F424476

General Info

Members Datasets Scaffolds Average Seq Length
367 239 365 107

Family's Representative Sequence

Representative Sequence 3300047319|Ga0495674_0025641|Ga0495674_0025641_4546_4941
Length 131
Sequence METRVRQRSLVRLSHPANQPTDLSQMSWTLLSIAGIFEIAFAFGMKWSEGFTRLMPALFTVGTGLSSVFLLSLSLRTLPVGTGYAVWTGIGAAGTAILGMAVLGDSAAPMRLLCIALILAGVIGLKLVSVT

Samples

Sample ID Description Type Environment
1 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
2 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
8 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
25 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
26 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
27 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
28 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
29 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
30 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
31 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
32 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
33 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
39 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
40 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
46 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
47 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
48 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
49 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
50 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
51 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
52 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
55 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
56 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
58 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
59 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
61 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
62 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
66 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
92 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
93 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
94 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
95 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
96 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
97 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
98 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
99 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
100 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
101 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
102 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
103 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
104 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
105 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
106 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
107 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
108 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
109 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
110 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
111 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
112 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
113 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
114 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
115 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
116 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
117 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
118 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
119 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
120 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
121 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
122 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
123 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
124 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
125 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
126 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
127 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
128 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
129 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
130 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
131 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
132 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
133 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
134 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
135 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
136 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
137 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
138 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
139 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
140 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
141 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
142 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
143 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
144 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
145 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
146 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
147 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
148 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
149 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
150 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
151 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
152 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
153 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
154 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
155 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
156 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
157 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
158 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
159 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
160 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
161 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
162 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
163 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
164 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
165 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
166 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
167 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
168 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
169 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
170 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
171 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
172 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
173 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
174 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
175 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
176 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
177 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
182 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
183 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
184 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
185 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
186 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
187 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
188 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
189 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
190 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
191 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
192 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
193 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
194 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
195 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
196 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
197 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
198 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
199 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
200 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
201 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
202 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
204 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
205 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
206 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
207 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
208 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
209 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
210 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
211 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
212 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
213 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
214 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
215 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
216 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
217 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
218 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
219 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
220 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
221 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
