F424686

General Info

Members Datasets Scaffolds Average Seq Length
368 165 368 276

Family's Representative Sequence

Representative Sequence 3300009148|Ga0105243_10096796|Ga0105243_100967962
Length 297
Sequence MRLGGEPESGNFEDRTGQGSSGLGGMGGGNALGCLIPLVMSRFGLGGVVVLVIGYFLLSSLGVLGSGGGVLPGGSGQQQAVPAGKSTLDPNMREFLLRVLGSTEQTWGEIFAKSGARYEPTTMVAYSGGTQTACGLGQAAAGPFYCPNDTRVYIDPSFFNELSQRFGAPGDAAAAYVIAHEVGHHVQDLQGTLNQAHDLQARASKTEGNAVQVRVELQADCYAGVWAASAHDSQGSILEPGDAQEALRAAEAVGDDTLQKQAQGYVVPDSFTHGTSAERMAAFQRGLKGASLAACKF

Samples

Sample ID Description Type Environment
1 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
115 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
116 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
117 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
118 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
119 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
120 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
121 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
122 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
123 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
124 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
125 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
126 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
127 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
128 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
129 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
132 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
135 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
136 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
137 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
138 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
139 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
140 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
141 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
142 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
143 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
144 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
145 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
146 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
147 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
148 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
149 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
150 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
151 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
152 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
153 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
154 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
155 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
156 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
157 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
158 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
159 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
160 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
161 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
162 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
163 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
164 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
165 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.54
Nodule 0
Rhizoplane 5.43
Rhizosphere 94.02
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1003129 3300001976 Bacteria 2183
2 Ga0065712_10069297 3300005290 Bacteria 7578
3 Ga0065715_10110657 3300005293 Bacteria 2609
4 Ga0070658_10021651 3300005327 Bacteria 5152
5 Ga0070658_10126755 3300005327 Bacteria 2125
6 Ga0070676_10089495 3300005328 Bacteria 1883
7 Ga0070670_100035826 3300005331 Bacteria 4272
8 Ga0070677_10000547 3300005333 Bacteria 12846
9 Ga0070680_100173188 3300005336 Bacteria 1817
10 Ga0070680_100383079 3300005336 Bacteria 1197
11 Ga0070682_100138535 3300005337 Bacteria 1656
12 Ga0068868_100071434 3300005338 Bacteria 2768
13 Ga0068868_100375728 3300005338 Bacteria 1222
14 Ga0070660_100029516 3300005339 Bacteria 4110
15 Ga0070660_100198540 3300005339 Bacteria 1627
16 Ga0070661_100036822 3300005344 Bacteria 3556
17 Ga0070661_100178520 3300005344 Bacteria 1615
18 Ga0070661_100203364 3300005344 Bacteria 1514
19 Ga0070661_100375362 3300005344 Bacteria 1120
20 Ga0070669_100015137 3300005353 Bacteria 5495
21 Ga0070669_100068031 3300005353 Bacteria 2628
22 Ga0070669_100123649 3300005353 Bacteria 1977
23 Ga0070675_100000380 3300005354 Bacteria 30037
24 Ga0070675_100014114 3300005354 Bacteria 6295
25 Ga0070675_100179332 3300005354 Bacteria 1831
26 Ga0070671_100002491 3300005355 Bacteria 14250
27 Ga0070671_100004296 3300005355 Bacteria 11277
28 Ga0070671_100006923 3300005355 Bacteria 9082
29 Ga0070671_100040797 3300005355 Bacteria 3856
30 Ga0070671_100071986 3300005355 Bacteria 2886
31 Ga0070671_100074520 3300005355 Bacteria 2835
32 Ga0070674_100019243 3300005356 Bacteria 4335
33 Ga0070673_100003514 3300005364 Bacteria 9767
34 Ga0070673_100076910 3300005364 Bacteria 2696
35 Ga0070673_100303492 3300005364 Bacteria 1406
36 Ga0070667_100006124 3300005367 Bacteria 9995
37 Ga0070667_100014701 3300005367 Bacteria 6465
38 Ga0070667_100016074 3300005367 Bacteria 6190
39 Ga0070667_100018347 3300005367 Bacteria 5802
40 Ga0070667_100038001 3300005367 Bacteria 4037
41 Ga0070667_100099763 3300005367 Bacteria 2507
42 Ga0070694_100347886 3300005444 Bacteria 1147
43 Ga0070663_100073024 3300005455 Bacteria 2502
44 Ga0070663_100363558 3300005455 Bacteria 1174
45 Ga0070678_100132660 3300005456 Bacteria 1982
46 Ga0070662_100163717 3300005457 Bacteria 1741
47 Ga0070662_100204855 3300005457 Bacteria 1567
48 Ga0070681_10117278 3300005458 Bacteria 2598
49 Ga0070706_100506810 3300005467 Bacteria 1123
50 Ga0070698_100028180 3300005471 Bacteria 5836
51 Ga0070679_100093391 3300005530 Bacteria 2996
52 Ga0070679_100456446 3300005530 Bacteria 1222
53 Ga0070684_100433725 3300005535 Bacteria 1214
54 Ga0068853_100000814 3300005539 Bacteria 21767
55 Ga0068853_100001065 3300005539 Bacteria 19364
56 Ga0068853_100307453 3300005539 Bacteria 1467
57 Ga0070672_100000401 3300005543 Bacteria 25012
58 Ga0070672_100049508 3300005543 Bacteria 3269
59 Ga0070695_100013514 3300005545 Bacteria 4907
60 Ga0070696_100010639 3300005546 Bacteria 6161
61 Ga0070696_100081711 3300005546 Bacteria 2290
62 Ga0070696_100282808 3300005546 Bacteria 1265
63 Ga0070693_100110580 3300005547 Bacteria 1690
64 Ga0070665_100000024 3300005548 Bacteria 374559
65 Ga0070665_100008011 3300005548 Bacteria 10703
66 Ga0070704_100408558 3300005549 Bacteria 1160
67 Ga0068855_100076372 3300005563 Bacteria 3888
68 Ga0068855_100354011 3300005563 Bacteria 1617
69 Ga0070664_100001285 3300005564 Bacteria 20077
70 Ga0070664_100027045 3300005564 Bacteria 4765
71 Ga0070664_100245768 3300005564 Bacteria 1607
72 Ga0068857_100008055 3300005577 Bacteria 9088
73 Ga0068857_100043351 3300005577 Bacteria 3991
74 Ga0068857_100070189 3300005577 Bacteria 3120
75 Ga0068857_100308596 3300005577 Bacteria 1459
