183 |
| 123 | Ga0105249_10014236 | 3300009553 | Bacteria | 7033 |
| 124 | Ga0105246_10092430 | 3300011119 | Bacteria | 2183 |
| 125 | Ga0105246_10200788 | 3300011119 | Bacteria | 1550 |
| 126 | Ga0157373_10008046 | 3300013100 | Bacteria | 7836 |
| 127 | Ga0157373_10064429 | 3300013100 | Bacteria | 2594 |
| 128 | Ga0163162_10079445 | 3300013306 | Bacteria | 3347 |
| 129 | Ga0163162_10126156 | 3300013306 | Bacteria | 2665 |
| 130 | Ga0157372_10370242 | 3300013307 | Bacteria | 1669 |
| 131 | Ga0157375_10084276 | 3300013308 | Bacteria | 3226 |
| 132 | Ga0157375_10102672 | 3300013308 | Bacteria | 2945 |
| 133 | Ga0157375_10236632 | 3300013308 | Bacteria | 1985 |
| 134 | Ga0157375_10596993 | 3300013308 | Bacteria | 1263 |
| 135 | Ga0163163_10060285 | 3300014325 | Bacteria | 3756 |
| 136 | Ga0163163_10360134 | 3300014325 | Bacteria | 1511 |
| 137 | Ga0157380_10063252 | 3300014326 | Bacteria | 2966 |
| 138 | Ga0157379_10011613 | 3300014968 | Bacteria | 7690 |
| 139 | Ga0157379_10017112 | 3300014968 | Bacteria | 6383 |
| 140 | Ga0157379_10026063 | 3300014968 | Bacteria | 5201 |
| 141 | Ga0157379_10425851 | 3300014968 | Bacteria | 1223 |
| 142 | Ga0163161_10176357 | 3300017792 | Bacteria | 1636 |
| 143 | Ga0207697_10049901 | 3300025315 | Bacteria | 1728 |
| 144 | Ga0207696_1026986 | 3300025711 | Bacteria | 1774 |
| 145 | Ga0207682_10001617 | 3300025893 | Bacteria | 10343 |
| 146 | Ga0207682_10028524 | 3300025893 | Bacteria | 2228 |
| 147 | Ga0207647_10005912 | 3300025904 | Bacteria | 8922 |
| 148 | Ga0207647_10021665 | 3300025904 | Bacteria | 4285 |
| 149 | Ga0207705_10015458 | 3300025909 | Bacteria | 5477 |
| 150 | Ga0207705_10028470 | 3300025909 | Bacteria | 3983 |
| 151 | Ga0207705_10146259 | 3300025909 | Bacteria | 1768 |
| 152 | Ga0207707_10188967 | 3300025912 | Bacteria | 1797 |
| 153 | Ga0207660_10077266 | 3300025917 | Bacteria | 2437 |
| 154 | Ga0207657_10007694 | 3300025919 | Bacteria | 11011 |
| 155 | Ga0207657_10039090 | 3300025919 | Bacteria | 4218 |
| 156 | Ga0207657_10083270 | 3300025919 | Bacteria | 2684 |
| 157 | Ga0207657_10142106 | 3300025919 | Bacteria | 1961 |
| 158 | Ga0207649_10075986 | 3300025920 | Bacteria | 2160 |
| 159 | Ga0207649_10142504 | 3300025920 | Bacteria | 1642 |
| 160 | Ga0207649_10340985 | 3300025920 | Bacteria | 1106 |
| 161 | Ga0207652_10214846 | 3300025921 | Bacteria | 1732 |
| 162 | Ga0207652_10315854 | 3300025921 | Bacteria | 1410 |
| 163 | Ga0207681_10014286 | 3300025923 | Bacteria | 4931 |
| 164 | Ga0207681_10019084 | 3300025923 | Bacteria | 4329 |
| 165 | Ga0207681_10054803 | 3300025923 | Bacteria | 2713 |
| 166 | Ga0207681_10083015 | 3300025923 | Bacteria | 2267 |
| 167 | Ga0207681_10311369 | 3300025923 | Bacteria | 1249 |
| 168 | Ga0207650_10009234 | 3300025925 | Bacteria | 6738 |
| 169 | Ga0207650_10245184 | 3300025925 | Bacteria | 1449 |
| 170 | Ga0207659_10003335 | 3300025926 | Bacteria | 9629 |
| 171 | Ga0207644_10010946 | 3300025931 | Bacteria | 5993 |
| 172 | Ga0207644_10033629 | 3300025931 | Bacteria | 3585 |
| 173 | Ga0207644_10053775 | 3300025931 | Bacteria | 2898 |
| 174 | Ga0207644_10061295 | 3300025931 | Bacteria | 2724 |
| 175 | Ga0207644_10337446 | 3300025931 | Bacteria | 1221 |
| 176 | Ga0207690_10008144 | 3300025932 | Bacteria | 6220 |
| 177 | Ga0207690_10300325 | 3300025932 | Bacteria | 1256 |
| 178 | Ga0207690_10367689 | 3300025932 | Bacteria | 1140 |
| 179 | Ga0207706_10000914 | 3300025933 | Bacteria | 30342 |
| 180 | Ga0207706_10003005 | 3300025933 | Bacteria | 16255 |
| 181 | Ga0207706_10028498 | 3300025933 | Bacteria | 4988 |
| 182 | Ga0207706_10040796 | 3300025933 | Bacteria | 4115 |
| 183 | Ga0207706_10041020 | 3300025933 | Bacteria | 4103 |
| 184 | Ga0207706_10220299 | 3300025933 | Bacteria | 1661 |
| 185 | Ga0207706_10662823 | 3300025933 | Bacteria | 893 |
| 186 | Ga0207686_10023924 | 3300025934 | Bacteria | 3532 |
| 187 | Ga0207686_10191116 | 3300025934 | Bacteria | 1459 |
| 188 | Ga0207669_10020567 | 3300025937 | Bacteria | 3465 |
| 189 | Ga0207691_10002386 | 3300025940 | Bacteria | 18370 |
| 190 | Ga0207691_10067292 | 3300025940 | Bacteria | 3239 |
| 191 | Ga0207711_10002664 | 3300025941 | Bacteria | 15787 |
| 192 | Ga0207711_10005655 | 3300025941 | Bacteria | 10562 |
| 193 | Ga0207711_10050893 | 3300025941 | Bacteria | 3547 |
| 194 | Ga0207689_10056646 | 3300025942 | Bacteria | 3226 |
| 195 | Ga0207661_10406988 | 3300025944 | Bacteria | 1234 |
| 196 | Ga0207679_10033866 | 3300025945 | Bacteria | 3598 |
| 197 | Ga0207679_10181088 | 3300025945 | Bacteria | 1743 |
| 198 | Ga0207679_10275643 | 3300025945 | Bacteria | 1440 |
| 199 | Ga0207679_10279870 | 3300025945 | Bacteria | 1430 |
| 200 | Ga0207667_10032087 | 3300025949 | Bacteria | 5662 |
| 201 | Ga0207667_10382256 | 3300025949 | Bacteria | 1434 |
| 202 | Ga0207667_10795795 | 3300025949 | Bacteria | 942 |
| 203 | Ga0207651_10004130 | 3300025960 | Bacteria | 7256 |
| 204 | Ga0207651_10075295 | 3300025960 | Bacteria | 2408 |
| 205 | Ga0207651_10354207 | 3300025960 | Bacteria | 1237 |
| 206 | Ga0207712_10000940 | 3300025961 | Bacteria | 21021 |
| 207 | Ga0207668_10011258 | 3300025972 | Bacteria | 5429 |
| 208 | Ga0207640_10268323 | 3300025981 | Bacteria | 1334 |
| 209 | Ga0207658_10010816 | 3300025986 | Bacteria | 6208 |
| 210 | Ga0207658_10011302 | 3300025986 | Bacteria | 6079 |
| 211 | Ga0207658_10024130 | 3300025986 | Bacteria | 4251 |