222 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
223 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
224 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
225 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
226 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
227 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
228 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
229 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
230 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
231 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
232 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
233 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
234 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
235 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
236 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
237 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
238 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
239 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.46
Metatranscriptomes 0
Isolates 0.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.89
Nodule 0
Rhizoplane 7.63
Rhizosphere 61.31
Stem 0
Stem Tuber 0
Unclassified 14.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1000059 3300002705 Bacteria 86130
2 JGI25162J39368_1003795 3300002737 Bacteria 4014
3 JGI25154J39366_1000056 3300002738 Bacteria 114494
4 JGI25157J39369_1000123 3300002741 Bacteria 65925
5 Ga0055532_1000059 3300003758 Bacteria 152948
6 Ga0055535_1007894 3300003761 Bacteria 1976
7 Ga0070658_11688798 3300005327 Bacteria 548
8 Ga0070677_10140089 3300005333 Bacteria 1114
9 Ga0070666_10416434 3300005335 Bacteria 967
10 Ga0070669_100006637 3300005353 Bacteria 8333
11 Ga0070673_100196587 3300005364 Bacteria 1735
12 Ga0070688_100313013 3300005365 Bacteria 1138
13 Ga0070713_100122648 3300005436 Unclassified 2281
14 Ga0070708_101255612 3300005445 Bacteria 692
15 Ga0070678_100064287 3300005456 Bacteria 2719
16 Ga0070678_100525036 3300005456 Bacteria 1048
17 Ga0070681_10142853 3300005458 Bacteria 2323
18 Ga0070681_10564363 3300005458 Bacteria 1052
19 Ga0070672_100046116 3300005543 Bacteria 3376
20 Ga0070665_100026867 3300005548 Bacteria 5798
21 Ga0070665_100429420 3300005548 Bacteria 1330
22 Ga0068854_100376333 3300005578 Bacteria 1169
23 Ga0068856_100195235 3300005614 Bacteria 2038
24 Ga0068852_100003034 3300005616 Bacteria 11676
25 Ga0075365_10465322 3300006038 Bacteria 893
26 Ga0075364_11093129 3300006051 Bacteria 541
27 Ga0075366_10256276 3300006195 Bacteria 1067
28 Ga0075370_10070891 3300006353 Bacteria 1993
29 Ga0075431_101253467 3300006847 Bacteria 703
30 Ga0068865_101338468 3300006881 Bacteria 638
31 Ga0105251_10115770 3300009011 Bacteria 1219
32 Ga0105244_10031275 3300009036 Bacteria 2825
33 Ga0105241_12527907 3300009174 Bacteria 515
34 Ga0105242_10767245 3300009176 Bacteria 951
35 Ga0105248_10147355 3300009177 Bacteria 2656
36 Ga0105248_10709749 3300009177 Bacteria 1135
37 Ga0105248_11413818 3300009177 Bacteria 787
38 Ga0105237_11152234 3300009545 Bacteria 782
39 Ga0105238_10645242 3300009551 Bacteria 1068
40 Ga0105249_11272528 3300009553 Bacteria 807
41 Ga0105246_10026587 3300011119 Bacteria 3783
42 Ga0157373_10021917 3300013100 Bacteria 4635
43 Ga0157373_10259846 3300013100 Bacteria 1229
44 Ga0157371_10050816 3300013102 Bacteria 2947
45 Ga0157370_10007879 3300013104 Bacteria 11545
46 Ga0157370_10140666 3300013104 Bacteria 2249
47 Ga0163162_12840895 3300013306 Bacteria 557
48 Ga0163163_11990155 3300014325 Bacteria 641
49 Ga0157380_10207229 3300014326 Bacteria 1744
50 Ga0182008_10002182 3300014497 Bacteria 12444
51 Ga0182008_10011027 3300014497 Bacteria 4819
52 Ga0182008_10014203 3300014497 Bacteria 4175
53 Ga0157376_11647084 3300014969 Bacteria 676
54 Ga0182006_1021732 3300015261 Bacteria 2672
55 Ga0182006_1113811 3300015261 Bacteria 947
56 Ga0182007_10007776 3300015262 Bacteria 4457
57 Ga0182007_10110633 3300015262 Bacteria 914
58 Ga0182005_1219690 3300015265 Unclassified 578
59 Ga0163161_10000042 3300017792 Bacteria 135368
60 Ga0163161_10411449 3300017792 Bacteria 1086
61 Ga0209435_100032 3300025206 Bacteria 153068
62 Ga0209672_100149 3300025228 Bacteria 62756
63 Ga0209147_100109 3300025229 Bacteria 153068
64 Ga0207427_100581 3300025231 Bacteria 18457
65 Ga0209437_100180 3300025233 Bacteria 133661
66 Ga0209437_100195 3300025233 Bacteria 121761
67 Ga0209258_100190 3300025242 Bacteria 126878
68 Ga0209646_1000113 3300025246 Bacteria 153068
69 Ga0209026_1000102 3300025250 Bacteria 153068
70 Ga0209026_1003397 3300025250 Bacteria 5251
71 Ga0209026_1019151 3300025250 Bacteria 1075
72 Ga0209148_1015251 3300025254 Bacteria 1345
73 Ga0209759_1000104 3300025256 Bacteria 153068
74 Ga0209759_1002408 3300025256 Bacteria 8234
75 Ga0209233_1014480 3300025261 Bacteria 2220
76 Ga0209455_1006419 3300025272 Bacteria 3473
77 Ga0209455_1006830 3300025272 Bacteria 3318
78 Ga0209675_1003885 3300025291 Bacteria 6875
79 Ga0209676_1015207 3300025292 Bacteria 2844
80 Ga0209025_1000038 3300025294 Bacteria 380508
81 Ga0209025_1026751 3300025294 Bacteria 2884
82 Ga0209050_1011411 3300025298 Bacteria 4217
83 Ga0207697_10292549 3300025315 Bacteria 722
84 Ga0207655_1112114 3300025728 Bacteria 919
85 Ga0207713_1056631 3300025735 Bacteria 1521
86 Ga0207680_10532183 3300025903 Bacteria 838
87 Ga0207645_10794264 3300025907 Bacteria 644
88 Ga0207695_10001990 3300025913 Bacteria 31545
89 Ga0207671_10173282 3300025914 Bacteria 1676
90 Ga0207671_10856954 3300025914 Bacteria 719
91 Ga0207660_10737014 3300025917 Bacteria 804
92 Ga0207681_10028100 3300025923 Bacteria 3642
93 Ga0207694_10039780 3300025924 Bacteria 3619
94 Ga0207694_10201679 3300025924 Bacteria 1619
95 Ga0207686_11555479 3300025934 Unclassified 546
96 Ga0207691_10100234 3300025940 Bacteria 2585
97 Ga0207711_10093121 3300025941 Bacteria 2654
98 Ga0207651_10710630 3300025960 Bacteria 886
99 Ga0207668_10293729 3300025972 Bacteria 1338
100 Ga0207639_10469720 3300026041 Bacteria 1145
101 Ga0207702_10140665 3300026078 Bacteria 2183
102 Ga0207641_10868404 3300026088 Bacteria 895
103 Ga0207648_10145852 3300026089 Bacteria 2088
104 Ga0207674_10452385 3300026116 Bacteria 1241
105 Ga0207675_100426195 3300026118 Bacteria 1311
106 Ga0207683_10085964 3300026121 Bacteria 2796
107 Ga0207683_10297487 3300026121 Bacteria 1476
108 Ga0207698_10011175 3300026142 Bacteria 5808
109 Ga0207698_12295653 3300026142 Bacteria 552
110 Ga0268266_10000987 3300028379 Bacteria 35837
111 Ga0268266_10378708 3300028379 Bacteria 1334
112 Ga0307517_10319860 3300028786 Bacteria 859
113 Ga0307515_10129647 3300028794 Bacteria 2788
114 Ga0307515_10489808 3300028794 Bacteria 841
115 Ga0307515_10885275 3300028794 Bacteria 522
116 Ga0307513_10007102 3300031456 Bacteria 14562
117 Ga0307513_10180628 3300031456 Bacteria 1974
118 Ga0307513_10382169 3300031456 Bacteria 1147
119 Ga0307513_10476285 3300031456 Bacteria 969
120 Ga0307509_10524128 3300031507 Bacteria 866
121 Ga0307408_100192582 3300031548 Bacteria 1644
122 Ga0307408_100911252 3300031548 Bacteria 805
123 Ga0307516_10284838 3300031730 Bacteria 1333
124 Ga0307412_10167310 3300031911 Bacteria 1640
125 Ga0307416_100078275 3300032002 Bacteria 2781
126 Ga0307416_102037680 3300032002 Bacteria 676
127 Ga0307510_10616380 3300033180 Bacteria 539
128 Ga0395900_0091438 3300037418 Bacteria 3127
129 Ga0395898_0065185 3300037466 Bacteria 3532
130 Ga0395901_0421801 3300038443 Bacteria 1368
131 Ga0439466_0064979 3300041411 Bacteria 1170
132 Ga0451789_0293198 3300041443 Bacteria 3518
133 Ga0451793_0629014 3300041452 Bacteria 2668
134 Ga0451797_0348275 3300041453 Bacteria 539
135 Ga0451795_0338133 3300041456 Bacteria 1234
136 Ga0451798_0786215 3300041458 Bacteria 2701
137 Ga0451800_0034565 3300041459 Bacteria 2569
138 Ga0451802_1220744 3300041460 Bacteria 1566
139 Ga0451855_0663656 3300041511 Bacteria 840
140 Ga0451853_1118044 3300041512 Bacteria 626
141 Ga0450908_000020 3300042184 Bacteria 37390
142 Ga0495603_0001298 3300046455 Bacteria 14539
143 Ga0495603_0006630 3300046455 Bacteria 6946
144 Ga0495629_0007166 3300046459 Bacteria 8213
145 Ga0495638_0000009 3300046460 Bacteria 525345
146 Ga0495638_0021911 3300046460 Bacteria 4200
147 Ga0495638_0077334 3300046460 Bacteria 2026
148 Ga0495653_0000048 3300046463 Bacteria 109560
149 Ga0495653_0812851 3300046463 Bacteria 561
150 Ga0495650_0005519 3300046471 Bacteria 8174
151 Ga0495650_0013906 3300046471 Bacteria 4226
152 Ga0495650_0192980 3300046471 Unclassified 711
153 Ga0495650_0244862 3300046471 Bacteria 611
154 Ga0495580_0000009 3300046472 Bacteria 101827
155 Ga0495580_0005458 3300046472 Bacteria 10510
156 Ga0495580_0008411 3300046472 Bacteria 8209
157 Ga0495580_0063214 3300046472 Bacteria 2596
158 Ga0495582_0005110 3300046473 Bacteria 7350
159 Ga0495582_0042725 3300046473 Bacteria 2496
160 Ga0495605_0002377 3300046474 Bacteria 11681
161 Ga0495605_0005217 3300046474 Bacteria 7575
162 Ga0495605_0009645 3300046474 Bacteria 5423
163 Ga0495639_0023844 3300046475 Bacteria 2691
164 Ga0495584_0153630 3300046491 Bacteria 1169
165 Ga0495594_0310811 3300046499 Bacteria 898
166 Ga0495594_0699102 3300046499 Bacteria 573
167 Ga0495596_0060926 3300046500 Bacteria 1470
168 Ga0495596_0213496 3300046500 Bacteria 749
169 Ga0495583_0004359 3300046506 Bacteria 10200