76 Ga0068857_100424847 3300005577 Bacteria 1239
77 Ga0068857_100474732 3300005577 Bacteria 1171
78 Ga0068854_100068743 3300005578 Bacteria 2583
79 Ga0068854_100285809 3300005578 Bacteria 1330
80 Ga0068856_100192820 3300005614 Bacteria 2051
81 Ga0068856_100267674 3300005614 Bacteria 1725
82 Ga0068852_100120637 3300005616 Bacteria 2400
83 Ga0068852_100325354 3300005616 Bacteria 1494
84 Ga0068859_100044585 3300005617 Bacteria 4456
85 Ga0068859_100062592 3300005617 Bacteria 3751
86 Ga0068859_100093335 3300005617 Bacteria 3061
87 Ga0068864_100000152 3300005618 Bacteria 64211
88 Ga0068864_100007919 3300005618 Bacteria 8754
89 Ga0068864_100009524 3300005618 Bacteria 8015
90 Ga0068851_10069742 3300005834 Bacteria 1816
91 Ga0068863_100011024 3300005841 Bacteria 8768
92 Ga0068863_100039595 3300005841 Bacteria 4484
93 Ga0068863_100070983 3300005841 Bacteria 3294
94 Ga0068863_100284247 3300005841 Bacteria 1603
95 Ga0068858_100002589 3300005842 Bacteria 18214
96 Ga0068858_100015237 3300005842 Bacteria 7232
97 Ga0068858_100053586 3300005842 Bacteria 3731
98 Ga0068858_100151542 3300005842 Bacteria 2180
99 Ga0068860_100006380 3300005843 Bacteria 11838
100 Ga0068860_100065858 3300005843 Bacteria 3440
101 Ga0068862_100045490 3300005844 Bacteria 3745
102 Ga0068862_100123182 3300005844 Bacteria 2287
103 Ga0068862_100265378 3300005844 Bacteria 1568
104 Ga0081539_10005679 3300005985 Bacteria 12518
105 Ga0075436_100125941 3300006914 Bacteria 1795
106 Ga0097620_100044585 3300006931 Bacteria 4456
107 Ga0097620_100062593 3300006931 Bacteria 3751
108 Ga0097620_100093337 3300006931 Bacteria 3061
109 Ga0075435_100277370 3300007076 Bacteria 1431
110 Ga0105250_10012615 3300009092 Bacteria 3484
111 Ga0105240_10016799 3300009093 Bacteria 9898
112 Ga0111539_10014044 3300009094 Bacteria 10007
113 Ga0105245_10200777 3300009098 Bacteria 1915
114 Ga0105247_10125397 3300009101 Bacteria 1668
115 Ga0105243_10096796 3300009148 Bacteria 2442
116 Ga0105242_10041396 3300009176 Bacteria 3716
117 Ga0105248_10004459 3300009177 Bacteria 15494
118 Ga0105248_10008414 3300009177 Bacteria 11324
119 Ga0105248_10011081 3300009177 Bacteria 9946
120 Ga0105248_10079091 3300009177 Bacteria 3695
121 Ga0105248_10162882 3300009177 Bacteria 2515
122 Ga0105237_10169421 3300009545 Bacteria 2183
123 Ga0105249_10014236 3300009553 Bacteria 7033
124 Ga0105246_10092430 3300011119 Bacteria 2183
125 Ga0105246_10200788 3300011119 Bacteria 1550
126 Ga0157373_10008046 3300013100 Bacteria 7836
127 Ga0157373_10064429 3300013100 Bacteria 2594
128 Ga0163162_10079445 3300013306 Bacteria 3347
129 Ga0163162_10126156 3300013306 Bacteria 2665
130 Ga0157372_10370242 3300013307 Bacteria 1669
131 Ga0157375_10084276 3300013308 Bacteria 3226
132 Ga0157375_10102672 3300013308 Bacteria 2945
133 Ga0157375_10236632 3300013308 Bacteria 1985
134 Ga0157375_10596993 3300013308 Bacteria 1263
135 Ga0163163_10060285 3300014325 Bacteria 3756
136 Ga0163163_10360134 3300014325 Bacteria 1511
137 Ga0157380_10063252 3300014326 Bacteria 2966
138 Ga0157379_10011613 3300014968 Bacteria 7690
139 Ga0157379_10017112 3300014968 Bacteria 6383
140 Ga0157379_10026063 3300014968 Bacteria 5201
141 Ga0157379_10425851 3300014968 Bacteria 1223
142 Ga0163161_10176357 3300017792 Bacteria 1636
143 Ga0207697_10049901 3300025315 Bacteria 1728
144 Ga0207696_1026986 3300025711 Bacteria 1774
145 Ga0207682_10001617 3300025893 Bacteria 10343
146 Ga0207682_10028524 3300025893 Bacteria 2228
147 Ga0207647_10005912 3300025904 Bacteria 8922
148 Ga0207647_10021665 3300025904 Bacteria 4285
149 Ga0207705_10015458 3300025909 Bacteria 5477
150 Ga0207705_10028470 3300025909 Bacteria 3983
151 Ga0207705_10146259 3300025909 Bacteria 1768
152 Ga0207707_10188967 3300025912 Bacteria 1797
153 Ga0207660_10077266 3300025917 Bacteria 2437
154 Ga0207657_10007694 3300025919 Bacteria 11011
155 Ga0207657_10039090 3300025919 Bacteria 4218
156 Ga0207657_10083270 3300025919 Bacteria 2684
157 Ga0207657_10142106 3300025919 Bacteria 1961
158 Ga0207649_10075986 3300025920 Bacteria 2160
159 Ga0207649_10142504 3300025920 Bacteria 1642
160 Ga0207649_10340985 3300025920 Bacteria 1106
161 Ga0207652_10214846 3300025921 Bacteria 1732
162 Ga0207652_10315854 3300025921 Bacteria 1410
163 Ga0207681_10014286 3300025923 Bacteria 4931
164 Ga0207681_10019084 3300025923 Bacteria 4329
165 Ga0207681_10054803 3300025923 Bacteria 2713
166 Ga0207681_10083015 3300025923 Bacteria 2267
167 Ga0207681_10311369 3300025923 Bacteria 1249
168 Ga0207650_10009234 3300025925 Bacteria 6738
169 Ga0207650_10245184 3300025925 Bacteria 1449
170 Ga0207659_10003335 3300025926 Bacteria 9629
171 Ga0207644_10010946 3300025931 Bacteria 5993
172 Ga0207644_10033629 3300025931 Bacteria 3585
173 Ga0207644_10053775 3300025931 Bacteria 2898
174 Ga0207644_10061295 3300025931 Bacteria 2724
175 Ga0207644_10337446 3300025931 Bacteria 1221
176 Ga0207690_10008144 3300025932 Bacteria 6220
177 Ga0207690_10300325 3300025932 Bacteria 1256
178 Ga0207690_10367689 3300025932 Bacteria 1140
179 Ga0207706_10000914 3300025933 Bacteria 30342
180 Ga0207706_10003005 3300025933 Bacteria 16255
181 Ga0207706_10028498 3300025933 Bacteria 4988
182 Ga0207706_10040796 3300025933 Bacteria 4115
183 Ga0207706_10041020 3300025933 Bacteria 4103
184 Ga0207706_10220299 3300025933 Bacteria 1661
185 Ga0207706_10662823 3300025933 Bacteria 893
186 Ga0207686_10023924 3300025934 Bacteria 3532
187 Ga0207686_10191116 3300025934 Bacteria 1459
188 Ga0207669_10020567 3300025937 Bacteria 3465
189 Ga0207691_10002386 3300025940 Bacteria 18370
190 Ga0207691_10067292 3300025940 Bacteria 3239
191 Ga0207711_10002664 3300025941 Bacteria 15787
192 Ga0207711_10005655 3300025941 Bacteria 10562
193 Ga0207711_10050893 3300025941 Bacteria 3547
194 Ga0207689_10056646 3300025942 Bacteria 3226
195 Ga0207661_10406988 3300025944 Bacteria 1234
196 Ga0207679_10033866 3300025945 Bacteria 3598
197 Ga0207679_10181088 3300025945 Bacteria 1743
198 Ga0207679_10275643 3300025945 Bacteria 1440
199 Ga0207679_10279870 3300025945 Bacteria 1430
200 Ga0207667_10032087 3300025949 Bacteria 5662
201 Ga0207667_10382256 3300025949 Bacteria 1434
202 Ga0207667_10795795 3300025949 Bacteria 942
203 Ga0207651_10004130 3300025960 Bacteria 7256
204 Ga0207651_10075295 3300025960 Bacteria 2408
205 Ga0207651_10354207 3300025960 Bacteria 1237
206 Ga0207712_10000940 3300025961 Bacteria 21021
207 Ga0207668_10011258 3300025972 Bacteria 5429
208 Ga0207640_10268323 3300025981 Bacteria 1334
209 Ga0207658_10010816 3300025986 Bacteria 6208
210 Ga0207658_10011302 3300025986 Bacteria 6079
211 Ga0207658_10024130 3300025986 Bacteria 4251
212 Ga0207658_10026494 3300025986 Bacteria 4065
213 Ga0207658_10035658 3300025986 Bacteria 3564
214 Ga0207658_10049154 3300025986 Bacteria 3097
215 Ga0207703_10051763 3300026035 Bacteria 3330
216 Ga0207703_10094336 3300026035 Bacteria 2522
217 Ga0207703_10226686 3300026035 Bacteria 1673
218 Ga0207639_10001556 3300026041 Bacteria 15378
219 Ga0207639_10234882 3300026041 Bacteria 1591
220 Ga0207639_10403015 3300026041 Bacteria 1233
221 Ga0207678_10001633 3300026067 Bacteria 20554
222 Ga0207678_10012511 3300026067 Bacteria 7452
223 Ga0207702_10070218 3300026078 Bacteria 3012
224 Ga0207702_10157677 3300026078 Bacteria 2070
225 Ga0207641_10010409 3300026088 Bacteria 7643
226 Ga0207641_10014279 3300026088 Bacteria 6508
227 Ga0207641_10074036 3300026088 Bacteria 2936
228 Ga0207641_10266337 3300026088 Bacteria 1606
229 Ga0207676_10009599 3300026095 Bacteria 6890
230 Ga0207676_10020940 3300026095 Bacteria 4792
231 Ga0207676_10065441 3300026095 Bacteria 2894
232 Ga0207676_10252572 3300026095 Bacteria 1588
233 Ga0207674_10000060 3300026116 Bacteria 112806
234 Ga0207674_10014458 3300026116 Bacteria 8715
235 Ga0207674_10029229 3300026116 Bacteria 5805
236 Ga0207674_10232840 3300026116 Bacteria 1790
237 Ga0207675_100235889 3300026118 Bacteria 1766
238 Ga0207675_100326829 3300026118 Bacteria 1498
239 Ga0207683_10083439 3300026121 Bacteria 2840
240 Ga0207683_10309319 3300026121 Bacteria 1446
241 Ga0207698_10216642 3300026142 Bacteria 1727
242 Ga0207698_10457749 3300026142 Bacteria 1233
243 Ga0209974_10003151 3300027876 Bacteria 5971
244 Ga0268266_10014446 3300028379 Bacteria 6788
245 Ga0268266_10167805 3300028379 Bacteria 1990
246 Ga0268265_10015055 3300028380 Bacteria 5282
247 Ga0268265_10084320 3300028380 Bacteria 2518
248 Ga0268265_10137495 3300028380 Bacteria 2040
249 Ga0268265_10188580 3300028380 Bacteria 1778
250 Ga0268264_10000379 3300028381 Bacteria 64925
251 Ga0268264_10000755 3300028381 Bacteria 36243
252 Ga0268264_10110989 3300028381 Bacteria 2402
253 Ga0316178_1168699 3300030735 Bacteria 1628
254 Ga0316182_1387698 3300030745 Bacteria 1108
255 Ga0265340_10079011 3300031247 Bacteria 1551
256 Ga0307408_100024840 3300031548 Bacteria 4097
257 Ga0307408_100033862 3300031548 Bacteria 3573
258 Ga0307408_100041723 3300031548 Bacteria 3254
259 Ga0307408_100236124 3300031548 Bacteria 1500
260 Ga0307405_10062318 3300031731 Bacteria 2361
261 Ga0307405_10074075 3300031731 Bacteria 2200
262 Ga0307405_10139645 3300031731 Bacteria 1687
263 Ga0307413_10017707 3300031824 Bacteria 3717
264 Ga0307413_10021220 3300031824 Bacteria 3472
265 Ga0307413_10336909 3300031824 Bacteria 1158
266 Ga0307413_10440180 3300031824 Bacteria 1032
267 Ga0307410_10019956 3300031852 Bacteria 4089
268 Ga0307410_10051451 3300031852 Bacteria 2776
269 Ga0307410_10057118 3300031852 Bacteria 2656
270 Ga0307410_10073430 3300031852 Bacteria 2378
271 Ga0307410_10087526 3300031852 Bacteria 2203
272 Ga0307410_10199145 3300031852 Bacteria 1528
273 Ga0307410_10321817 3300031852 Bacteria 1227
274 Ga0307406_10006681 3300031901 Bacteria 6378
275 Ga0307406_10020145 3300031901 Bacteria 3923
276 Ga0307406_10050813 3300031901 Bacteria 2630
277 Ga0307406_10087925 3300031901 Bacteria 2084
278 Ga0307406_10118761 3300031901 Bacteria 1834
279 Ga0307407_10070288 3300031903 Bacteria 2080
280 Ga0307412_10013048 3300031911 Bacteria 4858
281 Ga0307412_10063743 3300031911 Bacteria 2488
282 Ga0307409_100002852 3300031995 Bacteria 9149
283 Ga0307409_100005778 3300031995 Bacteria 7174
284 Ga0307409_100010012 3300031995 Bacteria 5862
285 Ga0307409_100069956 3300031995 Bacteria 2783
286 Ga0307409_100158193 3300031995 Bacteria 1978
287 Ga0307409_100520028 3300031995 Bacteria 1162
288 Ga0307416_100017702 3300032002 Bacteria 4994
289 Ga0307416_100037845 3300032002 Bacteria 3717
290 Ga0307416_100048026 3300032002 Bacteria 3383
291 Ga0307416_100064039 3300032002 Bacteria 3014
292 Ga0307416_100329038 3300032002 Bacteria 1534
293 Ga0307416_100360779 3300032002 Bacteria 1475
294 Ga0307416_100375022 3300032002 Bacteria 1450
295 Ga0307416_100600187 3300032002 Bacteria 1180
296 Ga0307414_10007243 3300032004 Bacteria 6230
297 Ga0307414_10007417 3300032004 Bacteria 6162
298 Ga0307414_10207388 3300032004 Bacteria 1599
299 Ga0307414_10278424 3300032004 Bacteria 1404
300 Ga0307411_10002078 3300032005 Bacteria 8620
301 Ga0307411_10002260 3300032005 Bacteria 8423
302 Ga0307411_10008973 3300032005 Bacteria 5222
303 Ga0307411_10034037 3300032005 Bacteria 3166
304 Ga0307411_10066008 3300032005 Bacteria 2429
305 Ga0307415_100001978 3300032126 Bacteria 10082
306 Ga0307415_100024001 3300032126 Bacteria 3799
307 Ga0307415_100032916 3300032126 Bacteria 3359
308 Ga0307415_100105831 3300032126 Bacteria 2075
309 Ga0307415_100401440 3300032126 Bacteria 1170
310 Ga0395899_0001765 3300037312 Bacteria 17978
311 Ga0395899_0137997 3300037312 Bacteria 1737
312 Ga0395899_0151559 3300037312 Bacteria 1643
313 Ga0395900_0036015 3300037418 Bacteria 5099
314 Ga0395900_0109319 3300037418 Bacteria 2840
315 Ga0395900_0116863 3300037418 Bacteria 2737
316 Ga0395900_0158155 3300037418 Bacteria 2313
317 Ga0395900_0460795 3300037418 Bacteria 1226
318 Ga0395898_0019395 3300037466 Bacteria 6921
319 Ga0395905_0006908 3300037471 Bacteria 11347
320 Ga0395905_0010343 3300037471 Bacteria 9081
321 Ga0395905_0030386 3300037471 Bacteria 5090
322 Ga0395905_0103973 3300037471 Bacteria 2666
323 Ga0395905_0153837 3300037471 Bacteria 2163
324 Ga0395905_0293561 3300037471 Bacteria 1512
325 Ga0395901_0059649 3300038443 Bacteria 3970
326 Ga0395901_0102171 3300038443 Bacteria 3008
327 Ga0450892_006191 3300042130 Bacteria 994
328 Ga0450905_003838 3300042142 Bacteria 1978
329 Ga0450889_001229 3300042144 Bacteria 2668
330 Ga0495585_0016914 3300046492 Bacteria 4224
331 Ga0495663_0001307 3300046525 Bacteria 7894
332 Ga0495663_0079348 3300046525 Bacteria 1055
333 Ga0495642_0008942 3300046528 Bacteria 3834
334 Ga0495598_0000568 3300046537 Bacteria 6943
335 Ga0495621_0000404 3300046539 Bacteria 10624
336 Ga0495668_0014504 3300046616 Bacteria 4618
337 Ga0495625_0093176 3300046660 Bacteria 2080
338 Ga0495647_0007996 3300046681 Bacteria 3555
339 Ga0495669_0011176 3300046684 Bacteria 3806
340 Ga0495669_0014007 3300046684 Bacteria 3426
341 Ga0495669_0018394 3300046684 Bacteria 3004
342 Ga0495670_0022310 3300046691 Bacteria 3125
343 Ga0495677_0007606 3300047445 Bacteria 4043
344 Ga0496102_0053641 3300048905 Bacteria 3674
345 Ga0496103_0062687 3300048906 Bacteria 2314
346 Ga0496104_0121111 3300048907 Bacteria 2512
347 Ga0496104_0221199 3300048907 Bacteria 1806
348 Ga0496105_0074714 3300048908 Bacteria 2800
349 Ga0496106_0336052 3300048909 Bacteria 1213
350 Ga0496107_0039128 3300048910 Bacteria 3402
351 Ga0496107_0072201 3300048910 Bacteria 2509
352 Ga0496108_0020819 3300048911 Bacteria 5393
353 Ga0496108_0038501 3300048911 Bacteria 3984
354 Ga0496108_0175419 3300048911 Bacteria 1855
355 Ga0496109_0110016 3300048912 Bacteria 2561
356 Ga0496110_0003535 3300048913 Bacteria 11999
357 Ga0496110_0004390 3300048913 Bacteria 10921
358 Ga0496111_0005304 3300048914 Bacteria 8234
359 Ga0496111_0080922 3300048914 Bacteria 2370
360 Ga0496112_0155611 3300048915 Bacteria 2252
361 Ga0496112_0232583 3300048915 Bacteria 1797
362 Ga0496113_0009265 3300048916 Bacteria 6460
363 Ga0496114_0078337 3300048917 Bacteria 2788
364 Ga0501080_0092654 3300049742 Bacteria 2806
365 nmdc:mga08y16_86986_c1 3300050511 Bacteria 3256
366 nmdc:mga08x19_115331_c1 3300050514 Bacteria 1795
367 Ga0500658_0000188 3300053134 Bacteria 29351
368 Ga0500636_0021725 3300053177 Bacteria 3799