| 212 | Ga0207658_10026494 | 3300025986 | Bacteria | 4065 |
| 213 | Ga0207658_10035658 | 3300025986 | Bacteria | 3564 |
| 214 | Ga0207658_10049154 | 3300025986 | Bacteria | 3097 |
| 215 | Ga0207703_10051763 | 3300026035 | Bacteria | 3330 |
| 216 | Ga0207703_10094336 | 3300026035 | Bacteria | 2522 |
| 217 | Ga0207703_10226686 | 3300026035 | Bacteria | 1673 |
| 218 | Ga0207639_10001556 | 3300026041 | Bacteria | 15378 |
| 219 | Ga0207639_10234882 | 3300026041 | Bacteria | 1591 |
| 220 | Ga0207639_10403015 | 3300026041 | Bacteria | 1233 |
| 221 | Ga0207678_10001633 | 3300026067 | Bacteria | 20554 |
| 222 | Ga0207678_10012511 | 3300026067 | Bacteria | 7452 |
| 223 | Ga0207702_10070218 | 3300026078 | Bacteria | 3012 |
| 224 | Ga0207702_10157677 | 3300026078 | Bacteria | 2070 |
| 225 | Ga0207641_10010409 | 3300026088 | Bacteria | 7643 |
| 226 | Ga0207641_10014279 | 3300026088 | Bacteria | 6508 |
| 227 | Ga0207641_10074036 | 3300026088 | Bacteria | 2936 |
| 228 | Ga0207641_10266337 | 3300026088 | Bacteria | 1606 |
| 229 | Ga0207676_10009599 | 3300026095 | Bacteria | 6890 |
| 230 | Ga0207676_10020940 | 3300026095 | Bacteria | 4792 |
| 231 | Ga0207676_10065441 | 3300026095 | Bacteria | 2894 |
| 232 | Ga0207676_10252572 | 3300026095 | Bacteria | 1588 |
| 233 | Ga0207674_10000060 | 3300026116 | Bacteria | 112806 |
| 234 | Ga0207674_10014458 | 3300026116 | Bacteria | 8715 |
| 235 | Ga0207674_10029229 | 3300026116 | Bacteria | 5805 |
| 236 | Ga0207674_10232840 | 3300026116 | Bacteria | 1790 |
| 237 | Ga0207675_100235889 | 3300026118 | Bacteria | 1766 |
| 238 | Ga0207675_100326829 | 3300026118 | Bacteria | 1498 |
| 239 | Ga0207683_10083439 | 3300026121 | Bacteria | 2840 |
| 240 | Ga0207683_10309319 | 3300026121 | Bacteria | 1446 |
| 241 | Ga0207698_10216642 | 3300026142 | Bacteria | 1727 |
| 242 | Ga0207698_10457749 | 3300026142 | Bacteria | 1233 |
| 243 | Ga0209974_10003151 | 3300027876 | Bacteria | 5971 |
| 244 | Ga0268266_10014446 | 3300028379 | Bacteria | 6788 |
| 245 | Ga0268266_10167805 | 3300028379 | Bacteria | 1990 |
| 246 | Ga0268265_10015055 | 3300028380 | Bacteria | 5282 |
| 247 | Ga0268265_10084320 | 3300028380 | Bacteria | 2518 |
| 248 | Ga0268265_10137495 | 3300028380 | Bacteria | 2040 |
| 249 | Ga0268265_10188580 | 3300028380 | Bacteria | 1778 |
| 250 | Ga0268264_10000379 | 3300028381 | Bacteria | 64925 |
| 251 | Ga0268264_10000755 | 3300028381 | Bacteria | 36243 |
| 252 | Ga0268264_10110989 | 3300028381 | Bacteria | 2402 |
| 253 | Ga0316178_1168699 | 3300030735 | Bacteria | 1628 |
| 254 | Ga0316182_1387698 | 3300030745 | Bacteria | 1108 |
| 255 | Ga0265340_10079011 | 3300031247 | Bacteria | 1551 |
| 256 | Ga0307408_100024840 | 3300031548 | Bacteria | 4097 |
| 257 | Ga0307408_100033862 | 3300031548 | Bacteria | 3573 |
| 258 | Ga0307408_100041723 | 3300031548 | Bacteria | 3254 |
| 259 | Ga0307408_100236124 | 3300031548 | Bacteria | 1500 |
| 260 | Ga0307405_10062318 | 3300031731 | Bacteria | 2361 |
| 261 | Ga0307405_10074075 | 3300031731 | Bacteria | 2200 |
| 262 | Ga0307405_10139645 | 3300031731 | Bacteria | 1687 |
| 263 | Ga0307413_10017707 | 3300031824 | Bacteria | 3717 |
| 264 | Ga0307413_10021220 | 3300031824 | Bacteria | 3472 |
| 265 | Ga0307413_10336909 | 3300031824 | Bacteria | 1158 |
| 266 | Ga0307413_10440180 | 3300031824 | Bacteria | 1032 |
| 267 | Ga0307410_10019956 | 3300031852 | Bacteria | 4089 |
| 268 | Ga0307410_10051451 | 3300031852 | Bacteria | 2776 |
| 269 | Ga0307410_10057118 | 3300031852 | Bacteria | 2656 |
| 270 | Ga0307410_10073430 | 3300031852 | Bacteria | 2378 |
| 271 | Ga0307410_10087526 | 3300031852 | Bacteria | 2203 |
| 272 | Ga0307410_10199145 | 3300031852 | Bacteria | 1528 |
| 273 | Ga0307410_10321817 | 3300031852 | Bacteria | 1227 |
| 274 | Ga0307406_10006681 | 3300031901 | Bacteria | 6378 |
| 275 | Ga0307406_10020145 | 3300031901 | Bacteria | 3923 |
| 276 | Ga0307406_10050813 | 3300031901 | Bacteria | 2630 |
| 277 | Ga0307406_10087925 | 3300031901 | Bacteria | 2084 |
| 278 | Ga0307406_10118761 | 3300031901 | Bacteria | 1834 |
| 279 | Ga0307407_10070288 | 3300031903 | Bacteria | 2080 |
| 280 | Ga0307412_10013048 | 3300031911 | Bacteria | 4858 |
| 281 | Ga0307412_10063743 | 3300031911 | Bacteria | 2488 |
| 282 | Ga0307409_100002852 | 3300031995 | Bacteria | 9149 |
| 283 | Ga0307409_100005778 | 3300031995 | Bacteria | 7174 |
| 284 | Ga0307409_100010012 | 3300031995 | Bacteria | 5862 |
| 285 | Ga0307409_100069956 | 3300031995 | Bacteria | 2783 |
| 286 | Ga0307409_100158193 | 3300031995 | Bacteria | 1978 |
| 287 | Ga0307409_100520028 | 3300031995 | Bacteria | 1162 |
| 288 | Ga0307416_100017702 | 3300032002 | Bacteria | 4994 |
| 289 | Ga0307416_100037845 | 3300032002 | Bacteria | 3717 |
| 290 | Ga0307416_100048026 | 3300032002 | Bacteria | 3383 |
| 291 | Ga0307416_100064039 | 3300032002 | Bacteria | 3014 |
| 292 | Ga0307416_100329038 | 3300032002 | Bacteria | 1534 |
| 293 | Ga0307416_100360779 | 3300032002 | Bacteria | 1475 |
| 294 | Ga0307416_100375022 | 3300032002 | Bacteria | 1450 |
| 295 | Ga0307416_100600187 | 3300032002 | Bacteria | 1180 |
| 296 | Ga0307414_10007243 | 3300032004 | Bacteria | 6230 |
| 297 | Ga0307414_10007417 | 3300032004 | Bacteria | 6162 |
| 298 | Ga0307414_10207388 | 3300032004 | Bacteria | 1599 |
| 299 | Ga0307414_10278424 | 3300032004 | Bacteria | 1404 |
| 300 | Ga0307411_10002078 | 3300032005 | Bacteria | 8620 |