170 Ga0495583_0263226 3300046506 Bacteria 689
171 Ga0495610_0005285 3300046512 Bacteria 9234
172 Ga0495610_0199806 3300046512 Bacteria 819
173 Ga0495616_0004030 3300046513 Bacteria 9331
174 Ga0495618_0783205 3300046514 Bacteria 556
175 Ga0495620_0028033 3300046515 Bacteria 2625
176 Ga0495620_0105108 3300046515 Unclassified 1123
177 Ga0495620_0152932 3300046515 Bacteria 899
178 Ga0495620_0187106 3300046515 Bacteria 799
179 Ga0495628_0010561 3300046516 Bacteria 7837
180 Ga0495630_0005008 3300046517 Bacteria 9319
181 Ga0495631_0000034 3300046518 Bacteria 84600
182 Ga0495631_0004507 3300046518 Bacteria 7402
183 Ga0495637_0087133 3300046520 Bacteria 1237
184 Ga0495643_0208460 3300046522 Bacteria 934
185 Ga0495644_0051156 3300046523 Bacteria 1551
186 Ga0495648_0020158 3300046524 Bacteria 4662
187 Ga0495648_0048986 3300046524 Bacteria 2594
188 Ga0495648_0110287 3300046524 Bacteria 1498
189 Ga0495648_0366981 3300046524 Bacteria 653
190 Ga0495666_0477409 3300046526 Bacteria 558
191 Ga0495642_0002122 3300046528 Bacteria 8196
192 Ga0495642_0138592 3300046528 Bacteria 1049
193 Ga0495642_0180792 3300046528 Bacteria 918
194 Ga0495652_0749715 3300046529 Bacteria 653
195 Ga0495654_0009859 3300046530 Bacteria 5219
196 Ga0495654_0244887 3300046530 Bacteria 749
197 Ga0495665_0051252 3300046531 Bacteria 2186
198 Ga0495665_0081792 3300046531 Bacteria 1698
199 Ga0495665_0146513 3300046531 Bacteria 1233
200 Ga0495640_0635631 3300046533 Bacteria 643
201 Ga0495621_0000487 3300046539 Bacteria 9778
202 Ga0495645_0006296 3300046543 Bacteria 8231
203 Ga0495622_0000004 3300046557 Bacteria 258984
204 Ga0495622_0017785 3300046557 Bacteria 3309
205 Ga0495622_0066853 3300046557 Bacteria 1661
206 Ga0495633_0006367 3300046558 Bacteria 7011
207 Ga0495667_0056510 3300046559 Bacteria 2581
208 Ga0495668_0029656 3300046616 Bacteria 3090
209 Ga0495668_0345041 3300046616 Bacteria 817
210 Ga0495611_0270887 3300046648 Bacteria 785
211 Ga0495625_0000606 3300046660 Bacteria 52107
212 Ga0495625_0011706 3300046660 Bacteria 7132
213 Ga0495625_0014791 3300046660 Bacteria 6211
214 Ga0495625_0036359 3300046660 Bacteria 3620
215 Ga0495625_0453172 3300046660 Bacteria 792
216 Ga0495625_0549201 3300046660 Bacteria 700
217 Ga0495625_0647100 3300046660 Bacteria 630
218 Ga0495661_0021357 3300046665 Bacteria 4222
219 Ga0495661_0034312 3300046665 Bacteria 3193
220 Ga0495588_0011576 3300046674 Bacteria 4143
221 Ga0495588_0074947 3300046674 Bacteria 1762
222 Ga0495646_0002123 3300046680 Bacteria 12033
223 Ga0495669_0017744 3300046684 Bacteria 3056
224 Ga0495669_0062506 3300046684 Bacteria 1687
225 Ga0495669_0259414 3300046684 Bacteria 835
226 Ga0495613_0048455 3300046689 Bacteria 3138
227 Ga0495613_0135205 3300046689 Bacteria 1764
228 Ga0495624_0001218 3300046690 Bacteria 20272
229 Ga0495624_0003518 3300046690 Bacteria 11613
230 Ga0495671_0017049 3300046692 Bacteria 3869
231 Ga0495671_0079482 3300046692 Bacteria 1607
232 Ga0495671_0086016 3300046692 Bacteria 1540
233 Ga0495671_0122103 3300046692 Bacteria 1271
234 Ga0495671_0231644 3300046692 Bacteria 893
235 Ga0495649_0046686 3300046694 Bacteria 2358
236 Ga0495649_0277016 3300046694 Bacteria 857
237 Ga0495589_0086291 3300046794 Bacteria 1524
238 Ga0495589_0257682 3300046794 Bacteria 814
239 Ga0495660_0157439 3300046810 Bacteria 1117
240 Ga0495660_0467318 3300046810 Bacteria 543
241 Ga0495581_0002591 3300047315 Bacteria 10274
242 Ga0495674_0002157 3300047319 Bacteria 19320
243 Ga0495674_0005831 3300047319 Bacteria 11813
244 Ga0495674_0006867 3300047319 Bacteria 10892
245 Ga0495674_0025641 3300047319 Bacteria 5402
246 Ga0495672_0000346 3300047320 Bacteria 59410
247 Ga0495672_0016459 3300047320 Bacteria 4981
248 Ga0495672_0131535 3300047320 Bacteria 1316
249 Ga0495672_0145159 3300047320 Bacteria 1235
250 Ga0495676_0053231 3300047321 Bacteria 3227
251 Ga0495680_0258381 3300047322 Bacteria 1232
252 Ga0495683_0134088 3300047323 Bacteria 1165
253 Ga0495683_0371603 3300047323 Bacteria 600
254 Ga0495675_0019756 3300047444 Bacteria 4281
255 Ga0495679_000038 3300047446 Bacteria 157311
256 Ga0495673_0000096 3300047469 Bacteria 182792
257 Ga0495673_0018481 3300047469 Bacteria 3512
258 Ga0495673_0030438 3300047469 Bacteria 2534
259 Ga0495681_0046105 3300047470 Bacteria 2081
260 Ga0495686_0000171 3300047472 Bacteria 123194
261 Ga0495686_0090099 3300047472 Bacteria 1863
262 Ga0495686_0097114 3300047472 Bacteria 1782
263 Ga0495686_0268695 3300047472 Bacteria 952
264 Ga0495593_0054924 3300047673 Bacteria 2098
265 Ga0495602_0094941 3300048088 Bacteria 2463
266 Ga0495626_0102965 3300048091 Bacteria 1243
267 Ga0496100_0072993 3300048903 Bacteria 2295
268 Ga0496100_0083249 3300048903 Bacteria 2165
269 Ga0496100_1194525 3300048903 Unclassified 600
270 Ga0496101_0019818 3300048904 Bacteria 4599
271 Ga0496101_0037949 3300048904 Bacteria 3419
272 Ga0496102_0193043 3300048905 Bacteria 1919
273 Ga0496103_0617054 3300048906 Bacteria 690
274 Ga0496104_0055503 3300048907 Bacteria 3746
275 Ga0496104_0092704 3300048907 Bacteria 2888
276 Ga0496105_0018141 3300048908 Bacteria 5650
277 Ga0496105_0151992 3300048908 Bacteria 1902
278 Ga0496106_0055937 3300048909 Bacteria 2983
279 Ga0496110_0025509 3300048913 Bacteria 5052
280 Ga0496111_1205088 3300048914 Bacteria 536
281 Ga0496112_0028589 3300048915 Bacteria 5383
282 Ga0496113_0000910 3300048916 Bacteria 15618
283 Ga0496114_0037251 3300048917 Bacteria 4023
284 Ga0496114_0654513 3300048917 Bacteria 924
285 Ga0496115_0005763 3300048918 Bacteria 9020
286 Ga0496115_0104761 3300048918 Bacteria 2321
287 Ga0496115_1447790 3300048918 Bacteria 505
288 Ga0496116_0084581 3300048919 Bacteria 1953
289 Ga0496117_0066746 3300048920 Bacteria 2438
290 Ga0496117_0249188 3300048920 Bacteria 970
291 Ga0496117_0620832 3300048920 Bacteria 502
292 Ga0496118_0016273 3300048921 Bacteria 6830
293 Ga0496118_0129718 3300048921 Bacteria 1622
294 Ga0496119_0114110 3300048922 Bacteria 1495
295 Ga0496120_0419462 3300048923 Bacteria 588
296 Ga0496121_0029227 3300048924 Bacteria 5105
297 Ga0496121_0032127 3300048924 Bacteria 4778
298 Ga0496121_0075659 3300048924 Bacteria 2688
299 Ga0496121_0080934 3300048924 Bacteria 2572
300 Ga0496121_0309342 3300048924 Bacteria 1069
301 Ga0496121_0642102 3300048924 Bacteria 648
302 Ga0496121_0655398 3300048924 Unclassified 639
303 Ga0496121_0850521 3300048924 Bacteria 530
304 Ga0496122_0258194 3300048925 Bacteria 969
305 Ga0496123_0057017 3300048926 Bacteria 2547
306 Ga0496123_0059325 3300048926 Bacteria 2475
307 Ga0496124_0570867 3300048927 Bacteria 742
308 Ga0496125_0000947 3300048928 Bacteria 45544
309 Ga0496125_0021636 3300048928 Bacteria 5993
310 Ga0496125_0172242 3300048928 Bacteria 1453
311 Ga0496126_0040616 3300048929 Bacteria 4312
312 Ga0496126_0074369 3300048929 Bacteria 3018
313 Ga0496126_0099695 3300048929 Bacteria 2544
314 Ga0496126_0129639 3300048929 Bacteria 2180
315 Ga0496126_0136154 3300048929 Bacteria 2119
316 Ga0496126_0144494 3300048929 Bacteria 2045
317 Ga0495678_143459 3300049459 Bacteria 779
318 Ga0495682_0007841 3300049460 Bacteria 4223
319 Ga0501039_0418313 3300049575 Unclassified 1053
320 Ga0501076_1270415 3300049592 Bacteria 606
321 Ga0501077_0446861 3300049593 Bacteria 828
322 Ga0501261_049019 3300049690 Bacteria 687
323 Ga0501044_0919576 3300049823 Unclassified 749
324 nmdc:mga03n38_378226_c1 3300050490 Bacteria 775
325 nmdc:mga0yw44_551984_c1 3300050492 Bacteria 782
326 nmdc:mga0k408_161338_c1 3300050493 Bacteria 1336
327 nmdc:mga07m45_66148_c1 3300050496 Bacteria 2053
328 Ga0500635_0116399 3300053080 Bacteria 997
329 Ga0495655_0336616 3300053083 Bacteria 526
330 Ga0500644_0186661 3300053088 Bacteria 851
331 Ga0500646_0003831 3300053090 Bacteria 3842
332 Ga0500651_0439149 3300053093 Bacteria 728
333 Ga0500566_0156032 3300053094 Bacteria 1195
334 Ga0500650_0041973 3300053098 Bacteria 2113
335 Ga0500562_001659 3300053108 Bacteria 5536
336 Ga0500562_005265 3300053108 Bacteria 3252
337 Ga0500562_079611 3300053108 Bacteria 886
338 Ga0500562_104100 3300053108 Bacteria 773
339 Ga0500569_059096 3300053109 Bacteria 1179
340 Ga0500572_181343 3300053111 Bacteria 690
341 Ga0500595_007507 3300053119 Bacteria 4523
342 Ga0500595_013335 3300053119 Bacteria 3151
343 Ga0500595_028382 3300053119 Bacteria 1908
344 Ga0500623_178941 3300053127 Bacteria 821
345 Ga0500642_0001960 3300053130 Bacteria 5967
346 Ga0500652_000268 3300053131 Bacteria 19453
347 Ga0500655_002666 3300053133 Bacteria 3235
348 Ga0500658_0000554 3300053134 Bacteria 15719
349 Ga0500568_0002458 3300053139 Bacteria 10893
350 Ga0500568_0117838 3300053139 Bacteria 990
351 Ga0500577_0025248 3300053142 Bacteria 2008
352 Ga0500579_159514 3300053143 Bacteria 956
353 Ga0500586_000969 3300053145 Bacteria 5914
354 Ga0500604_0002818 3300053151 Bacteria 4719
355 Ga0500616_0000093 3300053153 Bacteria 183114
356 Ga0500616_0023743 3300053153 Bacteria 3413
357 Ga0500616_0091885 3300053153 Bacteria 1501
358 Ga0500622_0000139 3300053156 Bacteria 77751
359 Ga0500627_0307486 3300053158 Bacteria 691
360 Ga0500627_0381247 3300053158 Bacteria 604
361 Ga0500638_178037 3300053162 Bacteria 920
362 Ga0500636_0397269 3300053177 Bacteria 641
363 Ga0500637_0044706 3300053178 Bacteria 2510
364 Ga0500645_008145 3300053730 Bacteria 3602
365 Ga0530510_0186284 3300061734 Bacteria 1540

