F424601

General Info

Members Datasets Scaffolds Average Seq Length
368 211 368 99

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100037458|Ga0070714_1000374583
Length 111
Sequence MIRVVLPAHLRTLAKVAGEVKLEIDGQATQRSVLDALETCYPMLRGTIRDQVTQQRRPFVRFFACTEDLSHEPPDAPLPEAVRIGAEPLLVVGAIAGGSESQRSLRNRDRI

Samples

Sample ID Description Type Environment
1 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
90 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
91 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
136 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
137 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
138 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
139 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
140 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
141 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
142 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
143 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
144 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
145 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
146 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
147 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
148 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
150 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
151 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
152 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
153 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
154 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
155 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
156 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
157 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
158 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
159 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
160 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
161 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
162 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
163 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
164 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
165 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
166 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
167 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
168 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
169 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
170 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
171 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
172 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
173 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
174 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
175 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
176 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
177 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
178 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
179 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
180 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
181 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
182 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
183 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
190 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
191 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
192 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
193 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
194 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
195 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
196 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
197 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
198 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
199 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
200 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
201 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
202 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
203 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
204 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
205 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
206 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
207 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
208 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
209 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
210 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
211 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.83
Metatranscriptomes 2.17
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.27
Rhizosphere 98.37
Stem 0
Stem Tuber 0
Unclassified 1.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058863_11110530 3300004799 Bacteria 502
2 Ga0070658_10122159 3300005327 Bacteria 2164
3 Ga0070658_10957977 3300005327 Bacteria 744
4 Ga0070683_100037334 3300005329 Bacteria 4447
5 Ga0070683_100131935 3300005329 Bacteria 2365
6 Ga0070683_100458477 3300005329 Bacteria 1217
7 Ga0070683_101499326 3300005329 Bacteria 648
8 Ga0070683_101769862 3300005329 Bacteria 594
9 Ga0070690_100054657 3300005330 Bacteria 2556
10 Ga0070690_100653827 3300005330 Bacteria 803
11 Ga0070670_101538859 3300005331 Bacteria 611
12 Ga0068869_101250328 3300005334 Bacteria 654
13 Ga0070666_10032815 3300005335 Bacteria 3432
14 Ga0070666_10602109 3300005335 Bacteria 802
15 Ga0070666_10767948 3300005335 Bacteria 709
16 Ga0070680_100285512 3300005336 Bacteria 1399
17 Ga0070682_101418607 3300005337 Bacteria 594
18 Ga0068868_100029515 3300005338 Bacteria 4199
19 Ga0070660_100290168 3300005339 Bacteria 1340
20 Ga0070688_100377567 3300005365 Unclassified 1044
21 Ga0070659_100015800 3300005366 Bacteria 5658