| 301 | Ga0307411_10002260 | 3300032005 | Bacteria | 8423 |
| 302 | Ga0307411_10008973 | 3300032005 | Bacteria | 5222 |
| 303 | Ga0307411_10034037 | 3300032005 | Bacteria | 3166 |
| 304 | Ga0307411_10066008 | 3300032005 | Bacteria | 2429 |
| 305 | Ga0307415_100001978 | 3300032126 | Bacteria | 10082 |
| 306 | Ga0307415_100024001 | 3300032126 | Bacteria | 3799 |
| 307 | Ga0307415_100032916 | 3300032126 | Bacteria | 3359 |
| 308 | Ga0307415_100105831 | 3300032126 | Bacteria | 2075 |
| 309 | Ga0307415_100401440 | 3300032126 | Bacteria | 1170 |
| 310 | Ga0395899_0001765 | 3300037312 | Bacteria | 17978 |
| 311 | Ga0395899_0137997 | 3300037312 | Bacteria | 1737 |
| 312 | Ga0395899_0151559 | 3300037312 | Bacteria | 1643 |
| 313 | Ga0395900_0036015 | 3300037418 | Bacteria | 5099 |
| 314 | Ga0395900_0109319 | 3300037418 | Bacteria | 2840 |
| 315 | Ga0395900_0116863 | 3300037418 | Bacteria | 2737 |
| 316 | Ga0395900_0158155 | 3300037418 | Bacteria | 2313 |
| 317 | Ga0395900_0460795 | 3300037418 | Bacteria | 1226 |
| 318 | Ga0395898_0019395 | 3300037466 | Bacteria | 6921 |
| 319 | Ga0395905_0006908 | 3300037471 | Bacteria | 11347 |
| 320 | Ga0395905_0010343 | 3300037471 | Bacteria | 9081 |
| 321 | Ga0395905_0030386 | 3300037471 | Bacteria | 5090 |
| 322 | Ga0395905_0103973 | 3300037471 | Bacteria | 2666 |
| 323 | Ga0395905_0153837 | 3300037471 | Bacteria | 2163 |
| 324 | Ga0395905_0293561 | 3300037471 | Bacteria | 1512 |
| 325 | Ga0395901_0059649 | 3300038443 | Bacteria | 3970 |
| 326 | Ga0395901_0102171 | 3300038443 | Bacteria | 3008 |
| 327 | Ga0450892_006191 | 3300042130 | Bacteria | 994 |
| 328 | Ga0450905_003838 | 3300042142 | Bacteria | 1978 |
| 329 | Ga0450889_001229 | 3300042144 | Bacteria | 2668 |
| 330 | Ga0495585_0016914 | 3300046492 | Bacteria | 4224 |
| 331 | Ga0495663_0001307 | 3300046525 | Bacteria | 7894 |
| 332 | Ga0495663_0079348 | 3300046525 | Bacteria | 1055 |
| 333 | Ga0495642_0008942 | 3300046528 | Bacteria | 3834 |
| 334 | Ga0495598_0000568 | 3300046537 | Bacteria | 6943 |
| 335 | Ga0495621_0000404 | 3300046539 | Bacteria | 10624 |
| 336 | Ga0495668_0014504 | 3300046616 | Bacteria | 4618 |
| 337 | Ga0495625_0093176 | 3300046660 | Bacteria | 2080 |
| 338 | Ga0495647_0007996 | 3300046681 | Bacteria | 3555 |
| 339 | Ga0495669_0011176 | 3300046684 | Bacteria | 3806 |
| 340 | Ga0495669_0014007 | 3300046684 | Bacteria | 3426 |
| 341 | Ga0495669_0018394 | 3300046684 | Bacteria | 3004 |
| 342 | Ga0495670_0022310 | 3300046691 | Bacteria | 3125 |
| 343 | Ga0495677_0007606 | 3300047445 | Bacteria | 4043 |
| 344 | Ga0496102_0053641 | 3300048905 | Bacteria | 3674 |
| 345 | Ga0496103_0062687 | 3300048906 | Bacteria | 2314 |
| 346 | Ga0496104_0121111 | 3300048907 | Bacteria | 2512 |
| 347 | Ga0496104_0221199 | 3300048907 | Bacteria | 1806 |
| 348 | Ga0496105_0074714 | 3300048908 | Bacteria | 2800 |
| 349 | Ga0496106_0336052 | 3300048909 | Bacteria | 1213 |
| 350 | Ga0496107_0039128 | 3300048910 | Bacteria | 3402 |
| 351 | Ga0496107_0072201 | 3300048910 | Bacteria | 2509 |
| 352 | Ga0496108_0020819 | 3300048911 | Bacteria | 5393 |
| 353 | Ga0496108_0038501 | 3300048911 | Bacteria | 3984 |
| 354 | Ga0496108_0175419 | 3300048911 | Bacteria | 1855 |
| 355 | Ga0496109_0110016 | 3300048912 | Bacteria | 2561 |
| 356 | Ga0496110_0003535 | 3300048913 | Bacteria | 11999 |
| 357 | Ga0496110_0004390 | 3300048913 | Bacteria | 10921 |
| 358 | Ga0496111_0005304 | 3300048914 | Bacteria | 8234 |
| 359 | Ga0496111_0080922 | 3300048914 | Bacteria | 2370 |
| 360 | Ga0496112_0155611 | 3300048915 | Bacteria | 2252 |
| 361 | Ga0496112_0232583 | 3300048915 | Bacteria | 1797 |
| 362 | Ga0496113_0009265 | 3300048916 | Bacteria | 6460 |
| 363 | Ga0496114_0078337 | 3300048917 | Bacteria | 2788 |
| 364 | Ga0501080_0092654 | 3300049742 | Bacteria | 2806 |
| 365 | nmdc:mga08y16_86986_c1 | 3300050511 | Bacteria | 3256 |
| 366 | nmdc:mga08x19_115331_c1 | 3300050514 | Bacteria | 1795 |
| 367 | Ga0500658_0000188 | 3300053134 | Bacteria | 29351 |
| 368 | Ga0500636_0021725 | 3300053177 | Bacteria | 3799 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005471 | Ga0070698_100028180 | Ga0070698_1000281804 | 237 |
| 2 | 3300025933 | Ga0207706_10662823 | Ga0207706_106628231 | 237 |
| 3 | 3300031824 | Ga0307413_10021220 | Ga0307413_100212204 | 243 |
| 4 | 3300031852 | Ga0307410_10057118 | Ga0307410_100571182 | 243 |
| 5 | 3300031901 | Ga0307406_10050813 | Ga0307406_100508133 | 243 |
| 6 | 3300031995 | Ga0307409_100069956 | Ga0307409_1000699561 | 243 |
| 7 | 3300032002 | Ga0307416_100600187 | Ga0307416_1006001872 | 243 |
| 8 | 3300032004 | Ga0307414_10278424 | Ga0307414_102784242 | 243 |
| 9 | 3300032005 | Ga0307411_10066008 | Ga0307411_100660082 | 243 |
| 10 | 3300032126 | Ga0307415_100032916 | Ga0307415_1000329164 | 243 |
| 11 | 3300037418 | Ga0395900_0460795 | Ga0395900_0460795_136_918 | 244 |
| 12 | 3300053177 | Ga0500636_0021725 | Ga0500636_0021725_1323_2216 | 244 |
| 13 | 3300027876 | Ga0209974_10003151 | Ga0209974_100031512 | 246 |
| 14 | 3300031548 | Ga0307408_100024840 | Ga0307408_1000248404 | 246 |
| 15 | 3300031824 | Ga0307413_10336909 | Ga0307413_103369091 | 246 |
| 16 | 3300031901 | Ga0307406_10020145 | Ga0307406_100201455 | 246 |
| 17 | 3300031995 | Ga0307409_100520028 | Ga0307409_1005200282 | 246 |
| 18 | 3300032002 | Ga0307416_100329038 | Ga0307416_1003290381 | 246 |
| 19 | 3300032126 | Ga0307415_100024001 | Ga0307415_1000240014 | 246 |