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005436 Ga0070713_100122648 Ga0070713_1001226481 97
2 3300005458 Ga0070681_10142853 Ga0070681_101428532 104
3 3300006051 Ga0075364_11093129 Ga0075364_110931291 104
4 3300006195 Ga0075366_10256276 Ga0075366_102562762 104
5 3300006847 Ga0075431_101253467 Ga0075431_1012534672 104
6 3300009177 Ga0105248_11413818 Ga0105248_114138181 104
7 3300005616 Ga0068852_100003034 Ga0068852_1000030348 105
8 3300006353 Ga0075370_10070891 Ga0075370_100708913 105
9 3300025250 Ga0209026_1019151 Ga0209026_10191512 105
10 3300025256 Ga0209759_1002408 Ga0209759_10024086 105
11 3300025735 Ga0207713_1056631 Ga0207713_10566312 105
12 3300025913 Ga0207695_10001990 Ga0207695_1000199010 105
13 3300025914 Ga0207671_10173282 Ga0207671_101732822 105
14 3300025924 Ga0207694_10201679 Ga0207694_102016792 105
15 3300026116 Ga0207674_10452385 Ga0207674_104523852 105
16 3300026142 Ga0207698_10011175 Ga0207698_100111752 105
17 3300026142 Ga0207698_12295653 Ga0207698_122956531 105
18 3300031730 Ga0307516_10284838 Ga0307516_102848382 105
19 3300033180 Ga0307510_10616380 Ga0307510_106163802 105
20 3300041443 Ga0451789_0293198 Ga0451789_0293198_2245_2562 105
21 3300041452 Ga0451793_0629014 Ga0451793_0629014_516_833 105
22 3300041453 Ga0451797_0348275 Ga0451797_0348275_59_376 105
23 3300041456 Ga0451795_0338133 Ga0451795_0338133_16_333 105
24 3300041458 Ga0451798_0786215 Ga0451798_0786215_799_1116 105
25 3300041459 Ga0451800_0034565 Ga0451800_0034565_209_526 105
26 3300041460 Ga0451802_1220744 Ga0451802_1220744_1073_1390 105
27 3300041511 Ga0451855_0663656 Ga0451855_0663656_195_512 105
28 3300046515 Ga0495620_0187106 Ga0495620_0187106_147_464 105
29 3300046616 Ga0495668_0345041 Ga0495668_0345041_325_642 105
30 3300046648 Ga0495611_0270887 Ga0495611_0270887_324_641 105
31 3300046660 Ga0495625_0453172 Ga0495625_0453172_427_744 105
32 3300046660 Ga0495625_0647100 Ga0495625_0647100_287_604 105
33 3300050490 nmdc:mga03n38_378226_c1 nmdc:mga03n38_378226_c1_404_721 105
34 3300050493 nmdc:mga0k408_161338_c1 nmdc:mga0k408_161338_c1_114_431 105
35 3300050496 nmdc:mga07m45_66148_c1 nmdc:mga07m45_66148_c1_1090_1407 105
36 3300053080 Ga0500635_0116399 Ga0500635_0116399_135_452 105
37 3300053088 Ga0500644_0186661 Ga0500644_0186661_511_837 105
38 3300053090 Ga0500646_0003831 Ga0500646_0003831_1189_1506 105
39 3300053098 Ga0500650_0041973 Ga0500650_0041973_1138_1455 105
40 3300053108 Ga0500562_001659 Ga0500562_001659_520_837 105
41 3300053108 Ga0500562_005265 Ga0500562_005265_1480_1797 105
42 3300053109 Ga0500569_059096 Ga0500569_059096_217_534 105
43 3300053127 Ga0500623_178941 Ga0500623_178941_186_503 105
44 3300053130 Ga0500642_0001960 Ga0500642_0001960_1915_2232 105
45 3300053131 Ga0500652_000268 Ga0500652_000268_1863_2180 105
46 3300053133 Ga0500655_002666 Ga0500655_002666_2140_2457 105
47 3300053142 Ga0500577_0025248 Ga0500577_0025248_1564_1881 105
48 3300053143 Ga0500579_159514 Ga0500579_159514_464_781 105
49 3300053151 Ga0500604_0002818 Ga0500604_0002818_2347_2664 105
50 3300053156 Ga0500622_0000139 Ga0500622_0000139_41497_41814 105
51 3300053158 Ga0500627_0307486 Ga0500627_0307486_303_620 105
52 3300053177 Ga0500636_0397269 Ga0500636_0397269_139_456 105
53 3300002705 JGI25156J39149_1000059 JGI25156J39149_100005949 106
54 3300002737 JGI25162J39368_1003795 JGI25162J39368_10037954 106
55 3300002738 JGI25154J39366_1000056 JGI25154J39366_100005643 106
56 3300002741 JGI25157J39369_1000123 JGI25157J39369_100012313 106
57 3300003758 Ga0055532_1000059 Ga0055532_100005979 106
58 3300003761 Ga0055535_1007894 Ga0055535_10078943 106
59 3300005327 Ga0070658_11688798 Ga0070658_116887981 106
60 3300005333 Ga0070677_10140089 Ga0070677_101400891 106
61 3300005335 Ga0070666_10416434 Ga0070666_104164342 106
62 3300005353 Ga0070669_100006637 Ga0070669_1000066378 106
63 3300005364 Ga0070673_100196587 Ga0070673_1001965872 106
64 3300005365 Ga0070688_100313013 Ga0070688_1003130133 106
65 3300005445 Ga0070708_101255612 Ga0070708_1012556121 106
66 3300005456 Ga0070678_100064287 Ga0070678_1000642873 106
67 3300005456 Ga0070678_100525036 Ga0070678_1005250361 106
68 3300005458 Ga0070681_10564363 Ga0070681_105643632 106
69 3300005543 Ga0070672_100046116 Ga0070672_1000461163 106
70 3300005548 Ga0070665_100026867 Ga0070665_1000268673 106
71 3300005548 Ga0070665_100429420 Ga0070665_1004294202 106
72 3300005578 Ga0068854_100376333 Ga0068854_1003763332 106
73 3300005614 Ga0068856_100195235 Ga0068856_1001952353 106
74 3300006038 Ga0075365_10465322 Ga0075365_104653222 106
75 3300006881 Ga0068865_101338468 Ga0068865_1013384681 106
76 3300009011 Ga0105251_10115770 Ga0105251_101157701 106
77 3300009036 Ga0105244_10031275 Ga0105244_100312754 106
78 3300009174 Ga0105241_12527907 Ga0105241_125279072 106
79 3300009176 Ga0105242_10767245 Ga0105242_107672451 106
80 3300009177 Ga0105248_10147355 Ga0105248_101473553 106
81 3300009177 Ga0105248_10709749 Ga0105248_107097493 106
82 3300009545 Ga0105237_11152234 Ga0105237_111522342 106
83 3300009551 Ga0105238_10645242 Ga0105238_106452422 106
84 3300009553 Ga0105249_11272528 Ga0105249_112725282 106
85 3300011119 Ga0105246_10026587 Ga0105246_100265875 106
86 3300013100 Ga0157373_10021917 Ga0157373_100219172 106
87 3300013100 Ga0157373_10259846 Ga0157373_102598462 106
88 3300013102 Ga0157371_10050816 Ga0157371_100508162 106
89 3300013104 Ga0157370_10007879 Ga0157370_100078797 106
90 3300013104 Ga0157370_10140666 Ga0157370_101406664 106
91 3300013306 Ga0163162_12840895 Ga0163162_128408952 106
92 3300014325 Ga0163163_11990155 Ga0163163_119901552 106
93 3300014326 Ga0157380_10207229 Ga0157380_102072293 106
94 3300014497 Ga0182008_10002182 Ga0182008_100021824 106