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005471 Ga0070698_100028180 Ga0070698_1000281804 237
2 3300025933 Ga0207706_10662823 Ga0207706_106628231 237
3 3300031824 Ga0307413_10021220 Ga0307413_100212204 243
4 3300031852 Ga0307410_10057118 Ga0307410_100571182 243
5 3300031901 Ga0307406_10050813 Ga0307406_100508133 243
6 3300031995 Ga0307409_100069956 Ga0307409_1000699561 243
7 3300032002 Ga0307416_100600187 Ga0307416_1006001872 243
8 3300032004 Ga0307414_10278424 Ga0307414_102784242 243
9 3300032005 Ga0307411_10066008 Ga0307411_100660082 243
10 3300032126 Ga0307415_100032916 Ga0307415_1000329164 243
11 3300037418 Ga0395900_0460795 Ga0395900_0460795_136_918 244
12 3300053177 Ga0500636_0021725 Ga0500636_0021725_1323_2216 244
13 3300027876 Ga0209974_10003151 Ga0209974_100031512 246
14 3300031548 Ga0307408_100024840 Ga0307408_1000248404 246
15 3300031824 Ga0307413_10336909 Ga0307413_103369091 246
16 3300031901 Ga0307406_10020145 Ga0307406_100201455 246
17 3300031995 Ga0307409_100520028 Ga0307409_1005200282 246
18 3300032002 Ga0307416_100329038 Ga0307416_1003290381 246
19 3300032126 Ga0307415_100024001 Ga0307415_1000240014 246
20 3300005539 Ga0068853_100001065 Ga0068853_1000010659 247
21 3300013100 Ga0157373_10008046 Ga0157373_100080462 249
22 3300025933 Ga0207706_10000914 Ga0207706_1000091426 249
23 3300005336 Ga0070680_100173188 Ga0070680_1001731882 250
24 3300005577 Ga0068857_100008055 Ga0068857_1000080556 252
25 3300009176 Ga0105242_10041396 Ga0105242_100413963 255
26 3300025934 Ga0207686_10023924 Ga0207686_100239243 255
27 3300005356 Ga0070674_100019243 Ga0070674_1000192433 256
28 3300025937 Ga0207669_10020567 Ga0207669_100205673 256
29 3300025933 Ga0207706_10040796 Ga0207706_100407962 257
30 3300025981 Ga0207640_10268323 Ga0207640_102683232 257
31 3300028380 Ga0268265_10015055 Ga0268265_100150554 257
32 3300031548 Ga0307408_100041723 Ga0307408_1000417231 257
33 3300031731 Ga0307405_10074075 Ga0307405_100740752 257
34 3300031824 Ga0307413_10017707 Ga0307413_100177074 257
35 3300031852 Ga0307410_10073430 Ga0307410_100734302 257
36 3300031903 Ga0307407_10070288 Ga0307407_100702881 257
37 3300031911 Ga0307412_10013048 Ga0307412_100130485 257
38 3300032002 Ga0307416_100017702 Ga0307416_1000177027 257
39 3300032126 Ga0307415_100105831 Ga0307415_1001058311 257
40 3300042130 Ga0450892_006191 Ga0450892_006191_32_835 257
41 3300005548 Ga0070665_100000024 Ga0070665_100000024226 258
42 3300046528 Ga0495642_0008942 Ga0495642_0008942_912_1793 258
43 3300005344 Ga0070661_100203364 Ga0070661_1002033641 259
44 3300005539 Ga0068853_100000814 Ga0068853_1000008142 259
45 3300026041 Ga0207639_10001556 Ga0207639_1000155616 259
46 3300005337 Ga0070682_100138535 Ga0070682_1001385352 260
47 3300005530 Ga0070679_100093391 Ga0070679_1000933913 260
48 3300025932 Ga0207690_10300325 Ga0207690_103003251 260
49 3300046681 Ga0495647_0007996 Ga0495647_0007996_2435_3280 260
50 3300031911 Ga0307412_10063743 Ga0307412_100637432 261
51 3300031548 Ga0307408_100033862 Ga0307408_1000338622 262
52 3300031731 Ga0307405_10139645 Ga0307405_101396452 262
53 3300031852 Ga0307410_10019956 Ga0307410_100199563 262
54 3300031901 Ga0307406_10118761 Ga0307406_101187611 262
55 3300031995 Ga0307409_100010012 Ga0307409_1000100122 262
56 3300032002 Ga0307416_100064039 Ga0307416_1000640393 262
57 3300032004 Ga0307414_10007243 Ga0307414_100072436 262
58 3300032005 Ga0307411_10002260 Ga0307411_100022607 262
59 3300025932 Ga0207690_10367689 Ga0207690_103676891 263
60 3300005344 Ga0070661_100178520 Ga0070661_1001785202 264
61 3300005616 Ga0068852_100120637 Ga0068852_1001206372 264
62 3300009177 Ga0105248_10162882 Ga0105248_101628823 264
63 3300025920 Ga0207649_10142504 Ga0207649_101425042 264
64 3300026142 Ga0207698_10457749 Ga0207698_104577491 264
65 3300030735 Ga0316178_1168699 Ga0316178_11686992 264
66 3300030745 Ga0316182_1387698 Ga0316182_13876981 264
67 3300031247 Ga0265340_10079011 Ga0265340_100790111 264
68 3300037471 Ga0395905_0293561 Ga0395905_0293561_84_980 264
69 3300048907 Ga0496104_0121111 Ga0496104_0121111_866_1762 264
70 3300048910 Ga0496107_0072201 Ga0496107_0072201_661_1557 264
71 3300048911 Ga0496108_0020819 Ga0496108_0020819_2650_3546 264
72 3300005355 Ga0070671_100006923 Ga0070671_1000069232 265
73 3300005364 Ga0070673_100076910 Ga0070673_1000769102 265
74 3300005546 Ga0070696_100081711 Ga0070696_1000817111 265
75 3300005614 Ga0068856_100267674 Ga0068856_1002676742 265
76 3300025909 Ga0207705_10146259 Ga0207705_101462592 265
77 3300025931 Ga0207644_10337446 Ga0207644_103374462 265
78 3300025945 Ga0207679_10275643 Ga0207679_102756432 265
79 3300026078 Ga0207702_10157677 Ga0207702_101576772 265
80 3300031995 Ga0307409_100158193 Ga0307409_1001581932 265
81 3300048912 Ga0496109_0110016 Ga0496109_0110016_459_1355 265
82 3300048915 Ga0496112_0232583 Ga0496112_0232583_117_1013 265
83 3300048916 Ga0496113_0009265 Ga0496113_0009265_4738_5634 265
84 3300005577 Ga0068857_100474732 Ga0068857_1004747321 266
85 3300026116 Ga0207674_10029229 Ga0207674_100292295 266
86 3300031852 Ga0307410_10087526 Ga0307410_100875262 266
87 3300031901 Ga0307406_10087925 Ga0307406_100879252 266
88 3300031995 Ga0307409_100002852 Ga0307409_1000028527 266
89 3300032002 Ga0307416_100037845 Ga0307416_1000378454 266
90 3300032002 Ga0307416_100048026 Ga0307416_1000480264 266
91 3300032005 Ga0307411_10008973 Ga0307411_100089734 266
92 3300032126 Ga0307415_100001978 Ga0307415_1000019786 266
93 3300037312 Ga0395899_0151559 Ga0395899_0151559_365_1249 266