| 20 | 3300005539 | Ga0068853_100001065 | Ga0068853_1000010659 | 247 |
| 21 | 3300013100 | Ga0157373_10008046 | Ga0157373_100080462 | 249 |
| 22 | 3300025933 | Ga0207706_10000914 | Ga0207706_1000091426 | 249 |
| 23 | 3300005336 | Ga0070680_100173188 | Ga0070680_1001731882 | 250 |
| 24 | 3300005577 | Ga0068857_100008055 | Ga0068857_1000080556 | 252 |
| 25 | 3300009176 | Ga0105242_10041396 | Ga0105242_100413963 | 255 |
| 26 | 3300025934 | Ga0207686_10023924 | Ga0207686_100239243 | 255 |
| 27 | 3300005356 | Ga0070674_100019243 | Ga0070674_1000192433 | 256 |
| 28 | 3300025937 | Ga0207669_10020567 | Ga0207669_100205673 | 256 |
| 29 | 3300025933 | Ga0207706_10040796 | Ga0207706_100407962 | 257 |
| 30 | 3300025981 | Ga0207640_10268323 | Ga0207640_102683232 | 257 |
| 31 | 3300028380 | Ga0268265_10015055 | Ga0268265_100150554 | 257 |
| 32 | 3300031548 | Ga0307408_100041723 | Ga0307408_1000417231 | 257 |
| 33 | 3300031731 | Ga0307405_10074075 | Ga0307405_100740752 | 257 |
| 34 | 3300031824 | Ga0307413_10017707 | Ga0307413_100177074 | 257 |
| 35 | 3300031852 | Ga0307410_10073430 | Ga0307410_100734302 | 257 |
| 36 | 3300031903 | Ga0307407_10070288 | Ga0307407_100702881 | 257 |
| 37 | 3300031911 | Ga0307412_10013048 | Ga0307412_100130485 | 257 |
| 38 | 3300032002 | Ga0307416_100017702 | Ga0307416_1000177027 | 257 |
| 39 | 3300032126 | Ga0307415_100105831 | Ga0307415_1001058311 | 257 |
| 40 | 3300042130 | Ga0450892_006191 | Ga0450892_006191_32_835 | 257 |
| 41 | 3300005548 | Ga0070665_100000024 | Ga0070665_100000024226 | 258 |
| 42 | 3300046528 | Ga0495642_0008942 | Ga0495642_0008942_912_1793 | 258 |
| 43 | 3300005344 | Ga0070661_100203364 | Ga0070661_1002033641 | 259 |
| 44 | 3300005539 | Ga0068853_100000814 | Ga0068853_1000008142 | 259 |
| 45 | 3300026041 | Ga0207639_10001556 | Ga0207639_1000155616 | 259 |
| 46 | 3300005337 | Ga0070682_100138535 | Ga0070682_1001385352 | 260 |
| 47 | 3300005530 | Ga0070679_100093391 | Ga0070679_1000933913 | 260 |
| 48 | 3300025932 | Ga0207690_10300325 | Ga0207690_103003251 | 260 |
| 49 | 3300046681 | Ga0495647_0007996 | Ga0495647_0007996_2435_3280 | 260 |
| 50 | 3300031911 | Ga0307412_10063743 | Ga0307412_100637432 | 261 |
| 51 | 3300031548 | Ga0307408_100033862 | Ga0307408_1000338622 | 262 |
| 52 | 3300031731 | Ga0307405_10139645 | Ga0307405_101396452 | 262 |
| 53 | 3300031852 | Ga0307410_10019956 | Ga0307410_100199563 | 262 |
| 54 | 3300031901 | Ga0307406_10118761 | Ga0307406_101187611 | 262 |
| 55 | 3300031995 | Ga0307409_100010012 | Ga0307409_1000100122 | 262 |
| 56 | 3300032002 | Ga0307416_100064039 | Ga0307416_1000640393 | 262 |
| 57 | 3300032004 | Ga0307414_10007243 | Ga0307414_100072436 | 262 |
| 58 | 3300032005 | Ga0307411_10002260 | Ga0307411_100022607 | 262 |
| 59 | 3300025932 | Ga0207690_10367689 | Ga0207690_103676891 | 263 |
| 60 | 3300005344 | Ga0070661_100178520 | Ga0070661_1001785202 | 264 |
| 61 | 3300005616 | Ga0068852_100120637 | Ga0068852_1001206372 | 264 |
| 62 | 3300009177 | Ga0105248_10162882 | Ga0105248_101628823 | 264 |
| 63 | 3300025920 | Ga0207649_10142504 | Ga0207649_101425042 | 264 |
| 64 | 3300026142 | Ga0207698_10457749 | Ga0207698_104577491 | 264 |
| 65 | 3300030735 | Ga0316178_1168699 | Ga0316178_11686992 | 264 |
| 66 | 3300030745 | Ga0316182_1387698 | Ga0316182_13876981 | 264 |
| 67 | 3300031247 | Ga0265340_10079011 | Ga0265340_100790111 | 264 |
| 68 | 3300037471 | Ga0395905_0293561 | Ga0395905_0293561_84_980 | 264 |
| 69 | 3300048907 | Ga0496104_0121111 | Ga0496104_0121111_866_1762 | 264 |
| 70 | 3300048910 | Ga0496107_0072201 | Ga0496107_0072201_661_1557 | 264 |
| 71 | 3300048911 | Ga0496108_0020819 | Ga0496108_0020819_2650_3546 | 264 |
| 72 | 3300005355 | Ga0070671_100006923 | Ga0070671_1000069232 | 265 |
| 73 | 3300005364 | Ga0070673_100076910 | Ga0070673_1000769102 | 265 |
| 74 | 3300005546 | Ga0070696_100081711 | Ga0070696_1000817111 | 265 |
| 75 | 3300005614 | Ga0068856_100267674 | Ga0068856_1002676742 | 265 |
| 76 | 3300025909 | Ga0207705_10146259 | Ga0207705_101462592 | 265 |
| 77 | 3300025931 | Ga0207644_10337446 | Ga0207644_103374462 | 265 |
| 78 | 3300025945 | Ga0207679_10275643 | Ga0207679_102756432 | 265 |
| 79 | 3300026078 | Ga0207702_10157677 | Ga0207702_101576772 | 265 |
| 80 | 3300031995 | Ga0307409_100158193 | Ga0307409_1001581932 | 265 |
| 81 | 3300048912 | Ga0496109_0110016 | Ga0496109_0110016_459_1355 | 265 |
| 82 | 3300048915 | Ga0496112_0232583 | Ga0496112_0232583_117_1013 | 265 |
| 83 | 3300048916 | Ga0496113_0009265 | Ga0496113_0009265_4738_5634 | 265 |
| 84 | 3300005577 | Ga0068857_100474732 | Ga0068857_1004747321 | 266 |
| 85 | 3300026116 | Ga0207674_10029229 | Ga0207674_100292295 | 266 |
| 86 | 3300031852 | Ga0307410_10087526 | Ga0307410_100875262 | 266 |
| 87 | 3300031901 | Ga0307406_10087925 | Ga0307406_100879252 | 266 |
| 88 | 3300031995 | Ga0307409_100002852 | Ga0307409_1000028527 | 266 |
| 89 | 3300032002 | Ga0307416_100037845 | Ga0307416_1000378454 | 266 |
| 90 | 3300032002 | Ga0307416_100048026 | Ga0307416_1000480264 | 266 |
| 91 | 3300032005 | Ga0307411_10008973 | Ga0307411_100089734 | 266 |
| 92 | 3300032126 | Ga0307415_100001978 | Ga0307415_1000019786 | 266 |
| 93 | 3300037312 | Ga0395899_0151559 | Ga0395899_0151559_365_1249 | 266 |
| 94 | 3300037418 | Ga0395900_0116863 | Ga0395900_0116863_995_1879 | 266 |