95 3300014497 Ga0182008_10011027 Ga0182008_100110275 106
96 3300014497 Ga0182008_10014203 Ga0182008_100142034 106
97 3300014969 Ga0157376_11647084 Ga0157376_116470842 106
98 3300015261 Ga0182006_1021732 Ga0182006_10217322 106
99 3300015261 Ga0182006_1113811 Ga0182006_11138112 106
100 3300015262 Ga0182007_10007776 Ga0182007_100077765 106
101 3300015262 Ga0182007_10110633 Ga0182007_101106332 106
102 3300015265 Ga0182005_1219690 Ga0182005_12196901 106
103 3300017792 Ga0163161_10000042 Ga0163161_1000004262 106
104 3300017792 Ga0163161_10411449 Ga0163161_104114492 106
105 3300025206 Ga0209435_100032 Ga0209435_10003264 106
106 3300025228 Ga0209672_100149 Ga0209672_1001494 106
107 3300025229 Ga0209147_100109 Ga0209147_10010964 106
108 3300025231 Ga0207427_100581 Ga0207427_1005812 106
109 3300025233 Ga0209437_100180 Ga0209437_10018011 106
110 3300025233 Ga0209437_100195 Ga0209437_10019536 106
111 3300025242 Ga0209258_100190 Ga0209258_10019037 106
112 3300025246 Ga0209646_1000113 Ga0209646_100011364 106
113 3300025250 Ga0209026_1000102 Ga0209026_100010264 106
114 3300025250 Ga0209026_1003397 Ga0209026_10033972 106
115 3300025254 Ga0209148_1015251 Ga0209148_10152512 106
116 3300025256 Ga0209759_1000104 Ga0209759_100010464 106
117 3300025261 Ga0209233_1014480 Ga0209233_10144802 106
118 3300025272 Ga0209455_1006419 Ga0209455_10064192 106
119 3300025272 Ga0209455_1006830 Ga0209455_10068303 106
120 3300025291 Ga0209675_1003885 Ga0209675_10038855 106
121 3300025292 Ga0209676_1015207 Ga0209676_10152073 106
122 3300025294 Ga0209025_1000038 Ga0209025_1000038228 106
123 3300025294 Ga0209025_1026751 Ga0209025_10267513 106
124 3300025298 Ga0209050_1011411 Ga0209050_10114112 106
125 3300025315 Ga0207697_10292549 Ga0207697_102925492 106
126 3300025728 Ga0207655_1112114 Ga0207655_11121142 106
127 3300025903 Ga0207680_10532183 Ga0207680_105321832 106
128 3300025907 Ga0207645_10794264 Ga0207645_107942641 106
129 3300025914 Ga0207671_10856954 Ga0207671_108569542 106
130 3300025917 Ga0207660_10737014 Ga0207660_107370142 106
131 3300025923 Ga0207681_10028100 Ga0207681_100281003 106
132 3300025924 Ga0207694_10039780 Ga0207694_100397802 106
133 3300025934 Ga0207686_11555479 Ga0207686_115554791 106
134 3300025940 Ga0207691_10100234 Ga0207691_101002343 106
135 3300025941 Ga0207711_10093121 Ga0207711_100931213 106
136 3300025960 Ga0207651_10710630 Ga0207651_107106301 106
137 3300025972 Ga0207668_10293729 Ga0207668_102937293 106
138 3300026041 Ga0207639_10469720 Ga0207639_104697202 106
139 3300026078 Ga0207702_10140665 Ga0207702_101406651 106
140 3300026088 Ga0207641_10868404 Ga0207641_108684042 106
141 3300026089 Ga0207648_10145852 Ga0207648_101458523 106
142 3300026118 Ga0207675_100426195 Ga0207675_1004261953 106
143 3300026121 Ga0207683_10085964 Ga0207683_100859643 106
144 3300026121 Ga0207683_10297487 Ga0207683_102974872 106
145 3300028379 Ga0268266_10000987 Ga0268266_100009876 106
146 3300028379 Ga0268266_10378708 Ga0268266_103787083 106
147 3300028786 Ga0307517_10319860 Ga0307517_103198602 106
148 3300028794 Ga0307515_10129647 Ga0307515_101296473 106
149 3300028794 Ga0307515_10489808 Ga0307515_104898082 106
150 3300028794 Ga0307515_10885275 Ga0307515_108852752 106
151 3300031456 Ga0307513_10007102 Ga0307513_100071025 106
152 3300031456 Ga0307513_10180628 Ga0307513_101806283 106
153 3300031456 Ga0307513_10382169 Ga0307513_103821692 106
154 3300031456 Ga0307513_10476285 Ga0307513_104762852 106
155 3300031507 Ga0307509_10524128 Ga0307509_105241282 106
156 3300031548 Ga0307408_100192582 Ga0307408_1001925822 106
157 3300031548 Ga0307408_100911252 Ga0307408_1009112522 106
158 3300031911 Ga0307412_10167310 Ga0307412_101673102 106
159 3300032002 Ga0307416_100078275 Ga0307416_1000782753 106
160 3300032002 Ga0307416_102037680 Ga0307416_1020376801 106
161 3300037418 Ga0395900_0091438 Ga0395900_0091438_2018_2338 106
162 3300037466 Ga0395898_0065185 Ga0395898_0065185_1592_1912 106
163 3300038443 Ga0395901_0421801 Ga0395901_0421801_25_345 106
164 3300041411 Ga0439466_0064979 Ga0439466_0064979_591_911 106
165 3300041512 Ga0451853_1118044 Ga0451853_1118044_243_563 106
166 3300042184 Ga0450908_000020 Ga0450908_000020_305_625 106
167 3300046455 Ga0495603_0001298 Ga0495603_0001298_11314_11649 106
168 3300046455 Ga0495603_0006630 Ga0495603_0006630_3189_3509 106
169 3300046459 Ga0495629_0007166 Ga0495629_0007166_3538_3858 106
170 3300046460 Ga0495638_0000009 Ga0495638_0000009_358519_358839 106
171 3300046460 Ga0495638_0021911 Ga0495638_0021911_1762_2082 106
172 3300046460 Ga0495638_0077334 Ga0495638_0077334_1196_1519 106
173 3300046463 Ga0495653_0000048 Ga0495653_0000048_66859_67239 106
174 3300046463 Ga0495653_0812851 Ga0495653_0812851_116_436 106
175 3300046471 Ga0495650_0005519 Ga0495650_0005519_3527_3847 106
176 3300046471 Ga0495650_0013906 Ga0495650_0013906_1710_2030 106
177 3300046471 Ga0495650_0192980 Ga0495650_0192980_127_453 106
178 3300046471 Ga0495650_0244862 Ga0495650_0244862_245_565 106
179 3300046472 Ga0495580_0000009 Ga0495580_0000009_60309_60644 106
180 3300046472 Ga0495580_0005458 Ga0495580_0005458_1261_1581 106
181 3300046472 Ga0495580_0008411 Ga0495580_0008411_4356_4676 106
182 3300046472 Ga0495580_0063214 Ga0495580_0063214_1018_1398 106
183 3300046473 Ga0495582_0005110 Ga0495582_0005110_3474_3794 106
184 3300046473 Ga0495582_0042725 Ga0495582_0042725_842_1222 106
185 3300046474 Ga0495605_0002377 Ga0495605_0002377_706_1026 106
186 3300046474 Ga0495605_0005217 Ga0495605_0005217_2906_3241 106
187 3300046474 Ga0495605_0009645 Ga0495605_0009645_150_470 106
188 3300046475 Ga0495639_0023844 Ga0495639_0023844_2296_2616 106
189 3300046491 Ga0495584_0153630 Ga0495584_0153630_690_1016 106