94 3300037418 Ga0395900_0116863 Ga0395900_0116863_995_1879 266
95 3300037471 Ga0395905_0006908 Ga0395905_0006908_5421_6305 266
96 3300005290 Ga0065712_10069297 Ga0065712_100692977 267
97 3300005327 Ga0070658_10126755 Ga0070658_101267551 267
98 3300005328 Ga0070676_10089495 Ga0070676_100894952 267
99 3300005331 Ga0070670_100035826 Ga0070670_1000358262 267
100 3300005353 Ga0070669_100015137 Ga0070669_1000151375 267
101 3300005354 Ga0070675_100000380 Ga0070675_10000038021 267
102 3300005354 Ga0070675_100179332 Ga0070675_1001793322 267
103 3300005355 Ga0070671_100002491 Ga0070671_1000024918 267
104 3300005364 Ga0070673_100003514 Ga0070673_1000035144 267
105 3300005367 Ga0070667_100099763 Ga0070667_1000997633 267
106 3300005456 Ga0070678_100132660 Ga0070678_1001326602 267
107 3300005458 Ga0070681_10117278 Ga0070681_101172784 267
108 3300005543 Ga0070672_100000401 Ga0070672_1000004013 267
109 3300005564 Ga0070664_100001285 Ga0070664_10000128511 267
110 3300005618 Ga0068864_100009524 Ga0068864_1000095245 267
111 3300009093 Ga0105240_10016799 Ga0105240_100167994 267
112 3300009177 Ga0105248_10008414 Ga0105248_100084143 267
113 3300013308 Ga0157375_10236632 Ga0157375_102366321 267
114 3300025315 Ga0207697_10049901 Ga0207697_100499012 267
115 3300025909 Ga0207705_10028470 Ga0207705_100284705 267
116 3300025919 Ga0207657_10142106 Ga0207657_101421062 267
117 3300025925 Ga0207650_10009234 Ga0207650_100092344 267
118 3300025926 Ga0207659_10003335 Ga0207659_100033355 267
119 3300025931 Ga0207644_10010946 Ga0207644_100109467 267
120 3300025933 Ga0207706_10028498 Ga0207706_100284984 267
121 3300025940 Ga0207691_10002386 Ga0207691_1000238613 267
122 3300025945 Ga0207679_10181088 Ga0207679_101810882 267
123 3300025960 Ga0207651_10004130 Ga0207651_100041304 267
124 3300025960 Ga0207651_10354207 Ga0207651_103542072 267
125 3300025986 Ga0207658_10011302 Ga0207658_100113024 267
126 3300026088 Ga0207641_10266337 Ga0207641_102663372 267
127 3300026095 Ga0207676_10009599 Ga0207676_100095992 267
128 3300026121 Ga0207683_10309319 Ga0207683_103093192 267
129 3300028379 Ga0268266_10167805 Ga0268266_101678052 267
130 3300048911 Ga0496108_0038501 Ga0496108_0038501_2309_3190 267
131 3300048911 Ga0496108_0175419 Ga0496108_0175419_653_1597 267
132 3300048913 Ga0496110_0003535 Ga0496110_0003535_8419_9363 267
133 3300048914 Ga0496111_0005304 Ga0496111_0005304_553_1497 267
134 3300048917 Ga0496114_0078337 Ga0496114_0078337_578_1522 267
135 3300049742 Ga0501080_0092654 Ga0501080_0092654_88_984 267
136 3300005355 Ga0070671_100071986 Ga0070671_1000719862 268
137 3300005367 Ga0070667_100006124 Ga0070667_1000061247 268
138 3300005842 Ga0068858_100053586 Ga0068858_1000535864 268
139 3300009177 Ga0105248_10011081 Ga0105248_100110817 268
140 3300013306 Ga0163162_10126156 Ga0163162_101261562 268
141 3300014968 Ga0157379_10026063 Ga0157379_100260634 268
142 3300017792 Ga0163161_10176357 Ga0163161_101763572 268
143 3300025893 Ga0207682_10028524 Ga0207682_100285242 268
144 3300025931 Ga0207644_10061295 Ga0207644_100612953 268
145 3300025941 Ga0207711_10002664 Ga0207711_100026647 268
146 3300025986 Ga0207658_10049154 Ga0207658_100491543 268
147 3300031852 Ga0307410_10199145 Ga0307410_101991452 268
148 3300048910 Ga0496107_0039128 Ga0496107_0039128_1120_2001 268
149 3300005344 Ga0070661_100375362 Ga0070661_1003753622 269
150 3300025912 Ga0207707_10188967 Ga0207707_101889671 269
151 3300025925 Ga0207650_10245184 Ga0207650_102451842 269
152 3300026095 Ga0207676_10252572 Ga0207676_102525722 269
153 3300025919 Ga0207657_10083270 Ga0207657_100832702 270
154 3300037312 Ga0395899_0137997 Ga0395899_0137997_249_1133 270
155 3300037418 Ga0395900_0158155 Ga0395900_0158155_285_1169 270
156 3300038443 Ga0395901_0102171 Ga0395901_0102171_615_1499 270
157 3300005293 Ga0065715_10110657 Ga0065715_101106573 271
158 3300005844 Ga0068862_100123182 Ga0068862_1001231822 271
159 3300025923 Ga0207681_10083015 Ga0207681_100830152 271
160 3300025945 Ga0207679_10033866 Ga0207679_100338663 271
161 3300005455 Ga0070663_100073024 Ga0070663_1000730242 272
162 3300005457 Ga0070662_100163717 Ga0070662_1001637171 272
163 3300005535 Ga0070684_100433725 Ga0070684_1004337251 272
164 3300005546 Ga0070696_100282808 Ga0070696_1002828082 272
165 3300005547 Ga0070693_100110580 Ga0070693_1001105802 272
166 3300005563 Ga0068855_100076372 Ga0068855_1000763725 272
167 3300005564 Ga0070664_100245768 Ga0070664_1002457682 272
168 3300005577 Ga0068857_100308596 Ga0068857_1003085962 272
169 3300013307 Ga0157372_10370242 Ga0157372_103702422 272
170 3300025919 Ga0207657_10039090 Ga0207657_100390902 272
171 3300025921 Ga0207652_10214846 Ga0207652_102148461 272
172 3300025933 Ga0207706_10003005 Ga0207706_100030052 272
173 3300025944 Ga0207661_10406988 Ga0207661_104069881 272
174 3300025945 Ga0207679_10279870 Ga0207679_102798702 272
175 3300025949 Ga0207667_10795795 Ga0207667_107957951 272
176 3300026041 Ga0207639_10234882 Ga0207639_102348822 272
177 3300026067 Ga0207678_10001633 Ga0207678_1000163316 272
178 3300026116 Ga0207674_10014458 Ga0207674_100144584 272
179 3300031548 Ga0307408_100236124 Ga0307408_1002361241 272
180 3300031901 Ga0307406_10006681 Ga0307406_100066816 272
181 3300046492 Ga0495585_0016914 Ga0495585_0016914_1716_2612 272
182 3300046525 Ga0495663_0001307 Ga0495663_0001307_1507_2403 272
183 3300046537 Ga0495598_0000568 Ga0495598_0000568_3199_4095 272
184 3300046539 Ga0495621_0000404 Ga0495621_0000404_8277_9173 272
185 3300046684 Ga0495669_0018394 Ga0495669_0018394_761_1657 272