| 95 | 3300037471 | Ga0395905_0006908 | Ga0395905_0006908_5421_6305 | 266 |
| 96 | 3300005290 | Ga0065712_10069297 | Ga0065712_100692977 | 267 |
| 97 | 3300005327 | Ga0070658_10126755 | Ga0070658_101267551 | 267 |
| 98 | 3300005328 | Ga0070676_10089495 | Ga0070676_100894952 | 267 |
| 99 | 3300005331 | Ga0070670_100035826 | Ga0070670_1000358262 | 267 |
| 100 | 3300005353 | Ga0070669_100015137 | Ga0070669_1000151375 | 267 |
| 101 | 3300005354 | Ga0070675_100000380 | Ga0070675_10000038021 | 267 |
| 102 | 3300005354 | Ga0070675_100179332 | Ga0070675_1001793322 | 267 |
| 103 | 3300005355 | Ga0070671_100002491 | Ga0070671_1000024918 | 267 |
| 104 | 3300005364 | Ga0070673_100003514 | Ga0070673_1000035144 | 267 |
| 105 | 3300005367 | Ga0070667_100099763 | Ga0070667_1000997633 | 267 |
| 106 | 3300005456 | Ga0070678_100132660 | Ga0070678_1001326602 | 267 |
| 107 | 3300005458 | Ga0070681_10117278 | Ga0070681_101172784 | 267 |
| 108 | 3300005543 | Ga0070672_100000401 | Ga0070672_1000004013 | 267 |
| 109 | 3300005564 | Ga0070664_100001285 | Ga0070664_10000128511 | 267 |
| 110 | 3300005618 | Ga0068864_100009524 | Ga0068864_1000095245 | 267 |
| 111 | 3300009093 | Ga0105240_10016799 | Ga0105240_100167994 | 267 |
| 112 | 3300009177 | Ga0105248_10008414 | Ga0105248_100084143 | 267 |
| 113 | 3300013308 | Ga0157375_10236632 | Ga0157375_102366321 | 267 |
| 114 | 3300025315 | Ga0207697_10049901 | Ga0207697_100499012 | 267 |
| 115 | 3300025909 | Ga0207705_10028470 | Ga0207705_100284705 | 267 |
| 116 | 3300025919 | Ga0207657_10142106 | Ga0207657_101421062 | 267 |
| 117 | 3300025925 | Ga0207650_10009234 | Ga0207650_100092344 | 267 |
| 118 | 3300025926 | Ga0207659_10003335 | Ga0207659_100033355 | 267 |
| 119 | 3300025931 | Ga0207644_10010946 | Ga0207644_100109467 | 267 |
| 120 | 3300025933 | Ga0207706_10028498 | Ga0207706_100284984 | 267 |
| 121 | 3300025940 | Ga0207691_10002386 | Ga0207691_1000238613 | 267 |
| 122 | 3300025945 | Ga0207679_10181088 | Ga0207679_101810882 | 267 |
| 123 | 3300025960 | Ga0207651_10004130 | Ga0207651_100041304 | 267 |
| 124 | 3300025960 | Ga0207651_10354207 | Ga0207651_103542072 | 267 |
| 125 | 3300025986 | Ga0207658_10011302 | Ga0207658_100113024 | 267 |
| 126 | 3300026088 | Ga0207641_10266337 | Ga0207641_102663372 | 267 |
| 127 | 3300026095 | Ga0207676_10009599 | Ga0207676_100095992 | 267 |
| 128 | 3300026121 | Ga0207683_10309319 | Ga0207683_103093192 | 267 |
| 129 | 3300028379 | Ga0268266_10167805 | Ga0268266_101678052 | 267 |
| 130 | 3300048911 | Ga0496108_0038501 | Ga0496108_0038501_2309_3190 | 267 |
| 131 | 3300048911 | Ga0496108_0175419 | Ga0496108_0175419_653_1597 | 267 |
| 132 | 3300048913 | Ga0496110_0003535 | Ga0496110_0003535_8419_9363 | 267 |
| 133 | 3300048914 | Ga0496111_0005304 | Ga0496111_0005304_553_1497 | 267 |
| 134 | 3300048917 | Ga0496114_0078337 | Ga0496114_0078337_578_1522 | 267 |
| 135 | 3300049742 | Ga0501080_0092654 | Ga0501080_0092654_88_984 | 267 |
| 136 | 3300005355 | Ga0070671_100071986 | Ga0070671_1000719862 | 268 |
| 137 | 3300005367 | Ga0070667_100006124 | Ga0070667_1000061247 | 268 |
| 138 | 3300005842 | Ga0068858_100053586 | Ga0068858_1000535864 | 268 |
| 139 | 3300009177 | Ga0105248_10011081 | Ga0105248_100110817 | 268 |
| 140 | 3300013306 | Ga0163162_10126156 | Ga0163162_101261562 | 268 |
| 141 | 3300014968 | Ga0157379_10026063 | Ga0157379_100260634 | 268 |
| 142 | 3300017792 | Ga0163161_10176357 | Ga0163161_101763572 | 268 |
| 143 | 3300025893 | Ga0207682_10028524 | Ga0207682_100285242 | 268 |
| 144 | 3300025931 | Ga0207644_10061295 | Ga0207644_100612953 | 268 |
| 145 | 3300025941 | Ga0207711_10002664 | Ga0207711_100026647 | 268 |
| 146 | 3300025986 | Ga0207658_10049154 | Ga0207658_100491543 | 268 |
| 147 | 3300031852 | Ga0307410_10199145 | Ga0307410_101991452 | 268 |
| 148 | 3300048910 | Ga0496107_0039128 | Ga0496107_0039128_1120_2001 | 268 |
| 149 | 3300005344 | Ga0070661_100375362 | Ga0070661_1003753622 | 269 |
| 150 | 3300025912 | Ga0207707_10188967 | Ga0207707_101889671 | 269 |
| 151 | 3300025925 | Ga0207650_10245184 | Ga0207650_102451842 | 269 |
| 152 | 3300026095 | Ga0207676_10252572 | Ga0207676_102525722 | 269 |
| 153 | 3300025919 | Ga0207657_10083270 | Ga0207657_100832702 | 270 |
| 154 | 3300037312 | Ga0395899_0137997 | Ga0395899_0137997_249_1133 | 270 |
| 155 | 3300037418 | Ga0395900_0158155 | Ga0395900_0158155_285_1169 | 270 |
| 156 | 3300038443 | Ga0395901_0102171 | Ga0395901_0102171_615_1499 | 270 |
| 157 | 3300005293 | Ga0065715_10110657 | Ga0065715_101106573 | 271 |
| 158 | 3300005844 | Ga0068862_100123182 | Ga0068862_1001231822 | 271 |
| 159 | 3300025923 | Ga0207681_10083015 | Ga0207681_100830152 | 271 |
| 160 | 3300025945 | Ga0207679_10033866 | Ga0207679_100338663 | 271 |
| 161 | 3300005455 | Ga0070663_100073024 | Ga0070663_1000730242 | 272 |
| 162 | 3300005457 | Ga0070662_100163717 | Ga0070662_1001637171 | 272 |
| 163 | 3300005535 | Ga0070684_100433725 | Ga0070684_1004337251 | 272 |
| 164 | 3300005546 | Ga0070696_100282808 | Ga0070696_1002828082 | 272 |
| 165 | 3300005547 | Ga0070693_100110580 | Ga0070693_1001105802 | 272 |
| 166 | 3300005563 | Ga0068855_100076372 | Ga0068855_1000763725 | 272 |
| 167 | 3300005564 | Ga0070664_100245768 | Ga0070664_1002457682 | 272 |
| 168 | 3300005577 | Ga0068857_100308596 | Ga0068857_1003085962 | 272 |
| 169 | 3300013307 | Ga0157372_10370242 | Ga0157372_103702422 | 272 |