190 3300046499 Ga0495594_0310811 Ga0495594_0310811_40_360 106
191 3300046499 Ga0495594_0699102 Ga0495594_0699102_95_415 106
192 3300046500 Ga0495596_0060926 Ga0495596_0060926_967_1287 106
193 3300046500 Ga0495596_0213496 Ga0495596_0213496_351_671 106
194 3300046506 Ga0495583_0004359 Ga0495583_0004359_6483_6803 106
195 3300046506 Ga0495583_0263226 Ga0495583_0263226_175_495 106
196 3300046512 Ga0495610_0005285 Ga0495610_0005285_6109_6429 106
197 3300046512 Ga0495610_0199806 Ga0495610_0199806_383_703 106
198 3300046513 Ga0495616_0004030 Ga0495616_0004030_5450_5770 106
199 3300046514 Ga0495618_0783205 Ga0495618_0783205_99_419 106
200 3300046515 Ga0495620_0028033 Ga0495620_0028033_917_1237 106
201 3300046515 Ga0495620_0105108 Ga0495620_0105108_789_1109 106
202 3300046515 Ga0495620_0152932 Ga0495620_0152932_445_765 106
203 3300046516 Ga0495628_0010561 Ga0495628_0010561_3130_3510 106
204 3300046517 Ga0495630_0005008 Ga0495630_0005008_7285_7605 106
205 3300046518 Ga0495631_0000034 Ga0495631_0000034_2484_2804 106
206 3300046518 Ga0495631_0004507 Ga0495631_0004507_6047_6367 106
207 3300046520 Ga0495637_0087133 Ga0495637_0087133_518_838 106
208 3300046522 Ga0495643_0208460 Ga0495643_0208460_30_350 106
209 3300046523 Ga0495644_0051156 Ga0495644_0051156_823_1143 106
210 3300046524 Ga0495648_0020158 Ga0495648_0020158_3989_4369 106
211 3300046524 Ga0495648_0048986 Ga0495648_0048986_547_882 106
212 3300046524 Ga0495648_0110287 Ga0495648_0110287_502_822 106
213 3300046524 Ga0495648_0366981 Ga0495648_0366981_109_429 106
214 3300046526 Ga0495666_0477409 Ga0495666_0477409_32_352 106
215 3300046528 Ga0495642_0002122 Ga0495642_0002122_3521_3841 106
216 3300046528 Ga0495642_0138592 Ga0495642_0138592_693_1028 106
217 3300046528 Ga0495642_0180792 Ga0495642_0180792_354_674 106
218 3300046529 Ga0495652_0749715 Ga0495652_0749715_151_531 106
219 3300046530 Ga0495654_0009859 Ga0495654_0009859_3847_4167 106
220 3300046530 Ga0495654_0244887 Ga0495654_0244887_358_678 106
221 3300046531 Ga0495665_0051252 Ga0495665_0051252_1775_2155 106
222 3300046531 Ga0495665_0081792 Ga0495665_0081792_1271_1591 106
223 3300046531 Ga0495665_0146513 Ga0495665_0146513_467_802 106
224 3300046533 Ga0495640_0635631 Ga0495640_0635631_151_471 106
225 3300046539 Ga0495621_0000487 Ga0495621_0000487_3514_3834 106
226 3300046543 Ga0495645_0006296 Ga0495645_0006296_4356_4676 106
227 3300046557 Ga0495622_0000004 Ga0495622_0000004_161167_161487 106
228 3300046557 Ga0495622_0017785 Ga0495622_0017785_636_971 106
229 3300046557 Ga0495622_0066853 Ga0495622_0066853_723_1043 106
230 3300046558 Ga0495633_0006367 Ga0495633_0006367_3169_3489 106
231 3300046559 Ga0495667_0056510 Ga0495667_0056510_773_1093 106
232 3300046616 Ga0495668_0029656 Ga0495668_0029656_952_1272 106
233 3300046660 Ga0495625_0000606 Ga0495625_0000606_47097_47417 106
234 3300046660 Ga0495625_0011706 Ga0495625_0011706_6414_6737 106
235 3300046660 Ga0495625_0014791 Ga0495625_0014791_2746_3066 106
236 3300046660 Ga0495625_0036359 Ga0495625_0036359_1561_1881 106
237 3300046660 Ga0495625_0549201 Ga0495625_0549201_292_612 106
238 3300046665 Ga0495661_0021357 Ga0495661_0021357_3604_3924 106
239 3300046665 Ga0495661_0034312 Ga0495661_0034312_85_405 106
240 3300046674 Ga0495588_0011576 Ga0495588_0011576_560_880 106
241 3300046674 Ga0495588_0074947 Ga0495588_0074947_570_890 106
242 3300046680 Ga0495646_0002123 Ga0495646_0002123_4226_4606 106
243 3300046684 Ga0495669_0017744 Ga0495669_0017744_2177_2497 106
244 3300046684 Ga0495669_0062506 Ga0495669_0062506_275_610 106
245 3300046684 Ga0495669_0259414 Ga0495669_0259414_445_765 106
246 3300046689 Ga0495613_0048455 Ga0495613_0048455_1736_2056 106
247 3300046689 Ga0495613_0135205 Ga0495613_0135205_1044_1424 106
248 3300046690 Ga0495624_0001218 Ga0495624_0001218_5392_5772 106
249 3300046690 Ga0495624_0003518 Ga0495624_0003518_1276_1596 106
250 3300046692 Ga0495671_0017049 Ga0495671_0017049_3099_3434 106
251 3300046692 Ga0495671_0079482 Ga0495671_0079482_167_487 106
252 3300046692 Ga0495671_0086016 Ga0495671_0086016_1188_1508 106
253 3300046692 Ga0495671_0122103 Ga0495671_0122103_398_718 106
254 3300046692 Ga0495671_0231644 Ga0495671_0231644_476_796 106
255 3300046694 Ga0495649_0046686 Ga0495649_0046686_527_847 106
256 3300046694 Ga0495649_0277016 Ga0495649_0277016_266_586 106
257 3300046794 Ga0495589_0086291 Ga0495589_0086291_435_755 106
258 3300046794 Ga0495589_0257682 Ga0495589_0257682_292_612 106
259 3300046810 Ga0495660_0157439 Ga0495660_0157439_83_418 106
260 3300046810 Ga0495660_0467318 Ga0495660_0467318_48_368 106
261 3300047315 Ga0495581_0002591 Ga0495581_0002591_3542_3862 106
262 3300047319 Ga0495674_0002157 Ga0495674_0002157_4909_5229 106
263 3300047319 Ga0495674_0005831 Ga0495674_0005831_8453_8788 106
264 3300047319 Ga0495674_0006867 Ga0495674_0006867_6390_6770 106
265 3300047319 Ga0495674_0025641 Ga0495674_0025641_4546_4941 106
266 3300047320 Ga0495672_0000346 Ga0495672_0000346_31714_32034 106
267 3300047320 Ga0495672_0016459 Ga0495672_0016459_3934_4269 106
268 3300047320 Ga0495672_0131535 Ga0495672_0131535_58_378 106
269 3300047320 Ga0495672_0145159 Ga0495672_0145159_386_706 106
270 3300047321 Ga0495676_0053231 Ga0495676_0053231_844_1224 106
271 3300047322 Ga0495680_0258381 Ga0495680_0258381_189_509 106
272 3300047323 Ga0495683_0134088 Ga0495683_0134088_259_594 106
273 3300047323 Ga0495683_0371603 Ga0495683_0371603_171_491 106
274 3300047444 Ga0495675_0019756 Ga0495675_0019756_1606_1926 106
275 3300047446 Ga0495679_000038 Ga0495679_000038_52585_52905 106
276 3300047469 Ga0495673_0000096 Ga0495673_0000096_109097_109417 106
277 3300047469 Ga0495673_0018481 Ga0495673_0018481_85_405 106
278 3300047469 Ga0495673_0030438 Ga0495673_0030438_1546_1881 106