186 3300046691 Ga0495670_0022310 Ga0495670_0022310_2084_2980 272
187 3300005333 Ga0070677_10000547 Ga0070677_1000054711 273
188 3300013100 Ga0157373_10064429 Ga0157373_100644291 273
189 3300025893 Ga0207682_10001617 Ga0207682_100016177 273
190 3300037471 Ga0395905_0030386 Ga0395905_0030386_129_1031 273
191 3300048907 Ga0496104_0221199 Ga0496104_0221199_60_881 273
192 3300005336 Ga0070680_100383079 Ga0070680_1003830791 274
193 3300005354 Ga0070675_100014114 Ga0070675_1000141142 274
194 3300005530 Ga0070679_100456446 Ga0070679_1004564462 274
195 3300014326 Ga0157380_10063252 Ga0157380_100632524 274
196 3300025917 Ga0207660_10077266 Ga0207660_100772662 274
197 3300025920 Ga0207649_10075986 Ga0207649_100759862 274
198 3300025921 Ga0207652_10315854 Ga0207652_103158542 274
199 3300026067 Ga0207678_10012511 Ga0207678_100125114 274
200 3300031731 Ga0307405_10062318 Ga0307405_100623182 274
201 3300031852 Ga0307410_10051451 Ga0307410_100514513 274
202 3300032002 Ga0307416_100375022 Ga0307416_1003750221 274
203 3300037418 Ga0395900_0109319 Ga0395900_0109319_1821_2723 274
204 3300037471 Ga0395905_0010343 Ga0395905_0010343_6008_6910 274
205 3300038443 Ga0395901_0059649 Ga0395901_0059649_1428_2330 274
206 3300046525 Ga0495663_0079348 Ga0495663_0079348_69_971 274
207 3300046684 Ga0495669_0011176 Ga0495669_0011176_2721_3623 274
208 3300047445 Ga0495677_0007606 Ga0495677_0007606_558_1460 274
209 3300005327 Ga0070658_10021651 Ga0070658_100216517 275
210 3300005455 Ga0070663_100363558 Ga0070663_1003635581 275
211 3300005844 Ga0068862_100045490 Ga0068862_1000454902 275
212 3300025909 Ga0207705_10015458 Ga0207705_100154584 275
213 3300046660 Ga0495625_0093176 Ga0495625_0093176_569_1471 275
214 3300046684 Ga0495669_0014007 Ga0495669_0014007_1812_2714 275
215 3300031852 Ga0307410_10321817 Ga0307410_103218172 276
216 3300032004 Ga0307414_10007417 Ga0307414_100074175 276
217 3300032005 Ga0307411_10034037 Ga0307411_100340373 276
218 3300037312 Ga0395899_0001765 Ga0395899_0001765_13009_13920 276
219 3300037418 Ga0395900_0036015 Ga0395900_0036015_129_1040 276
220 3300037466 Ga0395898_0019395 Ga0395898_0019395_292_1203 276
221 3300046616 Ga0495668_0014504 Ga0495668_0014504_2502_3401 276
222 3300048908 Ga0496105_0074714 Ga0496105_0074714_1173_2003 276
223 3300005338 Ga0068868_100375728 Ga0068868_1003757281 277
224 3300005355 Ga0070671_100040797 Ga0070671_1000407973 277
225 3300005841 Ga0068863_100284247 Ga0068863_1002842472 277
226 3300009177 Ga0105248_10079091 Ga0105248_100790914 277
227 3300013308 Ga0157375_10102672 Ga0157375_101026722 277
228 3300025941 Ga0207711_10005655 Ga0207711_100056559 277
229 3300028381 Ga0268264_10110989 Ga0268264_101109892 277
230 3300031995 Ga0307409_100005778 Ga0307409_1000057783 277
231 3300053134 Ga0500658_0000188 Ga0500658_0000188_19530_20429 277
232 3300005367 Ga0070667_100038001 Ga0070667_1000380015 278
233 3300025986 Ga0207658_10026494 Ga0207658_100264945 278
234 3300037471 Ga0395905_0103973 Ga0395905_0103973_143_1036 278
235 3300005985 Ga0081539_10005679 Ga0081539_100056795 279
236 3300005353 Ga0070669_100068031 Ga0070669_1000680313 280
237 3300005353 Ga0070669_100123649 Ga0070669_1001236492 280
238 3300005355 Ga0070671_100074520 Ga0070671_1000745203 280
239 3300005364 Ga0070673_100303492 Ga0070673_1003034922 280
240 3300005367 Ga0070667_100014701 Ga0070667_1000147012 280
241 3300005367 Ga0070667_100016074 Ga0070667_1000160746 280
242 3300005539 Ga0068853_100307453 Ga0068853_1003074532 280
243 3300005548 Ga0070665_100008011 Ga0070665_1000080116 280
244 3300005617 Ga0068859_100062592 Ga0068859_1000625923 280
245 3300005618 Ga0068864_100000152 Ga0068864_10000015213 280
246 3300005841 Ga0068863_100070983 Ga0068863_1000709834 280
247 3300005842 Ga0068858_100002589 Ga0068858_10000258919 280
248 3300005843 Ga0068860_100065858 Ga0068860_1000658583 280
249 3300006931 Ga0097620_100062593 Ga0097620_1000625933 280
250 3300009092 Ga0105250_10012615 Ga0105250_100126153 280
251 3300009101 Ga0105247_10125397 Ga0105247_101253972 280
252 3300009177 Ga0105248_10004459 Ga0105248_1000445916 280
253 3300011119 Ga0105246_10200788 Ga0105246_102007882 280
254 3300013306 Ga0163162_10079445 Ga0163162_100794453 280
255 3300013308 Ga0157375_10596993 Ga0157375_105969932 280
256 3300014325 Ga0163163_10060285 Ga0163163_100602852 280
257 3300014968 Ga0157379_10017112 Ga0157379_100171122 280
258 3300025711 Ga0207696_1026986 Ga0207696_10269862 280
259 3300025923 Ga0207681_10019084 Ga0207681_100190843 280
260 3300025923 Ga0207681_10054803 Ga0207681_100548032 280
261 3300025923 Ga0207681_10311369 Ga0207681_103113692 280
262 3300025931 Ga0207644_10033629 Ga0207644_100336293 280
263 3300025940 Ga0207691_10067292 Ga0207691_100672922 280
264 3300025941 Ga0207711_10050893 Ga0207711_100508934 280
265 3300025960 Ga0207651_10075295 Ga0207651_100752952 280
266 3300025986 Ga0207658_10010816 Ga0207658_100108162 280
267 3300025986 Ga0207658_10024130 Ga0207658_100241304 280
268 3300026035 Ga0207703_10051763 Ga0207703_100517634 280
269 3300026041 Ga0207639_10403015 Ga0207639_104030152 280
270 3300026088 Ga0207641_10074036 Ga0207641_100740364 280
271 3300026095 Ga0207676_10020940 Ga0207676_100209402 280
272 3300026118 Ga0207675_100235889 Ga0207675_1002358892 280
273 3300028379 Ga0268266_10014446 Ga0268266_100144465 280
274 3300028380 Ga0268265_10137495 Ga0268265_101374952 280
275 3300028381 Ga0268264_10000755 Ga0268264_1000075537 280
276 3300031824 Ga0307413_10440180 Ga0307413_104401801 280
277 3300032005 Ga0307411_10002078 Ga0307411_100020787 280
278 3300005339 Ga0070660_100198540 Ga0070660_1001985402 281
279 3300005467 Ga0070706_100506810 Ga0070706_1005068102 281
280 3300005545 Ga0070695_100013514 Ga0070695_1000135146 281
281 3300005546 Ga0070696_100010639 Ga0070696_1000106394 281
282 3300005578 Ga0068854_100068743 Ga0068854_1000687432 281
283 3300009094 Ga0111539_10014044 Ga0111539_100140443 281
284 3300025933 Ga0207706_10041020 Ga0207706_100410202 281
285 3300042142 Ga0450905_003838 Ga0450905_003838_998_1876 281
286 3300042144 Ga0450889_001229 Ga0450889_001229_180_1058 281
287 3300048909 Ga0496106_0336052 Ga0496106_0336052_163_1059 281
288 3300050511 nmdc:mga08y16_86986_c1 nmdc:mga08y16_86986_c1_1057_1935 281
289 3300026035 Ga0207703_10094336 Ga0207703_100943363 283
290 3300005841 Ga0068863_100039595 Ga0068863_1000395952 284
291 3300025972 Ga0207668_10011258 Ga0207668_100112583 284
292 3300026088 Ga0207641_10010409 Ga0207641_100104097 284
293 3300037471 Ga0395905_0153837 Ga0395905_0153837_331_1209 284
294 3300006914 Ga0075436_100125941 Ga0075436_1001259412 285
295 3300032002 Ga0307416_100360779 Ga0307416_1003607792 285
296 3300032004 Ga0307414_10207388 Ga0307414_102073882 285
297 3300032126 Ga0307415_100401440 Ga0307415_1004014402 285
298 3300050514 nmdc:mga08x19_115331_c1 nmdc:mga08x19_115331_c1_739_1629 285
299 3300026121 Ga0207683_10083439 Ga0207683_100834393 287
300 3300005338 Ga0068868_100071434 Ga0068868_1000714342 292
301 3300005339 Ga0070660_100029516 Ga0070660_1000295162 292
302 3300005444 Ga0070694_100347886 Ga0070694_1003478861 292
303 3300005543 Ga0070672_100049508 Ga0070672_1000495084 292
304 3300005549 Ga0070704_100408558 Ga0070704_1004085581 292
305 3300005577 Ga0068857_100070189 Ga0068857_1000701892 292
306 3300005577 Ga0068857_100424847 Ga0068857_1004248471 292
307 3300005578 Ga0068854_100285809 Ga0068854_1002858092 292
308 3300005617 Ga0068859_100093335 Ga0068859_1000933353 292
309 3300005842 Ga0068858_100151542 Ga0068858_1001515422 292
310 3300005843 Ga0068860_100006380 Ga0068860_1000063801 292
311 3300005844 Ga0068862_100265378 Ga0068862_1002653781 292
312 3300006931 Ga0097620_100093337 Ga0097620_1000933373 292
313 3300007076 Ga0075435_100277370 Ga0075435_1002773702 292
314 3300009098 Ga0105245_10200777 Ga0105245_102007772 292
315 3300009148 Ga0105243_10096796 Ga0105243_100967962 292
316 3300009553 Ga0105249_10014236 Ga0105249_100142365 292
317 3300011119 Ga0105246_10092430 Ga0105246_100924302 292
318 3300013308 Ga0157375_10084276 Ga0157375_100842763 292
319 3300014968 Ga0157379_10425851 Ga0157379_104258512 292
320 3300025904 Ga0207647_10005912 Ga0207647_100059126 292
321 3300025919 Ga0207657_10007694 Ga0207657_100076943 292
322 3300025923 Ga0207681_10014286 Ga0207681_100142864 292
323 3300025932 Ga0207690_10008144 Ga0207690_100081443 292
324 3300025934 Ga0207686_10191116 Ga0207686_101911162 292
325 3300025942 Ga0207689_10056646 Ga0207689_100566462 292
326 3300025949 Ga0207667_10032087 Ga0207667_100320872 292
327 3300025961 Ga0207712_10000940 Ga0207712_1000094019 292
328 3300026035 Ga0207703_10226686 Ga0207703_102266862 292
329 3300026116 Ga0207674_10232840 Ga0207674_102328402 292
330 3300026118 Ga0207675_100326829 Ga0207675_1003268292 292
331 3300028380 Ga0268265_10084320 Ga0268265_100843202 292
332 3300028380 Ga0268265_10188580 Ga0268265_101885802 292
333 3300028381 Ga0268264_10000379 Ga0268264_1000037936 292
334 3300001976 JGI24752J21851_1003129 JGI24752J21851_10031291 294
335 3300005344 Ga0070661_100036822 Ga0070661_1000368223 294
336 3300005355 Ga0070671_100004296 Ga0070671_1000042963 294
337 3300005367 Ga0070667_100018347 Ga0070667_1000183472 294
338 3300005457 Ga0070662_100204855 Ga0070662_1002048552 294
339 3300005563 Ga0068855_100354011 Ga0068855_1003540112 294
340 3300005564 Ga0070664_100027045 Ga0070664_1000270454 294
341 3300005577 Ga0068857_100043351 Ga0068857_1000433512 294
342 3300005614 Ga0068856_100192820 Ga0068856_1001928202 294
343 3300005616 Ga0068852_100325354 Ga0068852_1003253542 294
344 3300005617 Ga0068859_100044585 Ga0068859_1000445852 294
345 3300005618 Ga0068864_100007919 Ga0068864_1000079197 294
346 3300005834 Ga0068851_10069742 Ga0068851_100697422 294
347 3300005841 Ga0068863_100011024 Ga0068863_1000110245 294
348 3300005842 Ga0068858_100015237 Ga0068858_1000152376 294
349 3300006931 Ga0097620_100044585 Ga0097620_1000445852 294
350 3300009545 Ga0105237_10169421 Ga0105237_101694212 294
351 3300014325 Ga0163163_10360134 Ga0163163_103601342 294
352 3300014968 Ga0157379_10011613 Ga0157379_100116133 294
353 3300025904 Ga0207647_10021665 Ga0207647_100216654 294
354 3300025920 Ga0207649_10340985 Ga0207649_103409852 294
355 3300025931 Ga0207644_10053775 Ga0207644_100537752 294
356 3300025933 Ga0207706_10220299 Ga0207706_102202992 294
357 3300025949 Ga0207667_10382256 Ga0207667_103822562 294
358 3300025986 Ga0207658_10035658 Ga0207658_100356583 294
359 3300026078 Ga0207702_10070218 Ga0207702_100702184 294
360 3300026088 Ga0207641_10014279 Ga0207641_100142793 294
361 3300026095 Ga0207676_10065441 Ga0207676_100654412 294
362 3300026116 Ga0207674_10000060 Ga0207674_100000605 294
363 3300026142 Ga0207698_10216642 Ga0207698_102166422 294
364 3300048905 Ga0496102_0053641 Ga0496102_0053641_2064_2948 294
365 3300048906 Ga0496103_0062687 Ga0496103_0062687_68_952 294
366 3300048913 Ga0496110_0004390 Ga0496110_0004390_7868_8752 294
367 3300048914 Ga0496111_0080922 Ga0496111_0080922_1330_2214 294
368 3300048915 Ga0496112_0155611 Ga0496112_0155611_1322_2206 294