| 170 | 3300025919 | Ga0207657_10039090 | Ga0207657_100390902 | 272 |
| 171 | 3300025921 | Ga0207652_10214846 | Ga0207652_102148461 | 272 |
| 172 | 3300025933 | Ga0207706_10003005 | Ga0207706_100030052 | 272 |
| 173 | 3300025944 | Ga0207661_10406988 | Ga0207661_104069881 | 272 |
| 174 | 3300025945 | Ga0207679_10279870 | Ga0207679_102798702 | 272 |
| 175 | 3300025949 | Ga0207667_10795795 | Ga0207667_107957951 | 272 |
| 176 | 3300026041 | Ga0207639_10234882 | Ga0207639_102348822 | 272 |
| 177 | 3300026067 | Ga0207678_10001633 | Ga0207678_1000163316 | 272 |
| 178 | 3300026116 | Ga0207674_10014458 | Ga0207674_100144584 | 272 |
| 179 | 3300031548 | Ga0307408_100236124 | Ga0307408_1002361241 | 272 |
| 180 | 3300031901 | Ga0307406_10006681 | Ga0307406_100066816 | 272 |
| 181 | 3300046492 | Ga0495585_0016914 | Ga0495585_0016914_1716_2612 | 272 |
| 182 | 3300046525 | Ga0495663_0001307 | Ga0495663_0001307_1507_2403 | 272 |
| 183 | 3300046537 | Ga0495598_0000568 | Ga0495598_0000568_3199_4095 | 272 |
| 184 | 3300046539 | Ga0495621_0000404 | Ga0495621_0000404_8277_9173 | 272 |
| 185 | 3300046684 | Ga0495669_0018394 | Ga0495669_0018394_761_1657 | 272 |
| 186 | 3300046691 | Ga0495670_0022310 | Ga0495670_0022310_2084_2980 | 272 |
| 187 | 3300005333 | Ga0070677_10000547 | Ga0070677_1000054711 | 273 |
| 188 | 3300013100 | Ga0157373_10064429 | Ga0157373_100644291 | 273 |
| 189 | 3300025893 | Ga0207682_10001617 | Ga0207682_100016177 | 273 |
| 190 | 3300037471 | Ga0395905_0030386 | Ga0395905_0030386_129_1031 | 273 |
| 191 | 3300048907 | Ga0496104_0221199 | Ga0496104_0221199_60_881 | 273 |
| 192 | 3300005336 | Ga0070680_100383079 | Ga0070680_1003830791 | 274 |
| 193 | 3300005354 | Ga0070675_100014114 | Ga0070675_1000141142 | 274 |
| 194 | 3300005530 | Ga0070679_100456446 | Ga0070679_1004564462 | 274 |
| 195 | 3300014326 | Ga0157380_10063252 | Ga0157380_100632524 | 274 |
| 196 | 3300025917 | Ga0207660_10077266 | Ga0207660_100772662 | 274 |
| 197 | 3300025920 | Ga0207649_10075986 | Ga0207649_100759862 | 274 |
| 198 | 3300025921 | Ga0207652_10315854 | Ga0207652_103158542 | 274 |
| 199 | 3300026067 | Ga0207678_10012511 | Ga0207678_100125114 | 274 |
| 200 | 3300031731 | Ga0307405_10062318 | Ga0307405_100623182 | 274 |
| 201 | 3300031852 | Ga0307410_10051451 | Ga0307410_100514513 | 274 |
| 202 | 3300032002 | Ga0307416_100375022 | Ga0307416_1003750221 | 274 |
| 203 | 3300037418 | Ga0395900_0109319 | Ga0395900_0109319_1821_2723 | 274 |
| 204 | 3300037471 | Ga0395905_0010343 | Ga0395905_0010343_6008_6910 | 274 |
| 205 | 3300038443 | Ga0395901_0059649 | Ga0395901_0059649_1428_2330 | 274 |
| 206 | 3300046525 | Ga0495663_0079348 | Ga0495663_0079348_69_971 | 274 |
| 207 | 3300046684 | Ga0495669_0011176 | Ga0495669_0011176_2721_3623 | 274 |
| 208 | 3300047445 | Ga0495677_0007606 | Ga0495677_0007606_558_1460 | 274 |
| 209 | 3300005327 | Ga0070658_10021651 | Ga0070658_100216517 | 275 |
| 210 | 3300005455 | Ga0070663_100363558 | Ga0070663_1003635581 | 275 |
| 211 | 3300005844 | Ga0068862_100045490 | Ga0068862_1000454902 | 275 |
| 212 | 3300025909 | Ga0207705_10015458 | Ga0207705_100154584 | 275 |
| 213 | 3300046660 | Ga0495625_0093176 | Ga0495625_0093176_569_1471 | 275 |
| 214 | 3300046684 | Ga0495669_0014007 | Ga0495669_0014007_1812_2714 | 275 |
| 215 | 3300031852 | Ga0307410_10321817 | Ga0307410_103218172 | 276 |
| 216 | 3300032004 | Ga0307414_10007417 | Ga0307414_100074175 | 276 |
| 217 | 3300032005 | Ga0307411_10034037 | Ga0307411_100340373 | 276 |
| 218 | 3300037312 | Ga0395899_0001765 | Ga0395899_0001765_13009_13920 | 276 |
| 219 | 3300037418 | Ga0395900_0036015 | Ga0395900_0036015_129_1040 | 276 |
| 220 | 3300037466 | Ga0395898_0019395 | Ga0395898_0019395_292_1203 | 276 |
| 221 | 3300046616 | Ga0495668_0014504 | Ga0495668_0014504_2502_3401 | 276 |
| 222 | 3300048908 | Ga0496105_0074714 | Ga0496105_0074714_1173_2003 | 276 |
| 223 | 3300005338 | Ga0068868_100375728 | Ga0068868_1003757281 | 277 |
| 224 | 3300005355 | Ga0070671_100040797 | Ga0070671_1000407973 | 277 |
| 225 | 3300005841 | Ga0068863_100284247 | Ga0068863_1002842472 | 277 |
| 226 | 3300009177 | Ga0105248_10079091 | Ga0105248_100790914 | 277 |
| 227 | 3300013308 | Ga0157375_10102672 | Ga0157375_101026722 | 277 |
| 228 | 3300025941 | Ga0207711_10005655 | Ga0207711_100056559 | 277 |
| 229 | 3300028381 | Ga0268264_10110989 | Ga0268264_101109892 | 277 |
| 230 | 3300031995 | Ga0307409_100005778 | Ga0307409_1000057783 | 277 |
| 231 | 3300053134 | Ga0500658_0000188 | Ga0500658_0000188_19530_20429 | 277 |
| 232 | 3300005367 | Ga0070667_100038001 | Ga0070667_1000380015 | 278 |
| 233 | 3300025986 | Ga0207658_10026494 | Ga0207658_100264945 | 278 |
| 234 | 3300037471 | Ga0395905_0103973 | Ga0395905_0103973_143_1036 | 278 |
| 235 | 3300005985 | Ga0081539_10005679 | Ga0081539_100056795 | 279 |
| 236 | 3300005353 | Ga0070669_100068031 | Ga0070669_1000680313 | 280 |
| 237 | 3300005353 | Ga0070669_100123649 | Ga0070669_1001236492 | 280 |
| 238 | 3300005355 | Ga0070671_100074520 | Ga0070671_1000745203 | 280 |
| 239 | 3300005364 | Ga0070673_100303492 | Ga0070673_1003034922 | 280 |
| 240 | 3300005367 | Ga0070667_100014701 | Ga0070667_1000147012 | 280 |
| 241 | 3300005367 | Ga0070667_100016074 | Ga0070667_1000160746 | 280 |
| 242 | 3300005539 | Ga0068853_100307453 | Ga0068853_1003074532 | 280 |
| 243 | 3300005548 | Ga0070665_100008011 | Ga0070665_1000080116 | 280 |