279 3300047470 Ga0495681_0046105 Ga0495681_0046105_824_1144 106
280 3300047472 Ga0495686_0000171 Ga0495686_0000171_65876_66202 106
281 3300047472 Ga0495686_0090099 Ga0495686_0090099_582_902 106
282 3300047472 Ga0495686_0097114 Ga0495686_0097114_76_396 106
283 3300047472 Ga0495686_0268695 Ga0495686_0268695_265_585 106
284 3300047673 Ga0495593_0054924 Ga0495593_0054924_562_882 106
285 3300048088 Ga0495602_0094941 Ga0495602_0094941_1676_1996 106
286 3300048091 Ga0495626_0102965 Ga0495626_0102965_791_1111 106
287 3300048903 Ga0496100_0072993 Ga0496100_0072993_358_678 106
288 3300048903 Ga0496100_0083249 Ga0496100_0083249_294_629 106
289 3300048903 Ga0496100_1194525 Ga0496100_1194525_169_489 106
290 3300048904 Ga0496101_0019818 Ga0496101_0019818_725_1045 106
291 3300048904 Ga0496101_0037949 Ga0496101_0037949_539_874 106
292 3300048905 Ga0496102_0193043 Ga0496102_0193043_673_993 106
293 3300048906 Ga0496103_0617054 Ga0496103_0617054_286_606 106
294 3300048907 Ga0496104_0055503 Ga0496104_0055503_859_1179 106
295 3300048907 Ga0496104_0092704 Ga0496104_0092704_1514_1849 106
296 3300048908 Ga0496105_0018141 Ga0496105_0018141_3464_3784 106
297 3300048908 Ga0496105_0151992 Ga0496105_0151992_899_1219 106
298 3300048909 Ga0496106_0055937 Ga0496106_0055937_1089_1424 106
299 3300048913 Ga0496110_0025509 Ga0496110_0025509_1332_1652 106
300 3300048914 Ga0496111_1205088 Ga0496111_1205088_40_360 106
301 3300048915 Ga0496112_0028589 Ga0496112_0028589_802_1122 106
302 3300048916 Ga0496113_0000910 Ga0496113_0000910_11595_11915 106
303 3300048917 Ga0496114_0037251 Ga0496114_0037251_1379_1699 106
304 3300048917 Ga0496114_0654513 Ga0496114_0654513_563_883 106
305 3300048918 Ga0496115_0005763 Ga0496115_0005763_8442_8762 106
306 3300048918 Ga0496115_0104761 Ga0496115_0104761_1280_1600 106
307 3300048918 Ga0496115_1447790 Ga0496115_1447790_25_345 106
308 3300048919 Ga0496116_0084581 Ga0496116_0084581_825_1145 106
309 3300048920 Ga0496117_0066746 Ga0496117_0066746_1945_2265 106
310 3300048920 Ga0496117_0249188 Ga0496117_0249188_17_337 106
311 3300048920 Ga0496117_0620832 Ga0496117_0620832_157_477 106
312 3300048921 Ga0496118_0016273 Ga0496118_0016273_1660_1980 106
313 3300048921 Ga0496118_0129718 Ga0496118_0129718_1160_1480 106
314 3300048922 Ga0496119_0114110 Ga0496119_0114110_731_1066 106
315 3300048923 Ga0496120_0419462 Ga0496120_0419462_105_425 106
316 3300048924 Ga0496121_0029227 Ga0496121_0029227_1203_1538 106
317 3300048924 Ga0496121_0032127 Ga0496121_0032127_1098_1418 106
318 3300048924 Ga0496121_0075659 Ga0496121_0075659_2143_2463 106
319 3300048924 Ga0496121_0080934 Ga0496121_0080934_1808_2128 106
320 3300048924 Ga0496121_0309342 Ga0496121_0309342_451_771 106
321 3300048924 Ga0496121_0642102 Ga0496121_0642102_15_335 106
322 3300048924 Ga0496121_0655398 Ga0496121_0655398_247_567 106
323 3300048924 Ga0496121_0850521 Ga0496121_0850521_104_424 106
324 3300048925 Ga0496122_0258194 Ga0496122_0258194_243_563 106
325 3300048926 Ga0496123_0057017 Ga0496123_0057017_1038_1358 106
326 3300048926 Ga0496123_0059325 Ga0496123_0059325_1760_2080 106
327 3300048927 Ga0496124_0570867 Ga0496124_0570867_188_523 106
328 3300048928 Ga0496125_0000947 Ga0496125_0000947_2921_3241 106
329 3300048928 Ga0496125_0021636 Ga0496125_0021636_1953_2273 106
330 3300048928 Ga0496125_0172242 Ga0496125_0172242_600_920 106
331 3300048929 Ga0496126_0040616 Ga0496126_0040616_1890_2210 106
332 3300048929 Ga0496126_0074369 Ga0496126_0074369_997_1317 106
333 3300048929 Ga0496126_0099695 Ga0496126_0099695_851_1171 106
334 3300048929 Ga0496126_0129639 Ga0496126_0129639_1403_1723 106
335 3300048929 Ga0496126_0136154 Ga0496126_0136154_107_427 106
336 3300048929 Ga0496126_0144494 Ga0496126_0144494_447_782 106
337 3300049459 Ga0495678_143459 Ga0495678_143459_302_637 106
338 3300049460 Ga0495682_0007841 Ga0495682_0007841_687_1022 106
339 3300049575 Ga0501039_0418313 Ga0501039_0418313_554_874 106
340 3300049592 Ga0501076_1270415 Ga0501076_1270415_112_471 106
341 3300049593 Ga0501077_0446861 Ga0501077_0446861_388_747 106
342 3300049690 Ga0501261_049019 Ga0501261_049019_74_394 106
343 3300049823 Ga0501044_0919576 Ga0501044_0919576_276_596 106
344 3300050492 nmdc:mga0yw44_551984_c1 nmdc:mga0yw44_551984_c1_314_634 106
345 3300053083 Ga0495655_0336616 Ga0495655_0336616_89_469 106
346 3300053093 Ga0500651_0439149 Ga0500651_0439149_103_423 106
347 3300053094 Ga0500566_0156032 Ga0500566_0156032_226_546 106
348 3300053108 Ga0500562_079611 Ga0500562_079611_77_397 106
349 3300053108 Ga0500562_104100 Ga0500562_104100_221_541 106
350 3300053111 Ga0500572_181343 Ga0500572_181343_27_347 106
351 3300053119 Ga0500595_007507 Ga0500595_007507_1229_1549 106
352 3300053119 Ga0500595_013335 Ga0500595_013335_2434_2754 106
353 3300053119 Ga0500595_028382 Ga0500595_028382_1309_1629 106
354 3300053134 Ga0500658_0000554 Ga0500658_0000554_5181_5501 106
355 3300053139 Ga0500568_0002458 Ga0500568_0002458_1936_2256 106
356 3300053139 Ga0500568_0117838 Ga0500568_0117838_289_609 106
357 3300053145 Ga0500586_000969 Ga0500586_000969_1580_1900 106
358 3300053153 Ga0500616_0000093 Ga0500616_0000093_104924_105244 106
359 3300053153 Ga0500616_0023743 Ga0500616_0023743_2019_2339 106
360 3300053153 Ga0500616_0091885 Ga0500616_0091885_357_677 106
361 3300053158 Ga0500627_0381247 Ga0500627_0381247_237_563 106
362 3300053162 Ga0500638_178037 Ga0500638_178037_113_433 106
363 3300053178 Ga0500637_0044706 Ga0500637_0044706_1832_2152 106
364 3300053730 Ga0500645_008145 Ga0500645_008145_397_717 106
365 3300061734 Ga0530510_0186284 Ga0530510_0186284_1164_1484 106
366 iso_pu_bacteria 2562617112 2563059751 106
367 iso_pu_bacteria 2711768613 2713480541 106