22 Ga0070667_100268931 3300005367 Bacteria 1528
23 Ga0070714_100037458 3300005435 Bacteria 4076
24 Ga0070714_101537582 3300005435 Bacteria 650
25 Ga0070713_102311122 3300005436 Bacteria 520
26 Ga0070705_100024122 3300005440 Bacteria 3279
27 Ga0070705_101817311 3300005440 Unclassified 517
28 Ga0070694_100046220 3300005444 Bacteria 2922
29 Ga0070694_101679295 3300005444 Bacteria 540
30 Ga0070708_100185779 3300005445 Bacteria 1944
31 Ga0070708_100582621 3300005445 Bacteria 1055
32 Ga0070663_101501130 3300005455 Bacteria 599
33 Ga0070681_10253650 3300005458 Bacteria 1671
34 Ga0068867_100103154 3300005459 Bacteria 2181
35 Ga0068867_100632763 3300005459 Bacteria 937
36 Ga0070706_100717568 3300005467 Bacteria 927
37 Ga0070706_100997971 3300005467 Bacteria 772
38 Ga0070706_101059793 3300005467 Bacteria 747
39 Ga0070698_100029612 3300005471 Bacteria 5685
40 Ga0070698_100923745 3300005471 Bacteria 819
41 Ga0070698_102083418 3300005471 Bacteria 521
42 Ga0070699_100009631 3300005518 Bacteria 8363
43 Ga0070699_100066211 3300005518 Unclassified 3136
44 Ga0070699_100369397 3300005518 Bacteria 1294
45 Ga0070699_100388091 3300005518 Bacteria 1261
46 Ga0070699_101175755 3300005518 Bacteria 704
47 Ga0070679_100061928 3300005530 Bacteria 3729
48 Ga0070679_100542563 3300005530 Bacteria 1106
49 Ga0070679_101193342 3300005530 Bacteria 706
50 Ga0070684_100159481 3300005535 Bacteria 2046
51 Ga0070684_100258099 3300005535 Bacteria 1594
52 Ga0070684_100702557 3300005535 Bacteria 943
53 Ga0070684_101158837 3300005535 Bacteria 727
54 Ga0070697_100079631 3300005536 Bacteria 2697
55 Ga0070697_101372090 3300005536 Bacteria 631
56 Ga0068853_100446667 3300005539 Bacteria 1216
57 Ga0068853_101901648 3300005539 Bacteria 577
58 Ga0070686_101218309 3300005544 Bacteria 626
59 Ga0070696_100010232 3300005546 Bacteria 6278
60 Ga0070696_100019685 3300005546 Bacteria 4572
61 Ga0070696_101040246 3300005546 Bacteria 686
62 Ga0070665_100407567 3300005548 Bacteria 1368
63 Ga0070704_101812374 3300005549 Bacteria 565
64 Ga0068855_100120236 3300005563 Bacteria 3006
65 Ga0068855_100320987 3300005563 Bacteria 1712
66 Ga0070664_100422220 3300005564 Bacteria 1221
67 Ga0068857_100041369 3300005577 Bacteria 4087
68 Ga0068857_100062780 3300005577 Bacteria 3303
69 Ga0068856_100140576 3300005614 Bacteria 2421
70 Ga0068856_100463090 3300005614 Bacteria 1289
71 Ga0068852_100700923 3300005616 Bacteria 1022
72 Ga0068859_100016513 3300005617 Bacteria 7411
73 Ga0068859_101656500 3300005617 Bacteria 707
74 Ga0068859_101860479 3300005617 Unclassified 665
75 Ga0068859_102485090 3300005617 Bacteria 570
76 Ga0068864_100005621 3300005618 Bacteria 10277
77 Ga0068864_100325835 3300005618 Bacteria 1444
78 Ga0068864_100830077 3300005618 Bacteria 910
79 Ga0068866_10196681 3300005718 Bacteria 1202
80 Ga0068870_11321358 3300005840 Bacteria 526
81 Ga0068863_100774647 3300005841 Bacteria 956
82 Ga0068863_101963328 3300005841 Bacteria 595
83 Ga0068863_102005625 3300005841 Bacteria 589
84 Ga0068858_100007173 3300005842 Bacteria 10812
85 Ga0068858_100822278 3300005842 Bacteria 907
86 Ga0068860_100004892 3300005843 Bacteria 13652
87 Ga0068860_101489811 3300005843 Bacteria 698
88 Ga0081455_10007016 3300005937 Bacteria 11968
89 Ga0097621_100015771 3300006237 Bacteria 5695
90 Ga0097621_100177416 3300006237 Bacteria 1840
91 Ga0097621_100360905 3300006237 Bacteria 1294
92 Ga0097621_101041172 3300006237 Bacteria 767
93 Ga0097621_101855785 3300006237 Bacteria 575
94 Ga0068871_100040514 3300006358 Bacteria 3731
95 Ga0068871_100278007 3300006358 Unclassified 1464
96 Ga0068871_100339742 3300006358 Bacteria 1326
97 Ga0075428_100049839 3300006844 Bacteria 4594
98 Ga0075428_101635720 3300006844 Bacteria 673
99 Ga0075428_102560624 3300006844 Bacteria 522
100 Ga0075430_100563415 3300006846 Bacteria 940
101 Ga0075431_100381486 3300006847 Bacteria 1413
102 Ga0075433_10094549 3300006852 Bacteria 2645
103 Ga0075433_10493895 3300006852 Bacteria 1078
104 Ga0075433_10517611 3300006852 Bacteria 1050
105 Ga0075434_100001875 3300006871 Bacteria 18196
106 Ga0075434_100140069 3300006871 Bacteria 2438
107 Ga0075434_100341424 3300006871 Bacteria 1518
108 Ga0075434_101620890 3300006871 Bacteria 655
109 Ga0075429_100372331 3300006880 Bacteria 1250
110 Ga0075429_100905387 3300006880 Bacteria 772
111 Ga0068865_100280368 3300006881 Bacteria 1327
112 Ga0068865_101166592 3300006881 Bacteria 681
113 Ga0075436_100000567 3300006914 Bacteria 24122
114 Ga0075436_100107785 3300006914 Bacteria 1943
115 Ga0075436_100118123 3300006914 Bacteria 1854
116 Ga0097620_100016515 3300006931 Bacteria 7411
117 Ga0097620_101656511 3300006931 Bacteria 707
118 Ga0097620_101860206 3300006931 Unclassified 665
119 Ga0097620_102484612 3300006931 Bacteria 570
120 Ga0075435_100000423 3300007076 Bacteria 26136
121 Ga0075435_100016941 3300007076 Bacteria 5502
122 Ga0075435_100220624 3300007076 Bacteria 1610
123 Ga0099794_10051530 3300007265 Bacteria 1982
124 Ga0099794_10146650 3300007265 Bacteria 1197
125 Ga0099794_10286785 3300007265 Bacteria 852
126 Ga0105240_10084800 3300009093 Bacteria 3883
127 Ga0105240_10138560 3300009093 Bacteria 2911
128 Ga0105240_10907249 3300009093 Bacteria 947
129 Ga0105240_11122455 3300009093 Bacteria 836
130 Ga0105240_11184393 3300009093 Bacteria 810
131 Ga0111539_10050552 3300009094 Bacteria 4952
132 Ga0105245_10012991 3300009098 Bacteria 7256
133 Ga0105245_10075714 3300009098 Bacteria 3065
134 Ga0105245_11345337 3300009098 Bacteria 764
135 Ga0105247_10059570 3300009101 Bacteria 2364
136 Ga0114129_10018829 3300009147 Bacteria 9833
137 Ga0114129_10031638 3300009147 Bacteria 7480
138 Ga0114129_11007370 3300009147 Bacteria 1049
139 Ga0105243_10181831 3300009148 Bacteria 1829
140 Ga0105243_10570547 3300009148 Bacteria 1084