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04228

Zn_peptidase

Putative neutral zinc metallopeptidase

1

297

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ait-assembly1.cif.gz_A crystal structure of e. coli bepa 0.4971 95 283
2w2d-assembly1.cif.gz_B crystal structure of a catalytically active, non-toxic endopeptidase derivative of clostridium botulinum toxin a 0.323 181 290
1kny-assembly1.cif.gz_B kanamycin nucleotidyltransferase 0.3209 168 285
6ait-assembly1.cif.gz_A crystal structure of e. coli bepa 0.3185 95 283
5ecf-assembly1.cif.gz_A ligand binding domain 1 of penicillium marneffei mp1 protein complexed with arachidonic acids 0.3092 151 286
ID Description Score Start End Superfamily
af_P64429_1_283_3.40.390.10 Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) 0.793 1 290 3.40.390.10
af_P64429_1_283_3.40.390.10 Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) 0.7823 1 290 3.40.390.10
af_P9WL85_4_287_3.40.390.10 Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) 0.6553 10 290 3.40.390.10
af_P9WL85_4_287_3.40.390.10 Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) 0.6299 10 290 3.40.390.10
af_A0A1D8PF60_1_177_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.513 207 285 1.20.1270.60
ID Description Score Start End GO Terms
AF-A0A3D3K4L7-F1-model_v4 Metalloprotease 0.9601 91 222 GO:0006508
GO:0008237
GO:0016020
AF-A0A4S0PXI0-F1-model_v4 deleted 0.9478 83 183
AF-A0A536IGE2-F1-model_v4 Metalloprotease 0.9447 88 179 GO:0016020
AF-A0A2J5P8F9-F1-model_v4 Neutral zinc metallopeptidase 0.9446 85 290 GO:0016020
AF-A0A4Q2ZDX7-F1-model_v4 Zinc metalloprotease 0.9433 98 290 GO:0006508
GO:0008237
GO:0016020

Feature Viewer

pLDDT pTM Quality
73.82 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map