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00893

Multi_Drug_Res

Small Multidrug Resistance protein

26

118

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8tgy-assembly1.cif.gz_E crystal structure of gdx-clo from small multidrug resistance family of transporters in complex with guanylurea 0.9329 1 106
8tgy-assembly1.cif.gz_E crystal structure of gdx-clo from small multidrug resistance family of transporters in complex with guanylurea 0.9245 1 106
7ssu-assembly1.cif.gz_B structure of emre-d3 mutant in complex with monobody l10 and methyltriphenylphosphonium 0.8832 1 98
7mgx-assembly1.cif.gz_B structure of emre-d3 mutant in complex with monobody l10 and methyl viologen 0.8714 1 98
7mgx-assembly2.cif.gz_F structure of emre-d3 mutant in complex with monobody l10 and methyl viologen 0.8585 1 98
ID Description Score Start End Superfamily
af_P69937_1_105_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.989 1 104 1.10.3730.20
af_P69937_1_105_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.9705 1 104 1.10.3730.20
af_P9WGF1_2_106_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.9104 3 103 1.10.3730.20
af_Q4DEW8_2_121_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.8781 5 105 1.10.3730.20
af_P69212_3_109_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.8767 1 101 1.10.3730.20
ID Description Score Start End GO Terms
AF-A0A2E3Q1A7-F1-model_v4 QacE family quaternary ammonium compound efflux SMR transporter 0.9965 1 102 GO:0005886
GO:0022857
AF-A0A4R7PG08-F1-model_v4 deleted 0.9964 1 103
AF-C6B3X2-F1-model_v4 Guanidinium exporter 0.995 1 106 GO:0005886
GO:0022857
AF-A0A3P5WN29-F1-model_v4 Quaternary ammonium compound-resistance protein SugE 0.9944 2 102 GO:0005886
GO:0022857
AF-A0A1M4DVB0-F1-model_v4 Quaternary ammonium compound-resistance protein SugE 0.9931 1 104 GO:0005886
GO:0022857

Feature Viewer

pLDDT pTM Quality
96.08 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map