141 Ga0105243_10732794 3300009148 Bacteria 967
142 Ga0105243_12367703 3300009148 Bacteria 569
143 Ga0105241_10828902 3300009174 Bacteria 854
144 Ga0105241_11164551 3300009174 Bacteria 729
145 Ga0105242_10211471 3300009176 Bacteria 1729
146 Ga0105242_10337279 3300009176 Bacteria 1388
147 Ga0105242_10656492 3300009176 Bacteria 1021
148 Ga0105248_10021036 3300009177 Bacteria 7229
149 Ga0105248_10193247 3300009177 Bacteria 2293
150 Ga0105248_11901178 3300009177 Bacteria 675
151 Ga0105248_11939271 3300009177 Bacteria 669
152 Ga0105237_10003745 3300009545 Bacteria 17911
153 Ga0105237_10188156 3300009545 Bacteria 2065
154 Ga0105237_10357864 3300009545 Bacteria 1464
155 Ga0105237_10835256 3300009545 Bacteria 928
156 Ga0105238_10019644 3300009551 Bacteria 6880
157 Ga0105238_10156300 3300009551 Bacteria 2256
158 Ga0105238_10191477 3300009551 Bacteria 2021
159 Ga0105249_10128823 3300009553 Bacteria 2413
160 Ga0105249_10462261 3300009553 Bacteria 1309
161 Ga0105239_10136560 3300010375 Bacteria 2730
162 Ga0105239_10503113 3300010375 Bacteria 1378
163 Ga0105239_10546653 3300010375 Bacteria 1319
164 Ga0105239_10766739 3300010375 Bacteria 1104
165 Ga0105246_10062619 3300011119 Bacteria 2592
166 Ga0157370_10130592 3300013104 Bacteria 2343
167 Ga0157369_10227534 3300013105 Bacteria 1951
168 Ga0157374_10147859 3300013296 Bacteria 2283
169 Ga0157374_11075065 3300013296 Bacteria 825
170 Ga0157378_10058110 3300013297 Bacteria 3449
171 Ga0163162_10070248 3300013306 Bacteria 3553
172 Ga0163162_10215669 3300013306 Bacteria 2049
173 Ga0163162_10573797 3300013306 Bacteria 1255
174 Ga0157372_10185963 3300013307 Bacteria 2406
175 Ga0157372_10456653 3300013307 Bacteria 1489
176 Ga0157372_10568372 3300013307 Bacteria 1322
177 Ga0157372_10839105 3300013307 Bacteria 1067
178 Ga0157375_10114617 3300013308 Bacteria 2797
179 Ga0157375_10377595 3300013308 Bacteria 1584
180 Ga0163163_10010016 3300014325 Bacteria 8501
181 Ga0163163_10032293 3300014325 Bacteria 5056
182 Ga0163163_10100833 3300014325 Bacteria 2909
183 Ga0163163_10253230 3300014325 Unclassified 1811
184 Ga0157379_10022224 3300014968 Bacteria 5619
185 Ga0157379_10231110 3300014968 Bacteria 1676
186 Ga0157379_10338121 3300014968 Bacteria 1376
187 Ga0157376_10043045 3300014969 Bacteria 3704
188 Ga0157376_10565531 3300014969 Bacteria 1127
189 Ga0206356_10391455 3300020070 Bacteria 833
190 Ga0206349_1418717 3300020075 Bacteria 590
191 Ga0206351_10859780 3300020077 Bacteria 1128
192 Ga0206350_11088956 3300020080 Bacteria 1358
193 Ga0206350_11293820 3300020080 Bacteria 1615
194 Ga0206354_11365870 3300020081 Bacteria 957
195 Ga0213873_10101520 3300021358 Bacteria 828
196 Ga0213874_10013455 3300021377 Bacteria 2120
197 Ga0224712_10569047 3300022467 Bacteria 552
198 Ga0207710_10068438 3300025900 Bacteria 1624
199 Ga0207680_10027054 3300025903 Bacteria 3188
200 Ga0207643_11107969 3300025908 Bacteria 511
201 Ga0207705_10763312 3300025909 Bacteria 751
202 Ga0207684_10279021 3300025910 Bacteria 1441
203 Ga0207684_10291020 3300025910 Bacteria 1408
204 Ga0207684_10971778 3300025910 Bacteria 711
205 Ga0207654_10292208 3300025911 Bacteria 1106
206 Ga0207707_10006077 3300025912 Bacteria 10569
207 Ga0207695_10119403 3300025913 Bacteria 2607
208 Ga0207695_11153436 3300025913 Bacteria 655
209 Ga0207671_10132763 3300025914 Bacteria 1912
210 Ga0207671_10189707 3300025914 Bacteria 1602
211 Ga0207663_11337147 3300025916 Bacteria 577
212 Ga0207660_10180438 3300025917 Bacteria 1639
213 Ga0207657_10169009 3300025919 Bacteria 1772
214 Ga0207657_10539597 3300025919 Bacteria 912
215 Ga0207649_11190929 3300025920 Bacteria 602
216 Ga0207652_10109990 3300025921 Bacteria 2443
217 Ga0207652_10440701 3300025921 Bacteria 1174
218 Ga0207646_10050003 3300025922 Bacteria 3742
219 Ga0207646_11444620 3300025922 Bacteria 597
220 Ga0207694_10013385 3300025924 Bacteria 6179
221 Ga0207694_10359999 3300025924 Bacteria 1205
222 Ga0207687_10075083 3300025927 Bacteria 2425
223 Ga0207687_10119110 3300025927 Bacteria 1971
224 Ga0207687_11088139 3300025927 Bacteria 686
225 Ga0207700_11692710 3300025928 Bacteria 558
226 Ga0207664_10135925 3300025929 Bacteria 2074
227 Ga0207690_10460280 3300025932 Bacteria 1023
228 Ga0207706_10511801 3300025933 Bacteria 1036
229 Ga0207686_10013611 3300025934 Bacteria 4504
230 Ga0207686_10235320 3300025934 Bacteria 1330
231 Ga0207709_10247908 3300025935 Bacteria 1299
232 Ga0207704_10035240 3300025938 Bacteria 2866
233 Ga0207711_10012862 3300025941 Bacteria 6952
234 Ga0207711_10389343 3300025941 Bacteria 1294
235 Ga0207711_10931639 3300025941 Bacteria 807
236 Ga0207689_10537880 3300025942 Bacteria 981
237 Ga0207661_10047206 3300025944 Bacteria 3418
238 Ga0207661_10066057 3300025944 Bacteria 2938
239 Ga0207679_10421597 3300025945 Bacteria 1178
240 Ga0207667_10278249 3300025949 Bacteria 1710
241 Ga0207667_10538020 3300025949 Bacteria 1182
242 Ga0207651_11307438 3300025960 Bacteria 652
243 Ga0207712_10178822 3300025961 Bacteria 1664
244 Ga0207712_10683103 3300025961 Bacteria 895
245 Ga0207677_10003956 3300026023 Bacteria 7893
246 Ga0207703_10004915 3300026035 Bacteria 10854
247 Ga0207703_10139012 3300026035 Bacteria 2106
248 Ga0207639_10070338 3300026041 Bacteria 2733
249 Ga0207639_11515630 3300026041 Bacteria 629
250 Ga0207639_11974480 3300026041 Bacteria 544
251 Ga0207678_10860735 3300026067 Bacteria 801
252 Ga0207702_10370032 3300026078 Bacteria 1376
253 Ga0207641_10064927 3300026088 Bacteria 3121
254 Ga0207641_10455556 3300026088 Bacteria 1237
255 Ga0207676_10004080 3300026095 Bacteria 10296
256 Ga0207676_10506415 3300026095 Bacteria 1147
257 Ga0207674_10144046 3300026116 Bacteria 2342
258 Ga0207674_10415053 3300026116 Bacteria 1300
259 Ga0207683_11075277 3300026121 Unclassified 746
260 Ga0207698_10153462 3300026142 Bacteria 2003