| 244 | 3300005617 | Ga0068859_100062592 | Ga0068859_1000625923 | 280 |
| 245 | 3300005618 | Ga0068864_100000152 | Ga0068864_10000015213 | 280 |
| 246 | 3300005841 | Ga0068863_100070983 | Ga0068863_1000709834 | 280 |
| 247 | 3300005842 | Ga0068858_100002589 | Ga0068858_10000258919 | 280 |
| 248 | 3300005843 | Ga0068860_100065858 | Ga0068860_1000658583 | 280 |
| 249 | 3300006931 | Ga0097620_100062593 | Ga0097620_1000625933 | 280 |
| 250 | 3300009092 | Ga0105250_10012615 | Ga0105250_100126153 | 280 |
| 251 | 3300009101 | Ga0105247_10125397 | Ga0105247_101253972 | 280 |
| 252 | 3300009177 | Ga0105248_10004459 | Ga0105248_1000445916 | 280 |
| 253 | 3300011119 | Ga0105246_10200788 | Ga0105246_102007882 | 280 |
| 254 | 3300013306 | Ga0163162_10079445 | Ga0163162_100794453 | 280 |
| 255 | 3300013308 | Ga0157375_10596993 | Ga0157375_105969932 | 280 |
| 256 | 3300014325 | Ga0163163_10060285 | Ga0163163_100602852 | 280 |
| 257 | 3300014968 | Ga0157379_10017112 | Ga0157379_100171122 | 280 |
| 258 | 3300025711 | Ga0207696_1026986 | Ga0207696_10269862 | 280 |
| 259 | 3300025923 | Ga0207681_10019084 | Ga0207681_100190843 | 280 |
| 260 | 3300025923 | Ga0207681_10054803 | Ga0207681_100548032 | 280 |
| 261 | 3300025923 | Ga0207681_10311369 | Ga0207681_103113692 | 280 |
| 262 | 3300025931 | Ga0207644_10033629 | Ga0207644_100336293 | 280 |
| 263 | 3300025940 | Ga0207691_10067292 | Ga0207691_100672922 | 280 |
| 264 | 3300025941 | Ga0207711_10050893 | Ga0207711_100508934 | 280 |
| 265 | 3300025960 | Ga0207651_10075295 | Ga0207651_100752952 | 280 |
| 266 | 3300025986 | Ga0207658_10010816 | Ga0207658_100108162 | 280 |
| 267 | 3300025986 | Ga0207658_10024130 | Ga0207658_100241304 | 280 |
| 268 | 3300026035 | Ga0207703_10051763 | Ga0207703_100517634 | 280 |
| 269 | 3300026041 | Ga0207639_10403015 | Ga0207639_104030152 | 280 |
| 270 | 3300026088 | Ga0207641_10074036 | Ga0207641_100740364 | 280 |
| 271 | 3300026095 | Ga0207676_10020940 | Ga0207676_100209402 | 280 |
| 272 | 3300026118 | Ga0207675_100235889 | Ga0207675_1002358892 | 280 |
| 273 | 3300028379 | Ga0268266_10014446 | Ga0268266_100144465 | 280 |
| 274 | 3300028380 | Ga0268265_10137495 | Ga0268265_101374952 | 280 |
| 275 | 3300028381 | Ga0268264_10000755 | Ga0268264_1000075537 | 280 |
| 276 | 3300031824 | Ga0307413_10440180 | Ga0307413_104401801 | 280 |
| 277 | 3300032005 | Ga0307411_10002078 | Ga0307411_100020787 | 280 |
| 278 | 3300005339 | Ga0070660_100198540 | Ga0070660_1001985402 | 281 |
| 279 | 3300005467 | Ga0070706_100506810 | Ga0070706_1005068102 | 281 |
| 280 | 3300005545 | Ga0070695_100013514 | Ga0070695_1000135146 | 281 |
| 281 | 3300005546 | Ga0070696_100010639 | Ga0070696_1000106394 | 281 |
| 282 | 3300005578 | Ga0068854_100068743 | Ga0068854_1000687432 | 281 |
| 283 | 3300009094 | Ga0111539_10014044 | Ga0111539_100140443 | 281 |
| 284 | 3300025933 | Ga0207706_10041020 | Ga0207706_100410202 | 281 |
| 285 | 3300042142 | Ga0450905_003838 | Ga0450905_003838_998_1876 | 281 |
| 286 | 3300042144 | Ga0450889_001229 | Ga0450889_001229_180_1058 | 281 |
| 287 | 3300048909 | Ga0496106_0336052 | Ga0496106_0336052_163_1059 | 281 |
| 288 | 3300050511 | nmdc:mga08y16_86986_c1 | nmdc:mga08y16_86986_c1_1057_1935 | 281 |
| 289 | 3300026035 | Ga0207703_10094336 | Ga0207703_100943363 | 283 |
| 290 | 3300005841 | Ga0068863_100039595 | Ga0068863_1000395952 | 284 |
| 291 | 3300025972 | Ga0207668_10011258 | Ga0207668_100112583 | 284 |
| 292 | 3300026088 | Ga0207641_10010409 | Ga0207641_100104097 | 284 |
| 293 | 3300037471 | Ga0395905_0153837 | Ga0395905_0153837_331_1209 | 284 |
| 294 | 3300006914 | Ga0075436_100125941 | Ga0075436_1001259412 | 285 |
| 295 | 3300032002 | Ga0307416_100360779 | Ga0307416_1003607792 | 285 |
| 296 | 3300032004 | Ga0307414_10207388 | Ga0307414_102073882 | 285 |
| 297 | 3300032126 | Ga0307415_100401440 | Ga0307415_1004014402 | 285 |
| 298 | 3300050514 | nmdc:mga08x19_115331_c1 | nmdc:mga08x19_115331_c1_739_1629 | 285 |
| 299 | 3300026121 | Ga0207683_10083439 | Ga0207683_100834393 | 287 |
| 300 | 3300005338 | Ga0068868_100071434 | Ga0068868_1000714342 | 292 |
| 301 | 3300005339 | Ga0070660_100029516 | Ga0070660_1000295162 | 292 |
| 302 | 3300005444 | Ga0070694_100347886 | Ga0070694_1003478861 | 292 |
| 303 | 3300005543 | Ga0070672_100049508 | Ga0070672_1000495084 | 292 |
| 304 | 3300005549 | Ga0070704_100408558 | Ga0070704_1004085581 | 292 |
| 305 | 3300005577 | Ga0068857_100070189 | Ga0068857_1000701892 | 292 |
| 306 | 3300005577 | Ga0068857_100424847 | Ga0068857_1004248471 | 292 |
| 307 | 3300005578 | Ga0068854_100285809 | Ga0068854_1002858092 | 292 |
| 308 | 3300005617 | Ga0068859_100093335 | Ga0068859_1000933353 | 292 |
| 309 | 3300005842 | Ga0068858_100151542 | Ga0068858_1001515422 | 292 |
| 310 | 3300005843 | Ga0068860_100006380 | Ga0068860_1000063801 | 292 |
| 311 | 3300005844 | Ga0068862_100265378 | Ga0068862_1002653781 | 292 |
| 312 | 3300006931 | Ga0097620_100093337 | Ga0097620_1000933373 | 292 |
| 313 | 3300007076 | Ga0075435_100277370 | Ga0075435_1002773702 | 292 |
| 314 | 3300009098 | Ga0105245_10200777 | Ga0105245_102007772 | 292 |
| 315 | 3300009148 | Ga0105243_10096796 | Ga0105243_100967962 | 292 |
| 316 | 3300009553 | Ga0105249_10014236 | Ga0105249_100142365 | 292 |
| 317 | 3300011119 | Ga0105246_10092430 | Ga0105246_100924302 | 292 |
| 318 | 3300013308 | Ga0157375_10084276 | Ga0157375_100842763 | 292 |