261 Ga0268265_10327709 3300028380 Bacteria 1390
262 Ga0268264_10592155 3300028381 Bacteria 1092
263 Ga0265338_11068331 3300028800 Unclassified 545
264 Ga0265331_10409690 3300031250 Bacteria 608
265 Ga0265316_10002488 3300031344 Bacteria 19089
266 Ga0265314_10335481 3300031711 Bacteria 837
267 Ga0307415_101397849 3300032126 Bacteria 666
268 Ga0373953_0297889 3300035117 Bacteria 704
269 Ga0373957_0454232 3300035120 Bacteria 555
270 Ga0373943_0367749 3300035170 Bacteria 826
271 Ga0373955_0528851 3300035172 Bacteria 721
272 Ga0373935_1040687 3300035692 Bacteria 609
273 Ga0373927_0357868 3300035695 Bacteria 962
274 Ga0373927_0704015 3300035695 Bacteria 667
275 Ga0373937_0438199 3300036401 Bacteria 1240
276 Ga0316584_0582547 3300036712 Bacteria 778
277 Ga0373925_0533301 3300037068 Bacteria 965
278 Ga0395900_0004122 3300037418 Bacteria 15476
279 Ga0395898_0022195 3300037466 Bacteria 6432
280 Ga0436364_0763039 3300037853 Bacteria 19428
281 Ga0395901_0001693 3300038443 Bacteria 22747
282 Ga0436365_0939506 3300039437 Bacteria 901
283 Ga0436360_0626462 3300039438 Bacteria 536
284 Ga0436360_1216712 3300039438 Bacteria 817
285 Ga0436361_0477361 3300039447 Bacteria 701
286 Ga0436363_1214992 3300039450 Bacteria 6678
287 Ga0436363_1616419 3300039450 Bacteria 1042
288 Ga0436362_1056144 3300039453 Bacteria 2661
289 Ga0466969_0043560 3300044656 Bacteria 2236
290 Ga0466966_0043604 3300044684 Bacteria 2875
291 Ga0466963_0419811 3300044694 Bacteria 943
292 Ga0466959_0003376 3300045049 Bacteria 10432
293 Ga0466959_0302949 3300045049 Bacteria 1094
294 Ga0466959_1072864 3300045049 Bacteria 536
295 Ga0451576_0317118 3300045051 Bacteria 1631
296 Ga0495629_0549773 3300046459 Bacteria 775
297 Ga0495580_0002762 3300046472 Bacteria 15124
298 Ga0495580_0175286 3300046472 Bacteria 1481
299 Ga0495594_0054601 3300046499 Bacteria 2202
300 Ga0495618_0445726 3300046514 Bacteria 786
301 Ga0495628_0590155 3300046516 Bacteria 794
302 Ga0495628_0636477 3300046516 Bacteria 758
303 Ga0495630_0706602 3300046517 Bacteria 771
304 Ga0495665_0069566 3300046531 Bacteria 1855
305 Ga0495640_0255050 3300046533 Bacteria 1097
306 Ga0495587_0370257 3300046536 Bacteria 797
307 Ga0495587_0397439 3300046536 Bacteria 766
308 Ga0495667_0076745 3300046559 Bacteria 2174
309 Ga0495667_0964183 3300046559 Unclassified 521
310 Ga0495635_0113062 3300046663 Bacteria 1854
311 Ga0495635_0478786 3300046663 Bacteria 821
312 Ga0495599_0053275 3300046678 Bacteria 2535
313 Ga0495658_0557661 3300046683 Bacteria 734
314 Ga0495624_0493283 3300046690 Bacteria 733
315 Ga0495581_0375549 3300047315 Unclassified 830
316 Ga0495604_0137156 3300047317 Bacteria 1752
317 Ga0495604_0375965 3300047317 Bacteria 939
318 Ga0495604_1011704 3300047317 Bacteria 514
319 Ga0495676_0776198 3300047321 Unclassified 618
320 Ga0495680_0274244 3300047322 Bacteria 1190
321 Ga0495602_0275005 3300048088 Bacteria 1243
322 Ga0495602_0371665 3300048088 Bacteria 1026
323 Ga0495602_1011526 3300048088 Bacteria 548
324 Ga0496115_0565766 3300048918 Bacteria 907
325 Ga0501031_0576626 3300049568 Bacteria 724
326 Ga0501034_0277722 3300049571 Bacteria 1615
327 Ga0501034_1454722 3300049571 Bacteria 560
328 Ga0501036_0996261 3300049572 Bacteria 686
329 Ga0501036_1160245 3300049572 Bacteria 630
330 Ga0501038_1187863 3300049574 Bacteria 554
331 Ga0501040_1144871 3300049576 Bacteria 564
332 Ga0501042_0547324 3300049578 Bacteria 841
333 Ga0501068_0735349 3300049584 Bacteria 646
334 Ga0501071_0767649 3300049587 Bacteria 743
335 Ga0501074_0287446 3300049590 Bacteria 1169
336 Ga0501075_0884418 3300049591 Bacteria 679
337 Ga0501077_0915678 3300049593 Bacteria 564
338 Ga0501079_0167808 3300049741 Bacteria 1712
339 Ga0501081_0504892 3300049743 Bacteria 901
340 Ga0501045_0166628 3300049824 Bacteria 1641
341 nmdc:mga05p37_21012_c1 3300050507 Bacteria 7901
342 nmdc:mga05p37_5046_c1 3300050507 Bacteria 15471
343 nmdc:mga09592_10597_c1 3300050508 Bacteria 7505
344 nmdc:mga09592_1532663_c1 3300050508 Unclassified 541
345 nmdc:mga0qj67_217271_c1 3300050509 Bacteria 1552
346 nmdc:mga0qj67_496432_c1 3300050509 Bacteria 981
347 nmdc:mga06r32_89238_c1 3300050510 Bacteria 3010
348 nmdc:mga08y16_27594_c1 3300050511 Bacteria 5982
349 nmdc:mga0n895_1068451_c1 3300050512 Bacteria 786
350 nmdc:mga0n895_196275_c1 3300050512 Bacteria 2050
351 nmdc:mga0n895_33_c1 3300050512 Bacteria 80749
352 nmdc:mga0n895_406936_c1 3300050512 Bacteria 1376
353 nmdc:mga0rr50_1324812_c1 3300050513 Bacteria 610
354 nmdc:mga0rr50_17745_c1 3300050513 Bacteria 4761
355 nmdc:mga0rr50_1_c1 3300050513 Bacteria 558123
356 nmdc:mga08x19_143286_c1 3300050514 Bacteria 1615
357 nmdc:mga08x19_396_c1 3300050514 Bacteria 30660
358 nmdc:mga0a205_19772_c1 3300050515 Bacteria 6355
359 nmdc:mga0a205_391164_c1 3300050515 Bacteria 1255
360 Ga0495595_0267606 3300053084 Bacteria 857
361 Ga0495619_0091358 3300053085 Bacteria 2061
362 Ga0495619_0094376 3300053085 Bacteria 2029
363 Ga0501084_0294691 3300054114 Bacteria 1370
364 Ga0501084_0801403 3300054114 Bacteria 793
365 Ga0590077_053185 3300059426 Bacteria 911
366 Ga0501082_0255022 3300060353 Bacteria 1526
367 Ga0530510_0117931 3300061734 Bacteria 1947
368 Ga0530510_1597742 3300061734 Bacteria 501

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005536 Ga0070697_101372090 Ga0070697_1013720901 89
2 3300009148 Ga0105243_12367703 Ga0105243_123677031 91
3 3300009177 Ga0105248_11901178 Ga0105248_119011781 93
4 3300047321 Ga0495676_0776198 Ga0495676_0776198_11_295 94
5 3300045049 Ga0466959_1072864 Ga0466959_1072864_147_437 96
6 3300004799 Ga0058863_11110530 Ga0058863_111105301 98
7 3300005327 Ga0070658_10122159 Ga0070658_101221592 98
8 3300005327 Ga0070658_10957977 Ga0070658_109579771 98
9 3300005329 Ga0070683_100037334 Ga0070683_1000373343 98
10 3300005329 Ga0070683_100131935 Ga0070683_1001319352 98
11 3300005329 Ga0070683_100458477 Ga0070683_1004584772 98
12 3300005329 Ga0070683_101499326 Ga0070683_1014993262 98
13 3300005329 Ga0070683_101769862 Ga0070683_1017698621 98
14 3300005330 Ga0070690_100054657 Ga0070690_1000546573 98
15 3300005330 Ga0070690_100653827 Ga0070690_1006538272 98
16 3300005331 Ga0070670_101538859 Ga0070670_1015388592 98
17 3300005334 Ga0068869_101250328 Ga0068869_1012503281 98
18 3300005335 Ga0070666_10032815 Ga0070666_100328153 98
19 3300005335 Ga0070666_10602109 Ga0070666_106021091 98
20 3300005335 Ga0070666_10767948 Ga0070666_107679481 98
21 3300005336 Ga0070680_100285512 Ga0070680_1002855122 98
22 3300005337 Ga0070682_101418607 Ga0070682_1014186071 98
23 3300005338 Ga0068868_100029515 Ga0068868_1000295155 98
24 3300005339 Ga0070660_100290168 Ga0070660_1002901682 98
25 3300005365 Ga0070688_100377567 Ga0070688_1003775671 98
26 3300005366 Ga0070659_100015800 Ga0070659_1000158002 98
27 3300005367 Ga0070667_100268931 Ga0070667_1002689312 98
28 3300005435 Ga0070714_100037458 Ga0070714_1000374583 98
29 3300005435 Ga0070714_101537582 Ga0070714_1015375822 98
30 3300005436 Ga0070713_102311122 Ga0070713_1023111221 98
31 3300005440 Ga0070705_100024122 Ga0070705_1000241226 98
32 3300005440 Ga0070705_101817311 Ga0070705_1018173111 98
33 3300005444 Ga0070694_100046220 Ga0070694_1000462201 98
34 3300005444 Ga0070694_101679295 Ga0070694_1016792952 98
35 3300005445 Ga0070708_100185779 Ga0070708_1001857792 98
36 3300005445 Ga0070708_100582621 Ga0070708_1005826212 98
37 3300005455 Ga0070663_101501130 Ga0070663_1015011302 98
38 3300005458 Ga0070681_10253650 Ga0070681_102536502 98
39 3300005459 Ga0068867_100103154 Ga0068867_1001031542 98
40 3300005459 Ga0068867_100632763 Ga0068867_1006327632 98
41 3300005467 Ga0070706_100717568 Ga0070706_1007175682 98
42 3300005467 Ga0070706_100997971 Ga0070706_1009979712 98
43 3300005467 Ga0070706_101059793 Ga0070706_1010597932 98
44 3300005471 Ga0070698_100029612 Ga0070698_1000296126 98
45 3300005471 Ga0070698_100923745 Ga0070698_1009237451 98
46 3300005471 Ga0070698_102083418 Ga0070698_1020834182 98
47 3300005518 Ga0070699_100009631 Ga0070699_1000096316 98
48 3300005518 Ga0070699_100066211 Ga0070699_1000662112 98
49 3300005518 Ga0070699_100369397 Ga0070699_1003693971 98
50 3300005518 Ga0070699_100388091 Ga0070699_1003880912 98
51 3300005518 Ga0070699_101175755 Ga0070699_1011757552 98
52 3300005530 Ga0070679_100061928 Ga0070679_1000619282 98
53 3300005530 Ga0070679_100542563 Ga0070679_1005425631 98
54 3300005530 Ga0070679_101193342 Ga0070679_1011933421 98
55 3300005535 Ga0070684_100159481 Ga0070684_1001594812 98
56 3300005535 Ga0070684_100258099 Ga0070684_1002580992 98
57 3300005535 Ga0070684_100702557 Ga0070684_1007025572 98
58 3300005535 Ga0070684_101158837 Ga0070684_1011588372 98
59 3300005536 Ga0070697_100079631 Ga0070697_1000796316 98
60 3300005539 Ga0068853_100446667 Ga0068853_1004466672 98
61 3300005539 Ga0068853_101901648 Ga0068853_1019016482 98
62 3300005544 Ga0070686_101218309 Ga0070686_1012183091 98
63 3300005546 Ga0070696_100010232 Ga0070696_1000102322 98
64 3300005546 Ga0070696_100019685 Ga0070696_1000196852 98
65 3300005546 Ga0070696_101040246 Ga0070696_1010402461 98
66 3300005548 Ga0070665_100407567 Ga0070665_1004075672 98
67 3300005549 Ga0070704_101812374 Ga0070704_1018123742 98
68 3300005563 Ga0068855_100120236 Ga0068855_1001202366 98
69 3300005563 Ga0068855_100320987 Ga0068855_1003209872 98
70 3300005564 Ga0070664_100422220 Ga0070664_1004222201 98
71 3300005577 Ga0068857_100041369 Ga0068857_1000413692 98
72 3300005577 Ga0068857_100062780 Ga0068857_1000627802 98
73 3300005614 Ga0068856_100140576 Ga0068856_1001405762 98
74 3300005614 Ga0068856_100463090 Ga0068856_1004630902 98
75 3300005616 Ga0068852_100700923 Ga0068852_1007009232 98
76 3300005617 Ga0068859_100016513 Ga0068859_1000165134 98
77 3300005617 Ga0068859_101656500 Ga0068859_1016565002 98
78 3300005617 Ga0068859_101860479 Ga0068859_1018604792 98
79 3300005617 Ga0068859_102485090 Ga0068859_1024850902 98
80 3300005618 Ga0068864_100005621 Ga0068864_1000056213 98
81 3300005618 Ga0068864_100325835 Ga0068864_1003258352 98
82 3300005618 Ga0068864_100830077 Ga0068864_1008300772 98
83 3300005718 Ga0068866_10196681 Ga0068866_101966812 98
84 3300005840 Ga0068870_11321358 Ga0068870_113213582 98
85 3300005841 Ga0068863_100774647 Ga0068863_1007746472 98
86 3300005841 Ga0068863_101963328 Ga0068863_1019633282 98
87 3300005841 Ga0068863_102005625 Ga0068863_1020056252 98
88 3300005842 Ga0068858_100007173 Ga0068858_1000071739 98
89 3300005842 Ga0068858_100822278 Ga0068858_1008222782 98
90 3300005843 Ga0068860_100004892 Ga0068860_1000048926 98
91 3300005843 Ga0068860_101489811 Ga0068860_1014898112 98
92 3300005937 Ga0081455_10007016 Ga0081455_1000701611 98
93 3300006237 Ga0097621_100015771 Ga0097621_1000157714 98
94 3300006237 Ga0097621_100177416 Ga0097621_1001774162 98
95 3300006237 Ga0097621_100360905 Ga0097621_1003609052 98
96 3300006237 Ga0097621_101041172 Ga0097621_1010411721 98
97 3300006237 Ga0097621_101855785 Ga0097621_1018557852 98
98 3300006358 Ga0068871_100040514 Ga0068871_1000405144 98
99 3300006358 Ga0068871_100278007 Ga0068871_1002780072 98
100 3300006358 Ga0068871_100339742 Ga0068871_1003397422 98
101 3300006844 Ga0075428_100049839 Ga0075428_1000498394 98
102 3300006844 Ga0075428_101635720 Ga0075428_1016357201 98
103 3300006844 Ga0075428_102560624 Ga0075428_1025606242 98
104 3300006846 Ga0075430_100563415 Ga0075430_1005634151 98
105 3300006847 Ga0075431_100381486 Ga0075431_1003814863 98
106 3300006852 Ga0075433_10094549 Ga0075433_100945492 98
107 3300006852 Ga0075433_10493895 Ga0075433_104938952 98
108 3300006852 Ga0075433_10517611 Ga0075433_105176112 98
109 3300006871 Ga0075434_100001875 Ga0075434_1000018755 98
110 3300006871 Ga0075434_100140069 Ga0075434_1001400692 98
111 3300006871 Ga0075434_100341424 Ga0075434_1003414242 98
112 3300006871 Ga0075434_101620890 Ga0075434_1016208901 98
113 3300006880 Ga0075429_100372331 Ga0075429_1003723312 98
114 3300006880 Ga0075429_100905387 Ga0075429_1009053872 98
115 3300006881 Ga0068865_100280368 Ga0068865_1002803681 98
116 3300006881 Ga0068865_101166592 Ga0068865_1011665922 98
117 3300006914 Ga0075436_100000567 Ga0075436_10000056714 98
118 3300006914 Ga0075436_100107785 Ga0075436_1001077852 98
119 3300006914 Ga0075436_100118123 Ga0075436_1001181232 98
120 3300006931 Ga0097620_100016515 Ga0097620_1000165154 98
121 3300006931 Ga0097620_101656511 Ga0097620_1016565112 98
122 3300006931 Ga0097620_101860206 Ga0097620_1018602062 98
123 3300006931 Ga0097620_102484612 Ga0097620_1024846122 98
124 3300007076 Ga0075435_100000423 Ga0075435_10000042318 98
125 3300007076 Ga0075435_100016941 Ga0075435_1000169413 98
126 3300007076 Ga0075435_100220624 Ga0075435_1002206243 98
127 3300007265 Ga0099794_10051530 Ga0099794_100515302 98
128 3300007265 Ga0099794_10146650 Ga0099794_101466502 98
129 3300007265 Ga0099794_10286785 Ga0099794_102867852 98
130 3300009093 Ga0105240_10084800 Ga0105240_100848002 98
131 3300009093 Ga0105240_10138560 Ga0105240_101385604 98
132 3300009093 Ga0105240_10907249 Ga0105240_109072492 98
133 3300009093 Ga0105240_11122455 Ga0105240_111224552 98
134 3300009093 Ga0105240_11184393 Ga0105240_111843931 98
135 3300009094 Ga0111539_10050552 Ga0111539_100505522 98
136 3300009098 Ga0105245_10012991 Ga0105245_100129914 98
137 3300009098 Ga0105245_10075714 Ga0105245_100757145 98
138 3300009098 Ga0105245_11345337 Ga0105245_113453371 98
139 3300009101 Ga0105247_10059570 Ga0105247_100595703 98
140 3300009147 Ga0114129_10018829 Ga0114129_100188296 98
141 3300009147 Ga0114129_10031638 Ga0114129_100316386 98
142 3300009147 Ga0114129_11007370 Ga0114129_110073702 98
143 3300009148 Ga0105243_10181831 Ga0105243_101818311 98
144 3300009148 Ga0105243_10570547 Ga0105243_105705471 98
145 3300009148 Ga0105243_10732794 Ga0105243_107327942 98
146 3300009174 Ga0105241_10828902 Ga0105241_108289022 98
147 3300009174 Ga0105241_11164551 Ga0105241_111645512 98
148 3300009176 Ga0105242_10211471 Ga0105242_102114712 98
149 3300009176 Ga0105242_10337279 Ga0105242_103372791 98
150 3300009176 Ga0105242_10656492 Ga0105242_106564922 98
151 3300009177 Ga0105248_10021036 Ga0105248_100210369 98
152 3300009177 Ga0105248_10193247 Ga0105248_101932472 98
153 3300009177 Ga0105248_11939271 Ga0105248_119392712 98
154 3300009545 Ga0105237_10003745 Ga0105237_1000374518 98
155 3300009545 Ga0105237_10188156 Ga0105237_101881562 98
156 3300009545 Ga0105237_10357864 Ga0105237_103578642 98
157 3300009545 Ga0105237_10835256 Ga0105237_108352562 98
158 3300009551 Ga0105238_10019644 Ga0105238_100196448 98
159 3300009551 Ga0105238_10156300 Ga0105238_101563005 98
160 3300009551 Ga0105238_10191477 Ga0105238_101914772 98
161 3300009553 Ga0105249_10128823 Ga0105249_101288234 98
162 3300009553 Ga0105249_10462261 Ga0105249_104622612 98
163 3300010375 Ga0105239_10136560 Ga0105239_101365604 98
164 3300010375 Ga0105239_10503113 Ga0105239_105031132 98
165 3300010375 Ga0105239_10546653 Ga0105239_105466532 98
166 3300010375 Ga0105239_10766739 Ga0105239_107667392 98
167 3300011119 Ga0105246_10062619 Ga0105246_100626192 98
168 3300013104 Ga0157370_10130592 Ga0157370_101305922 98
169 3300013105 Ga0157369_10227534 Ga0157369_102275341 98
170 3300013296 Ga0157374_10147859 Ga0157374_101478593 98
171 3300013296 Ga0157374_11075065 Ga0157374_110750652 98
172 3300013297 Ga0157378_10058110 Ga0157378_100581102 98
173 3300013306 Ga0163162_10070248 Ga0163162_100702482 98
174 3300013306 Ga0163162_10215669 Ga0163162_102156692 98
175 3300013306 Ga0163162_10573797 Ga0163162_105737972 98
176 3300013307 Ga0157372_10185963 Ga0157372_101859633 98
177 3300013307 Ga0157372_10456653 Ga0157372_104566532 98
178 3300013307 Ga0157372_10568372 Ga0157372_105683722 98
179 3300013307 Ga0157372_10839105 Ga0157372_108391052 98
180 3300013308 Ga0157375_10114617 Ga0157375_101146172 98
181 3300013308 Ga0157375_10377595 Ga0157375_103775951 98
182 3300014325 Ga0163163_10010016 Ga0163163_100100169 98
183 3300014325 Ga0163163_10032293 Ga0163163_100322934 98
184 3300014325 Ga0163163_10100833 Ga0163163_101008333 98
185 3300014325 Ga0163163_10253230 Ga0163163_102532302 98
186 3300014968 Ga0157379_10022224 Ga0157379_100222245 98
187 3300014968 Ga0157379_10231110 Ga0157379_102311102 98
188 3300014968 Ga0157379_10338121 Ga0157379_103381212 98
189 3300014969 Ga0157376_10043045 Ga0157376_100430452 98
190 3300014969 Ga0157376_10565531 Ga0157376_105655312 98
191 3300020070 Ga0206356_10391455 Ga0206356_103914552 98
192 3300020075 Ga0206349_1418717 Ga0206349_14187171 98
193 3300020077 Ga0206351_10859780 Ga0206351_108597802 98
194 3300020080 Ga0206350_11088956 Ga0206350_110889561 98
195 3300020080 Ga0206350_11293820 Ga0206350_112938202 98
196 3300020081 Ga0206354_11365870 Ga0206354_113658702 98
197 3300021358 Ga0213873_10101520 Ga0213873_101015202 98
198 3300021377 Ga0213874_10013455 Ga0213874_100134552 98
199 3300022467 Ga0224712_10569047 Ga0224712_105690472 98
200 3300025900 Ga0207710_10068438 Ga0207710_100684382 98
201 3300025903 Ga0207680_10027054 Ga0207680_100270542 98
202 3300025908 Ga0207643_11107969 Ga0207643_111079691 98
203 3300025909 Ga0207705_10763312 Ga0207705_107633122 98
204 3300025910 Ga0207684_10279021 Ga0207684_102790213 98
205 3300025910 Ga0207684_10291020 Ga0207684_102910202 98
206 3300025910 Ga0207684_10971778 Ga0207684_109717781 98
207 3300025911 Ga0207654_10292208 Ga0207654_102922082 98
208 3300025912 Ga0207707_10006077 Ga0207707_1000607712 98
209 3300025913 Ga0207695_10119403 Ga0207695_101194034 98
210 3300025913 Ga0207695_11153436 Ga0207695_111534362 98
211 3300025914 Ga0207671_10132763 Ga0207671_101327632 98
212 3300025914 Ga0207671_10189707 Ga0207671_101897072 98
213 3300025916 Ga0207663_11337147 Ga0207663_113371472 98
214 3300025917 Ga0207660_10180438 Ga0207660_101804382 98
215 3300025919 Ga0207657_10169009 Ga0207657_101690092 98
216 3300025919 Ga0207657_10539597 Ga0207657_105395972 98
217 3300025920 Ga0207649_11190929 Ga0207649_111909292 98
218 3300025921 Ga0207652_10109990 Ga0207652_101099902 98
219 3300025921 Ga0207652_10440701 Ga0207652_104407012 98
220 3300025922 Ga0207646_10050003 Ga0207646_100500036 98
221 3300025922 Ga0207646_11444620 Ga0207646_114446201 98
222 3300025924 Ga0207694_10013385 Ga0207694_100133856 98
223 3300025924 Ga0207694_10359999 Ga0207694_103599993 98
224 3300025927 Ga0207687_10075083 Ga0207687_100750832 98
225 3300025927 Ga0207687_10119110 Ga0207687_101191102 98
226 3300025927 Ga0207687_11088139 Ga0207687_110881392 98
227 3300025928 Ga0207700_11692710 Ga0207700_116927102 98
228 3300025929 Ga0207664_10135925 Ga0207664_101359252 98
229 3300025932 Ga0207690_10460280 Ga0207690_104602802 98
230 3300025933 Ga0207706_10511801 Ga0207706_105118012 98
231 3300025934 Ga0207686_10013611 Ga0207686_100136115 98
232 3300025934 Ga0207686_10235320 Ga0207686_102353202 98
233 3300025935 Ga0207709_10247908 Ga0207709_102479082 98
234 3300025938 Ga0207704_10035240 Ga0207704_100352402 98
235 3300025941 Ga0207711_10012862 Ga0207711_100128629 98
236 3300025941 Ga0207711_10389343 Ga0207711_103893433 98
237 3300025941 Ga0207711_10931639 Ga0207711_109316392 98
238 3300025942 Ga0207689_10537880 Ga0207689_105378802 98
239 3300025944 Ga0207661_10047206 Ga0207661_100472063 98
240 3300025944 Ga0207661_10066057 Ga0207661_100660572 98
241 3300025945 Ga0207679_10421597 Ga0207679_104215972 98
242 3300025949 Ga0207667_10278249 Ga0207667_102782492 98
243 3300025949 Ga0207667_10538020 Ga0207667_105380202 98
244 3300025960 Ga0207651_11307438 Ga0207651_113074381 98
245 3300025961 Ga0207712_10178822 Ga0207712_101788222 98
246 3300025961 Ga0207712_10683103 Ga0207712_106831032 98
247 3300026023 Ga0207677_10003956 Ga0207677_100039566 98
248 3300026035 Ga0207703_10004915 Ga0207703_100049156 98
249 3300026035 Ga0207703_10139012 Ga0207703_101390124 98
250 3300026041 Ga0207639_10070338 Ga0207639_100703382 98
251 3300026041 Ga0207639_11515630 Ga0207639_115156301 98
252 3300026041 Ga0207639_11974480 Ga0207639_119744802 98
253 3300026067 Ga0207678_10860735 Ga0207678_108607352 98
254 3300026078 Ga0207702_10370032 Ga0207702_103700322 98
255 3300026088 Ga0207641_10064927 Ga0207641_100649272 98
256 3300026088 Ga0207641_10455556 Ga0207641_104555561 98
257 3300026095 Ga0207676_10004080 Ga0207676_100040809 98
258 3300026095 Ga0207676_10506415 Ga0207676_105064152 98
259 3300026116 Ga0207674_10144046 Ga0207674_101440463 98
260 3300026116 Ga0207674_10415053 Ga0207674_104150532 98
261 3300026121 Ga0207683_11075277 Ga0207683_110752772 98
262 3300026142 Ga0207698_10153462 Ga0207698_101534622 98
263 3300028380 Ga0268265_10327709 Ga0268265_103277092 98
264 3300028381 Ga0268264_10592155 Ga0268264_105921552 98
265 3300028800 Ga0265338_11068331 Ga0265338_110683312 98
266 3300031250 Ga0265331_10409690 Ga0265331_104096902 98
267 3300031344 Ga0265316_10002488 Ga0265316_100024886 98
268 3300031711 Ga0265314_10335481 Ga0265314_103354811 98
269 3300032126 Ga0307415_101397849 Ga0307415_1013978491 98
270 3300035117 Ga0373953_0297889 Ga0373953_0297889_154_450 98
271 3300035120 Ga0373957_0454232 Ga0373957_0454232_38_334 98
272 3300035170 Ga0373943_0367749 Ga0373943_0367749_321_617 98
273 3300035172 Ga0373955_0528851 Ga0373955_0528851_209_505 98
274 3300035692 Ga0373935_1040687 Ga0373935_1040687_226_522 98
275 3300035695 Ga0373927_0357868 Ga0373927_0357868_38_334 98
276 3300035695 Ga0373927_0704015 Ga0373927_0704015_156_452 98
277 3300036401 Ga0373937_0438199 Ga0373937_0438199_823_1119 98
278 3300036712 Ga0316584_0582547 Ga0316584_0582547_49_348 98
279 3300037068 Ga0373925_0533301 Ga0373925_0533301_346_642 98
280 3300037418 Ga0395900_0004122 Ga0395900_0004122_6550_6846 98
281 3300037466 Ga0395898_0022195 Ga0395898_0022195_931_1227 98
282 3300037853 Ga0436364_0763039 Ga0436364_0763039_10020_10316 98
283 3300038443 Ga0395901_0001693 Ga0395901_0001693_14033_14329 98
284 3300039437 Ga0436365_0939506 Ga0436365_0939506_56_352 98
285 3300039438 Ga0436360_0626462 Ga0436360_0626462_66_362 98
286 3300039438 Ga0436360_1216712 Ga0436360_1216712_219_515 98
287 3300039447 Ga0436361_0477361 Ga0436361_0477361_56_352 98
288 3300039450 Ga0436363_1214992 Ga0436363_1214992_5053_5349 98
289 3300039450 Ga0436363_1616419 Ga0436363_1616419_414_722 98
290 3300039453 Ga0436362_1056144 Ga0436362_1056144_1742_2038 98
291 3300044656 Ga0466969_0043560 Ga0466969_0043560_1313_1654 98
292 3300044684 Ga0466966_0043604 Ga0466966_0043604_505_846 98
293 3300044694 Ga0466963_0419811 Ga0466963_0419811_231_527 98
294 3300045049 Ga0466959_0003376 Ga0466959_0003376_2169_2528 98
295 3300045049 Ga0466959_0302949 Ga0466959_0302949_156_452 98
296 3300045051 Ga0451576_0317118 Ga0451576_0317118_133_429 98
297 3300046459 Ga0495629_0549773 Ga0495629_0549773_39_335 98
298 3300046472 Ga0495580_0002762 Ga0495580_0002762_3510_3806 98
299 3300046472 Ga0495580_0175286 Ga0495580_0175286_700_996 98
300 3300046499 Ga0495594_0054601 Ga0495594_0054601_1821_2117 98
301 3300046514 Ga0495618_0445726 Ga0495618_0445726_438_734 98
302 3300046516 Ga0495628_0590155 Ga0495628_0590155_247_543 98
303 3300046516 Ga0495628_0636477 Ga0495628_0636477_312_608 98
304 3300046517 Ga0495630_0706602 Ga0495630_0706602_245_541 98
305 3300046531 Ga0495665_0069566 Ga0495665_0069566_827_1123 98
306 3300046533 Ga0495640_0255050 Ga0495640_0255050_517_813 98
307 3300046536 Ga0495587_0370257 Ga0495587_0370257_44_340 98
308 3300046536 Ga0495587_0397439 Ga0495587_0397439_359_655 98
309 3300046559 Ga0495667_0076745 Ga0495667_0076745_1405_1701 98
310 3300046559 Ga0495667_0964183 Ga0495667_0964183_196_492 98
311 3300046663 Ga0495635_0113062 Ga0495635_0113062_595_891 98
312 3300046663 Ga0495635_0478786 Ga0495635_0478786_393_689 98
313 3300046678 Ga0495599_0053275 Ga0495599_0053275_1179_1475 98
314 3300046683 Ga0495658_0557661 Ga0495658_0557661_261_557 98
315 3300046690 Ga0495624_0493283 Ga0495624_0493283_353_649 98
316 3300047315 Ga0495581_0375549 Ga0495581_0375549_35_331 98
317 3300047317 Ga0495604_0137156 Ga0495604_0137156_1174_1470 98
318 3300047317 Ga0495604_0375965 Ga0495604_0375965_559_855 98
319 3300047317 Ga0495604_1011704 Ga0495604_1011704_45_341 98
320 3300047322 Ga0495680_0274244 Ga0495680_0274244_15_311 98
321 3300048088 Ga0495602_0275005 Ga0495602_0275005_435_731 98
322 3300048088 Ga0495602_0371665 Ga0495602_0371665_503_799 98
323 3300048088 Ga0495602_1011526 Ga0495602_1011526_110_406 98
324 3300048918 Ga0496115_0565766 Ga0496115_0565766_543_839 98
325 3300049568 Ga0501031_0576626 Ga0501031_0576626_157_453 98
326 3300049571 Ga0501034_0277722 Ga0501034_0277722_38_355 98
327 3300049571 Ga0501034_1454722 Ga0501034_1454722_219_515 98
328 3300049572 Ga0501036_0996261 Ga0501036_0996261_171_467 98
329 3300049572 Ga0501036_1160245 Ga0501036_1160245_115_420 98
330 3300049574 Ga0501038_1187863 Ga0501038_1187863_111_407 98
331 3300049576 Ga0501040_1144871 Ga0501040_1144871_143_439 98
332 3300049578 Ga0501042_0547324 Ga0501042_0547324_447_743 98
333 3300049584 Ga0501068_0735349 Ga0501068_0735349_75_371 98
334 3300049587 Ga0501071_0767649 Ga0501071_0767649_278_574 98
335 3300049590 Ga0501074_0287446 Ga0501074_0287446_450_755 98
336 3300049591 Ga0501075_0884418 Ga0501075_0884418_171_467 98
337 3300049593 Ga0501077_0915678 Ga0501077_0915678_222_518 98
338 3300049741 Ga0501079_0167808 Ga0501079_0167808_1165_1461 98
339 3300049743 Ga0501081_0504892 Ga0501081_0504892_481_777 98
340 3300049824 Ga0501045_0166628 Ga0501045_0166628_1012_1317 98
341 3300050507 nmdc:mga05p37_21012_c1 nmdc:mga05p37_21012_c1_3949_4245 98
342 3300050507 nmdc:mga05p37_5046_c1 nmdc:mga05p37_5046_c1_7861_8157 98
343 3300050508 nmdc:mga09592_10597_c1 nmdc:mga09592_10597_c1_3362_3658 98
344 3300050508 nmdc:mga09592_1532663_c1 nmdc:mga09592_1532663_c1_220_516 98
345 3300050509 nmdc:mga0qj67_217271_c1 nmdc:mga0qj67_217271_c1_255_551 98
346 3300050509 nmdc:mga0qj67_496432_c1 nmdc:mga0qj67_496432_c1_14_310 98
347 3300050510 nmdc:mga06r32_89238_c1 nmdc:mga06r32_89238_c1_2512_2808 98
348 3300050511 nmdc:mga08y16_27594_c1 nmdc:mga08y16_27594_c1_2166_2462 98
349 3300050512 nmdc:mga0n895_1068451_c1 nmdc:mga0n895_1068451_c1_329_625 98
350 3300050512 nmdc:mga0n895_196275_c1 nmdc:mga0n895_196275_c1_706_1002 98
351 3300050512 nmdc:mga0n895_33_c1 nmdc:mga0n895_33_c1_29268_29564 98
352 3300050512 nmdc:mga0n895_406936_c1 nmdc:mga0n895_406936_c1_909_1205 98
353 3300050513 nmdc:mga0rr50_1324812_c1 nmdc:mga0rr50_1324812_c1_34_330 98
354 3300050513 nmdc:mga0rr50_17745_c1 nmdc:mga0rr50_17745_c1_2844_3140 98
355 3300050513 nmdc:mga0rr50_1_c1 nmdc:mga0rr50_1_c1_416537_416833 98
356 3300050514 nmdc:mga08x19_143286_c1 nmdc:mga08x19_143286_c1_581_877 98
357 3300050514 nmdc:mga08x19_396_c1 nmdc:mga08x19_396_c1_17207_17503 98
358 3300050515 nmdc:mga0a205_19772_c1 nmdc:mga0a205_19772_c1_2500_2796 98
359 3300050515 nmdc:mga0a205_391164_c1 nmdc:mga0a205_391164_c1_663_959 98
360 3300053084 Ga0495595_0267606 Ga0495595_0267606_142_438 98
361 3300053085 Ga0495619_0091358 Ga0495619_0091358_1404_1700 98
362 3300053085 Ga0495619_0094376 Ga0495619_0094376_142_438 98
363 3300054114 Ga0501084_0294691 Ga0501084_0294691_732_1037 98
364 3300054114 Ga0501084_0801403 Ga0501084_0801403_49_345 98
365 3300059426 Ga0590077_053185 Ga0590077_053185_185_481 98
366 3300060353 Ga0501082_0255022 Ga0501082_0255022_1095_1391 98
367 3300061734 Ga0530510_0117931 Ga0530510_0117931_734_1030 98
368 3300061734 Ga0530510_1597742 Ga0530510_1597742_148_453 98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hro-assembly1.cif.gz_A crystal structure of h. volcanii small archaeal modifier protein 1 0.8541 3 95
3po0-assembly1.cif.gz_A crystal structure of samp1 from haloferax volcanii 0.8317 3 98
4hro-assembly1.cif.gz_A crystal structure of h. volcanii small archaeal modifier protein 1 0.8109 3 95
3po0-assembly1.cif.gz_A crystal structure of samp1 from haloferax volcanii 0.7989 3 98
4n6e-assembly1.cif.gz_B-2 crystal structure of amycolatopsis orientalis bexx/cyso complex 0.7969 1 98
ID Description Score Start End Superfamily
4hroA00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8541 3 95 3.10.20.30
4hroA00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8109 3 95 3.10.20.30
af_Q6MWY3_4_79_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8087 2 95 3.10.20.30
af_Q54NM8_4_86_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8025 1 98 3.10.20.30
af_Q6MWY3_4_79_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.7997 2 95 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A535NE45-F1-model_v4 MoaD/ThiS family protein 0.9934 1 47
AF-A0A1F8SIJ2-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.9855 1 94
AF-A0A534ZY62-F1-model_v4 MoaD/ThiS family protein 0.985 1 84
AF-A0A3N5W3B6-F1-model_v4 MoaD/ThiS family protein 0.9796 1 67
AF-A0A1G0SXB6-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.9792 1 85

Feature Viewer

pLDDT pTM Quality
92.26 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map