| 319 | 3300014968 | Ga0157379_10425851 | Ga0157379_104258512 | 292 |
| 320 | 3300025904 | Ga0207647_10005912 | Ga0207647_100059126 | 292 |
| 321 | 3300025919 | Ga0207657_10007694 | Ga0207657_100076943 | 292 |
| 322 | 3300025923 | Ga0207681_10014286 | Ga0207681_100142864 | 292 |
| 323 | 3300025932 | Ga0207690_10008144 | Ga0207690_100081443 | 292 |
| 324 | 3300025934 | Ga0207686_10191116 | Ga0207686_101911162 | 292 |
| 325 | 3300025942 | Ga0207689_10056646 | Ga0207689_100566462 | 292 |
| 326 | 3300025949 | Ga0207667_10032087 | Ga0207667_100320872 | 292 |
| 327 | 3300025961 | Ga0207712_10000940 | Ga0207712_1000094019 | 292 |
| 328 | 3300026035 | Ga0207703_10226686 | Ga0207703_102266862 | 292 |
| 329 | 3300026116 | Ga0207674_10232840 | Ga0207674_102328402 | 292 |
| 330 | 3300026118 | Ga0207675_100326829 | Ga0207675_1003268292 | 292 |
| 331 | 3300028380 | Ga0268265_10084320 | Ga0268265_100843202 | 292 |
| 332 | 3300028380 | Ga0268265_10188580 | Ga0268265_101885802 | 292 |
| 333 | 3300028381 | Ga0268264_10000379 | Ga0268264_1000037936 | 292 |
| 334 | 3300001976 | JGI24752J21851_1003129 | JGI24752J21851_10031291 | 294 |
| 335 | 3300005344 | Ga0070661_100036822 | Ga0070661_1000368223 | 294 |
| 336 | 3300005355 | Ga0070671_100004296 | Ga0070671_1000042963 | 294 |
| 337 | 3300005367 | Ga0070667_100018347 | Ga0070667_1000183472 | 294 |
| 338 | 3300005457 | Ga0070662_100204855 | Ga0070662_1002048552 | 294 |
| 339 | 3300005563 | Ga0068855_100354011 | Ga0068855_1003540112 | 294 |
| 340 | 3300005564 | Ga0070664_100027045 | Ga0070664_1000270454 | 294 |
| 341 | 3300005577 | Ga0068857_100043351 | Ga0068857_1000433512 | 294 |
| 342 | 3300005614 | Ga0068856_100192820 | Ga0068856_1001928202 | 294 |
| 343 | 3300005616 | Ga0068852_100325354 | Ga0068852_1003253542 | 294 |
| 344 | 3300005617 | Ga0068859_100044585 | Ga0068859_1000445852 | 294 |
| 345 | 3300005618 | Ga0068864_100007919 | Ga0068864_1000079197 | 294 |
| 346 | 3300005834 | Ga0068851_10069742 | Ga0068851_100697422 | 294 |
| 347 | 3300005841 | Ga0068863_100011024 | Ga0068863_1000110245 | 294 |
| 348 | 3300005842 | Ga0068858_100015237 | Ga0068858_1000152376 | 294 |
| 349 | 3300006931 | Ga0097620_100044585 | Ga0097620_1000445852 | 294 |
| 350 | 3300009545 | Ga0105237_10169421 | Ga0105237_101694212 | 294 |
| 351 | 3300014325 | Ga0163163_10360134 | Ga0163163_103601342 | 294 |
| 352 | 3300014968 | Ga0157379_10011613 | Ga0157379_100116133 | 294 |
| 353 | 3300025904 | Ga0207647_10021665 | Ga0207647_100216654 | 294 |
| 354 | 3300025920 | Ga0207649_10340985 | Ga0207649_103409852 | 294 |
| 355 | 3300025931 | Ga0207644_10053775 | Ga0207644_100537752 | 294 |
| 356 | 3300025933 | Ga0207706_10220299 | Ga0207706_102202992 | 294 |
| 357 | 3300025949 | Ga0207667_10382256 | Ga0207667_103822562 | 294 |
| 358 | 3300025986 | Ga0207658_10035658 | Ga0207658_100356583 | 294 |
| 359 | 3300026078 | Ga0207702_10070218 | Ga0207702_100702184 | 294 |
| 360 | 3300026088 | Ga0207641_10014279 | Ga0207641_100142793 | 294 |
| 361 | 3300026095 | Ga0207676_10065441 | Ga0207676_100654412 | 294 |
| 362 | 3300026116 | Ga0207674_10000060 | Ga0207674_100000605 | 294 |
| 363 | 3300026142 | Ga0207698_10216642 | Ga0207698_102166422 | 294 |
| 364 | 3300048905 | Ga0496102_0053641 | Ga0496102_0053641_2064_2948 | 294 |
| 365 | 3300048906 | Ga0496103_0062687 | Ga0496103_0062687_68_952 | 294 |
| 366 | 3300048913 | Ga0496110_0004390 | Ga0496110_0004390_7868_8752 | 294 |
| 367 | 3300048914 | Ga0496111_0080922 | Ga0496111_0080922_1330_2214 | 294 |
| 368 | 3300048915 | Ga0496112_0155611 | Ga0496112_0155611_1322_2206 | 294 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6ait-assembly1.cif.gz_A | crystal structure of e. coli bepa | 0.4971 | 95 | 283 |
| 2w2d-assembly1.cif.gz_B | crystal structure of a catalytically active, non-toxic endopeptidase derivative of clostridium botulinum toxin a | 0.323 | 181 | 290 |
| 1kny-assembly1.cif.gz_B | kanamycin nucleotidyltransferase | 0.3209 | 168 | 285 |
| 6ait-assembly1.cif.gz_A | crystal structure of e. coli bepa | 0.3185 | 95 | 283 |
| 5ecf-assembly1.cif.gz_A | ligand binding domain 1 of penicillium marneffei mp1 protein complexed with arachidonic acids | 0.3092 | 151 | 286 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P64429_1_283_3.40.390.10 | Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) | 0.793 | 1 | 290 | 3.40.390.10 |
| af_P64429_1_283_3.40.390.10 | Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) | 0.7823 | 1 | 290 | 3.40.390.10 |
| af_P9WL85_4_287_3.40.390.10 | Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) | 0.6553 | 10 | 290 | 3.40.390.10 |
| af_P9WL85_4_287_3.40.390.10 | Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) | 0.6299 | 10 | 290 | 3.40.390.10 |
| af_A0A1D8PF60_1_177_1.20.1270.60 | Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain | 0.513 | 207 | 285 | 1.20.1270.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D3K4L7-F1-model_v4 | Metalloprotease | 0.9601 | 91 | 222 |
GO:0006508
GO:0008237 GO:0016020 |
| AF-A0A4S0PXI0-F1-model_v4 | deleted | 0.9478 | 83 | 183 |
|
| AF-A0A536IGE2-F1-model_v4 | Metalloprotease | 0.9447 | 88 | 179 |
GO:0016020
|
| AF-A0A2J5P8F9-F1-model_v4 | Neutral zinc metallopeptidase | 0.9446 | 85 | 290 |
GO:0016020
|
| AF-A0A4Q2ZDX7-F1-model_v4 | Zinc metalloprotease | 0.9433 | 98 | 290 |
GO:0006508
GO:0008237 GO:0016020 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar