F424465

General Info

Members Datasets Scaffolds Average Seq Length
367 223 355 227

Family's Representative Sequence

Representative Sequence 3300046524|Ga0495648_0206066|Ga0495648_0206066_182_907
Length 241
Sequence MKLEKVTESPGRAPKSSEKRWPDKRWYDDACGTALAMELVGERWSLLIVRELMFGPRRFGELRAGLGGISANVLTQRLEGMEAAGILTREKLPPPASVQVYALTPWGYQSEQAIQELGRWAVRSPRHDPTLPLSAASLMLSFRTMIDRPNAALLDAAIGFRLGNEQFVARVNADGISILREDPADADVVVASDPVTTASIVYGGRPITDAESAGVLALKGDRSLFEHFVTLFPLPPKTGSA

Samples

Sample ID Description Type Environment
1 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
2 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
3 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
4 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
5 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
6 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
7 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
8 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
9 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
10 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
11 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
12 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
13 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
14 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
15 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
16 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
17 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
18 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
19 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
20 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
21 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
22 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
23 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
24 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
25 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
26 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
27 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
28 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
29 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
30 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
33 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
34 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
37 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
38 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
44 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
45 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
75 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
98 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
99 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
102 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
104 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
153 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
154 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
155 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
156 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
157 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
158 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
159 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
160 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
161 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
162 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
163 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
164 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
165 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
166 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
167 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
168 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
169 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
170 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
171 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
172 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
173 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
174 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
175 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
176 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
177 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
178 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
179 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
180 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
181 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
182 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
183 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
184 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
185 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
186 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
187 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
188 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
189 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
190 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
191 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
192 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
193 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
194 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
195 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
196 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
197 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
198 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
199 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
200 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
201 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
202 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
203 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
204 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
205 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
206 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
207 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
208 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
209 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
210 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
211 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
212 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
213 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
214 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
215 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
216 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
217 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
218 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
219 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
220 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
221 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
222 641522639 Methylobacterium sp. 4-46 Isolate Nodule
223 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.73
Metatranscriptomes 0
Isolates 3.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.72
Nodule 0.27
Rhizoplane 4.63
Rhizosphere 75.2
Stem 0
Stem Tuber 0
Unclassified 11.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000009 3300001904 Bacteria 35855
2 JGI24741J21665_1000775 3300001915 Bacteria 9599
3 JGI24752J21851_1000043 3300001976 Bacteria 15468
4 JGI24740J21852_10010122 3300001979 Bacteria 3649
5 JGI24740J21852_10051252 3300001979 Bacteria 1182
6 JGI24737J22298_10011196 3300001990 Bacteria 2943
7 JGI24737J22298_10025350 3300001990 Bacteria 1875
8 JGI24750J21931_1001696 3300002070 Bacteria 2696
9 JGI24748J21848_1000026 3300002074 Bacteria 101640
10 JGI24738J21930_10001213 3300002075 Bacteria 7231
11 JGI24749J21850_1000317 3300002076 Bacteria 7403
12 JGI24034J26672_10000015 3300002239 Bacteria 137655
13 JGI24742J22300_10001491 3300002244 Bacteria 3700
14 JGI24742J22300_10004442 3300002244 Bacteria 2295
15 JGI24751J29686_10021950 3300002459 Bacteria 1323
16 JGI25165J46597_1000138 3300003214 Bacteria 121773
17 JGI25153J46596_10000005 3300003215 Bacteria 492839
18 rootH1_10093282 3300003316 Bacteria 1267
19 Ga0055525_1000037 3300003759 Bacteria 297990
20 Ga0055542_1000088 3300003762 Bacteria 123491
21 Ga0055542_1000293 3300003762 Bacteria 55815
22 Ga0055529_1000034 3300003763 Bacteria 244657
23 Ga0065165_1012136 3300005262 Bacteria 3530
24 Ga0070658_10019332 3300005327 Bacteria 5455
25 Ga0070658_10026692 3300005327 Bacteria 4635
26 Ga0070658_10208667 3300005327 Bacteria 1650
27 Ga0070658_10310771 3300005327 Bacteria 1345
28 Ga0070690_100000025 3300005330 Bacteria 69409
29 Ga0070670_100504452 3300005331 Bacteria 1076
30 Ga0070666_10000015 3300005335 Bacteria 208372
31 Ga0070680_100023453 3300005336 Bacteria 4921
32 Ga0070682_100194224 3300005337 Bacteria 1427
33 Ga0070660_100002485 3300005339 Bacteria 12648
34 Ga0070660_100019602 3300005339 Bacteria 4959
35 Ga0070660_100075904 3300005339 Bacteria 2632
36 Ga0070661_100000764 3300005344 Bacteria 23216
37 Ga0070661_100223361 3300005344 Bacteria 1445
38 Ga0070661_100258136 3300005344 Bacteria 1347
39 Ga0070668_100124855 3300005347 Bacteria 2061
40 Ga0070669_100000059 3300005353 Bacteria 108504
41 Ga0070671_100009469 3300005355 Bacteria 7820
42 Ga0070673_100430232 3300005364 Bacteria 1184
43 Ga0070688_100013459 3300005365 Bacteria 4613
44 Ga0070659_100075286 3300005366 Bacteria 2690
45 Ga0070659_100144291 3300005366 Bacteria 1939
46 Ga0070667_100000098 3300005367 Bacteria 108706
47 Ga0070667_100055889 3300005367 Bacteria 3333
48 Ga0070709_10217892 3300005434 Bacteria 1360
49 Ga0070713_100235744 3300005436 Bacteria 1665
50 Ga0070663_100077760 3300005455 Bacteria 2430
51 Ga0070663_100168014 3300005455 Bacteria 1693
52 Ga0070662_100044820 3300005457 Bacteria 3170
53 Ga0070662_100134473 3300005457 Bacteria 1910
54 Ga0070681_10019073 3300005458 Bacteria 6864
55 Ga0068867_100391424 3300005459 Bacteria 1170
56 Ga0070685_10000247 3300005466 Bacteria 35364
57 Ga0070679_100000001 3300005530 Bacteria 764811
58 Ga0070679_100278663 3300005530 Bacteria 1625
59 Ga0070684_100109344 3300005535 Bacteria 2478
60 Ga0070684_100220589 3300005535 Bacteria 1730
61 Ga0068853_100219888 3300005539 Bacteria 1734
62 Ga0070686_100000006 3300005544 Bacteria 243316
63 Ga0070665_100000021 3300005548 Bacteria 389668
64 Ga0070665_100000217 3300005548 Bacteria 97947
65 Ga0070665_100359958 3300005548 Bacteria 1461
66 Ga0068855_100313731 3300005563 Bacteria 1734
67 Ga0068857_100183703 3300005577 Bacteria 1903
68 Ga0068854_100013179 3300005578 Bacteria 5419
69 Ga0068854_100135107 3300005578 Bacteria 1887
70 Ga0068852_100555846 3300005616 Bacteria 1148
71 Ga0068859_100000937 3300005617 Bacteria 29957
72 Ga0068859_100006308 3300005617 Bacteria 12027
73 Ga0068859_100053773 3300005617 Bacteria 4050
74 Ga0068864_100017721 3300005618 Bacteria 5941
75 Ga0068861_100000271 3300005719 Bacteria 28950
76 Ga0068861_100006465 3300005719 Bacteria 7984
77 Ga0068851_10052262 3300005834 Bacteria 2077
78 Ga0068863_100000108 3300005841 Bacteria 87921
79 Ga0068863_100029844 3300005841 Bacteria 5208
80 Ga0068858_100000318 3300005842 Bacteria 51170
81 Ga0068858_100002166 3300005842 Bacteria 19926
82 Ga0068858_100002534 3300005842 Bacteria 18415
83 Ga0068860_100000050 3300005843 Bacteria 208372
84 Ga0068860_100000164 3300005843 Bacteria 108706
85 Ga0068860_100008125 3300005843 Bacteria 10451
86 Ga0068862_100000059 3300005844 Bacteria 136840
87 Ga0068862_100000062 3300005844 Bacteria 126792
88 Ga0081539_10016379 3300005985 Bacteria 5298
89 Ga0070716_100391237 3300006173 Bacteria 997
90 Ga0075369_10200113 3300006186 Bacteria 922
91 Ga0097621_100083685 3300006237 Bacteria 2659
92 Ga0075430_100007354 3300006846 Bacteria 9302
93 Ga0097620_100000937 3300006931 Bacteria 29957
94 Ga0097620_100006308 3300006931 Bacteria 12027
95 Ga0097620_100053773 3300006931 Bacteria 4050
96 Ga0105251_10093864 3300009011 Bacteria 1376
97 Ga0105250_10064926 3300009092 Bacteria 1471
98 Ga0105240_10029747 3300009093 Bacteria 7108
99 Ga0105240_10036683 3300009093 Bacteria 6305
100 Ga0105245_10001471 3300009098 Bacteria 21285
101 Ga0105247_10004620 3300009101 Bacteria 8777
102 Ga0105247_10037189 3300009101 Bacteria 2970
103 Ga0105243_10000030 3300009148 Bacteria 190342
104 Ga0105243_10065420 3300009148 Bacteria 2921
105 Ga0105241_10005131 3300009174 Bacteria 9660
106 Ga0105242_10342134 3300009176 Bacteria 1379
107 Ga0105242_10467238 3300009176 Bacteria 1193
108 Ga0105248_10004882 3300009177 Bacteria 14819
109 Ga0105248_10021965 3300009177 Bacteria 7072
110 Ga0105248_10025328 3300009177 Bacteria 6596
111 Ga0105237_10004010 3300009545 Bacteria 17216
112 Ga0105237_10008128 3300009545 Bacteria 11390
113 Ga0105237_10010310 3300009545 Bacteria 9956
114 Ga0105249_10000034 3300009553 Bacteria 208378
115 Ga0105249_10000065 3300009553 Bacteria 151159
116 Ga0105239_10000031 3300010375 Bacteria 226947
117 Ga0105246_10301227 3300011119 Bacteria 1294
118 Ga0157373_10026314 3300013100 Bacteria 4203
119 Ga0157371_10000043 3300013102 Bacteria 197887
120 Ga0157378_10121452 3300013297 Bacteria 2408
121 Ga0157378_10250730 3300013297 Bacteria 1694
122 Ga0157378_10578863 3300013297 Bacteria 1131
123 Ga0163162_10023676 3300013306 Bacteria 6063
124 Ga0163162_10106873 3300013306 Bacteria 2894
125 Ga0163162_10519686 3300013306 Bacteria 1320
126 Ga0163162_11300539 3300013306 Bacteria 826
127 Ga0157372_10375760 3300013307 Bacteria 1656
128 Ga0157380_10000231 3300014326 Bacteria 33437
129 Ga0157380_10313841 3300014326 Bacteria 1450
130 Ga0157380_10742010 3300014326 Bacteria 992
131 Ga0157379_10005954 3300014968 Bacteria 10505
132 Ga0157379_10014589 3300014968 Bacteria 6891
133 Ga0163161_10000051 3300017792 Bacteria 122360
134 Ga0163161_10166110 3300017792 Bacteria 1685
135 Ga0207672_1001009 3300025223 Bacteria 2707
136 Ga0209563_100053 3300025230 Bacteria 332370
137 Ga0209437_103131 3300025233 Bacteria 3044
138 Ga0209646_1002469 3300025246 Bacteria 4076
139 Ga0209677_112012 3300025253 Bacteria 1311
140 Ga0209148_1000093 3300025254 Bacteria 245339
141 Ga0209233_1000182 3300025261 Bacteria 137671
142 Ga0209233_1021410 3300025261 Bacteria 1674
143 Ga0209455_1000045 3300025272 Bacteria 383329
144 Ga0209758_1000001 3300025297 Bacteria 1981790
145 Ga0207697_10013606 3300025315 Bacteria 3392
146 Ga0207656_10000833 3300025321 Bacteria 10068
147 Ga0207710_10002558 3300025900 Bacteria 8406
148 Ga0207710_10052410 3300025900 Bacteria 1834
149 Ga0207680_10000007 3300025903 Bacteria 623574
150 Ga0207647_10001146 3300025904 Bacteria 20388
151 Ga0207647_10018510 3300025904 Bacteria 4707
152 Ga0207647_10144267 3300025904 Bacteria 1394
153 Ga0207705_10022866 3300025909 Bacteria 4457
154 Ga0207705_10025529 3300025909 Bacteria 4216
155 Ga0207705_10339120 3300025909 Bacteria 1157
156 Ga0207654_10001455 3300025911 Bacteria 12563
157 Ga0207654_10003313 3300025911 Bacteria 8148
158 Ga0207695_10004741 3300025913 Bacteria 18408
159 Ga0207695_10020416 3300025913 Bacteria 7589
160 Ga0207695_10057203 3300025913 Bacteria 4053
161 Ga0207695_10060121 3300025913 Bacteria 3935
162 Ga0207671_10000658 3300025914 Bacteria 45037
163 Ga0207671_10002252 3300025914 Bacteria 20883
164 Ga0207671_10003710 3300025914 Bacteria 15047
165 Ga0207671_10008821 3300025914 Bacteria 8493
166 Ga0207671_10017838 3300025914 Bacteria 5461
167 Ga0207693_10047360 3300025915 Bacteria 3378
168 Ga0207660_10004252 3300025917 Bacteria 9334
169 Ga0207657_10010024 3300025919 Bacteria 9479
170 Ga0207657_10040155 3300025919 Bacteria 4149
171 Ga0207657_10100264 3300025919 Bacteria 2404
172 Ga0207657_10486333 3300025919 Bacteria 967
173 Ga0207649_10000027 3300025920 Bacteria 161926
174 Ga0207652_10000003 3300025921 Bacteria 502441
175 Ga0207652_10481563 3300025921 Bacteria 1118
176 Ga0207681_10000089 3300025923 Bacteria 79526
177 Ga0207694_10008129 3300025924 Bacteria 7926
178 Ga0207694_10059432 3300025924 Bacteria 2973
179 Ga0207694_10069023 3300025924 Bacteria 2761
180 Ga0207650_10126260 3300025925 Bacteria 1997
181 Ga0207650_10202941 3300025925 Bacteria 1589
182 Ga0207687_10001257 3300025927 Bacteria 17337
183 Ga0207644_10004047 3300025931 Bacteria 9509
184 Ga0207690_10009709 3300025932 Bacteria 5714
185 Ga0207690_10082304 3300025932 Bacteria 2251
186 Ga0207706_10071534 3300025933 Bacteria 3051
187 Ga0207706_10178512 3300025933 Bacteria 1865
188 Ga0207686_10164921 3300025934 Bacteria 1557
189 Ga0207709_10000018 3300025935 Bacteria 431545
190 Ga0207669_10000519 3300025937 Bacteria 16855
191 Ga0207665_10209181 3300025939 Bacteria 1424
192 Ga0207691_10225983 3300025940 Bacteria 1622
193 Ga0207711_10004240 3300025941 Bacteria 12267
194 Ga0207711_10012992 3300025941 Bacteria 6918
195 Ga0207711_10041007 3300025941 Bacteria 3940
196 Ga0207661_10056673 3300025944 Bacteria 3147
197 Ga0207679_10204615 3300025945 Bacteria 1651
198 Ga0207679_10504334 3300025945 Bacteria 1080
199 Ga0207667_10000069 3300025949 Bacteria 180683
200 Ga0207667_10046245 3300025949 Bacteria 4608
201 Ga0207667_10749622 3300025949 Bacteria 976
202 Ga0207651_10431281 3300025960 Bacteria 1127
203 Ga0207712_10000002 3300025961 Bacteria 706628
204 Ga0207712_10000004 3300025961 Bacteria 614655
205 Ga0207668_10104406 3300025972 Bacteria 2112
206 Ga0207640_10001029 3300025981 Bacteria 15417
207 Ga0207640_10013409 3300025981 Bacteria 4696
208 Ga0207640_10274257 3300025981 Bacteria 1321
209 Ga0207658_10000196 3300025986 Bacteria 63933
210 Ga0207658_10002005 3300025986 Bacteria 15177
211 Ga0207658_10048831 3300025986 Bacteria 3106
212 Ga0207703_10000938 3300026035 Bacteria 28262
213 Ga0207703_10004368 3300026035 Bacteria 11617
214 Ga0207703_10006515 3300026035 Bacteria 9317
215 Ga0207639_10009327 3300026041 Bacteria 6766
216 Ga0207639_10088489 3300026041 Bacteria 2471
217 Ga0207678_10002303 3300026067 Bacteria 17294
218 Ga0207678_10072468 3300026067 Bacteria 2952
219 Ga0207702_10001915 3300026078 Bacteria 20339
220 Ga0207702_10014385 3300026078 Bacteria 6569
221 Ga0207641_10000428 3300026088 Bacteria 48639
222 Ga0207641_10009799 3300026088 Bacteria 7888
223 Ga0207641_10027160 3300026088 Bacteria 4726
224 Ga0207676_10001679 3300026095 Bacteria 16324
225 Ga0207674_10057130 3300026116 Bacteria 3957
226 Ga0207674_10776134 3300026116 Bacteria 925
227 Ga0207675_100000038 3300026118 Bacteria 93037
228 Ga0207675_100000449 3300026118 Bacteria 39979
229 Ga0207683_10149797 3300026121 Bacteria 2105
230 Ga0207698_10019699 3300026142 Bacteria 4625
231 Ga0207698_10072177 3300026142 Bacteria 2743
232 Ga0268266_10000015 3300028379 Bacteria 630629
233 Ga0268266_10000225 3300028379 Bacteria 98082
234 Ga0268266_10238344 3300028379 Bacteria 1678
235 Ga0268265_10000086 3300028380 Bacteria 119049
236 Ga0268265_10000141 3300028380 Bacteria 91426
237 Ga0268264_10000003 3300028381 Bacteria 1141976
238 Ga0268264_10000228 3300028381 Bacteria 108722
239 Ga0268264_10000788 3300028381 Bacteria 34588
240 Ga0307517_10036460 3300028786 Bacteria 5530
241 Ga0307517_10085079 3300028786 Bacteria 2654
242 Ga0307513_10023204 3300031456 Bacteria 7254
243 Ga0307513_10036971 3300031456 Bacteria 5438
244 Ga0307509_10280702 3300031507 Bacteria 1427
245 Ga0307508_10000550 3300031616 Bacteria 44447
246 Ga0307412_10001509 3300031911 Bacteria 12928
247 Ga0307412_10036244 3300031911 Bacteria 3158
248 Ga0307510_10100106 3300033180 Bacteria 2694
249 Ga0373954_0113621 3300035118 Bacteria 1311
250 Ga0395905_0573856 3300037471 Bacteria 1029
251 Ga0395905_0621961 3300037471 Bacteria 982
252 Ga0395901_0278309 3300038443 Bacteria 1739
253 Ga0395901_0544445 3300038443 Bacteria 1177
254 Ga0436363_0533682 3300039450 Bacteria 9963
255 Ga0451807_0086616 3300041486 Bacteria 2903
256 Ga0466960_0067655 3300044901 Bacteria 1770
257 Ga0495638_0342988 3300046460 Bacteria 791
258 Ga0495650_0000879 3300046471 Bacteria 35608
259 Ga0495650_0090015 3300046471 Bacteria 1169
260 Ga0495584_0102052 3300046491 Bacteria 1450
261 Ga0495585_0068676 3300046492 Bacteria 1935
262 Ga0495585_0077946 3300046492 Bacteria 1798
263 Ga0495583_0009822 3300046506 Bacteria 5671
264 Ga0495583_0049302 3300046506 Bacteria 1929
265 Ga0495583_0073199 3300046506 Bacteria 1502
266 Ga0495606_0000372 3300046507 Bacteria 76478
267 Ga0495606_0053863 3300046507 Bacteria 2608
268 Ga0495616_0044147 3300046513 Bacteria 2262
269 Ga0495643_0007640 3300046522 Bacteria 6942
270 Ga0495643_0008168 3300046522 Bacteria 6657
271 Ga0495643_0150601 3300046522 Bacteria 1152
272 Ga0495648_0000024 3300046524 Bacteria 235605
273 Ga0495648_0112570 3300046524 Bacteria 1478
274 Ga0495648_0206066 3300046524 Bacteria 981
275 Ga0495648_0289086 3300046524 Bacteria 773
276 Ga0495663_0019544 3300046525 Bacteria 1940
277 Ga0495663_0108989 3300046525 Bacteria 918
278 Ga0495642_0003570 3300046528 Bacteria 6124
279 Ga0495622_0050908 3300046557 Bacteria 1921
280 Ga0495633_0006344 3300046558 Bacteria 7033
281 Ga0495668_0000084 3300046616 Bacteria 153179
282 Ga0495625_0000774 3300046660 Bacteria 44511
283 Ga0495625_0001098 3300046660 Bacteria 35115
284 Ga0495625_0151584 3300046660 Bacteria 1558
285 Ga0495625_0167943 3300046660 Bacteria 1466
286 Ga0495625_0188758 3300046660 Bacteria 1366
287 Ga0495661_0139523 3300046665 Bacteria 1320
288 Ga0495613_0578398 3300046689 Bacteria 749
289 Ga0495649_0093277 3300046694 Bacteria 1603
290 Ga0495600_0000952 3300046809 Bacteria 15558
291 Ga0495683_0015896 3300047323 Bacteria 3909
292 Ga0495687_000300 3300047443 Bacteria 65580
293 Ga0495677_0033916 3300047445 Bacteria 1861
294 Ga0495681_0035382 3300047470 Bacteria 2480
295 Ga0495686_0001274 3300047472 Bacteria 28520
296 Ga0495686_0101990 3300047472 Bacteria 1729
297 Ga0496101_0233596 3300048904 Bacteria 1430
298 Ga0496102_0000647 3300048905 Bacteria 35229
299 Ga0496102_0090636 3300048905 Bacteria 2829
300 Ga0496103_0000478 3300048906 Bacteria 33686
301 Ga0496104_0079050 3300048907 Bacteria 3135
302 Ga0496104_0383857 3300048907 Bacteria 1317
303 Ga0496105_0061245 3300048908 Bacteria 3105
304 Ga0496105_0101162 3300048908 Bacteria 2380
305 Ga0496107_0122760 3300048910 Bacteria 1914
306 Ga0496110_0297141 3300048913 Bacteria 1471
307 Ga0496111_0007233 3300048914 Bacteria 7261
308 Ga0496111_0054703 3300048914 Bacteria 2886
309 Ga0496113_0107465 3300048916 Bacteria 2168
310 Ga0496115_0000061 3300048918 Bacteria 101438
311 Ga0496115_0280241 3300048918 Bacteria 1369
312 Ga0496116_0023237 3300048919 Bacteria 4622
313 Ga0496116_0078398 3300048919 Bacteria 2060
314 Ga0496117_0000281 3300048920 Bacteria 94664
315 Ga0496117_0186618 3300048920 Bacteria 1186
316 Ga0496118_0000555 3300048921 Bacteria 61594
317 Ga0496118_0021179 3300048921 Bacteria 5732
318 Ga0496118_0079110 3300048921 Bacteria 2322
319 Ga0496119_0086175 3300048922 Bacteria 1796
320 Ga0496120_0024787 3300048923 Bacteria 3733
321 Ga0496120_0140066 3300048923 Bacteria 1229
322 Ga0496121_0000069 3300048924 Bacteria 253087
323 Ga0496121_0028474 3300048924 Bacteria 5199
324 Ga0496121_0049600 3300048924 Bacteria 3557
325 Ga0496121_0075182 3300048924 Bacteria 2700
326 Ga0496122_0024115 3300048925 Bacteria 5333
327 Ga0496123_0083314 3300048926 Bacteria 1934
328 Ga0496123_0114855 3300048926 Bacteria 1529
329 Ga0496124_0000266 3300048927 Bacteria 101288
330 Ga0496124_0002241 3300048927 Bacteria 25721
331 Ga0496124_0003039 3300048927 Bacteria 20964
332 Ga0496124_0042634 3300048927 Bacteria 3906
333 Ga0496125_0015947 3300048928 Bacteria 7236
334 Ga0496125_0231716 3300048928 Bacteria 1180
335 Ga0496126_0001074 3300048929 Bacteria 45978
336 Ga0496126_0002142 3300048929 Bacteria 27515
337 Ga0496126_0252508 3300048929 Bacteria 1469
338 Ga0496126_0349804 3300048929 Bacteria 1209
339 nmdc:mga0qj67_11035_c1 3300050509 Bacteria 6764
340 Ga0500647_0312110 3300053091 Bacteria 668
341 Ga0500595_000700 3300053119 Bacteria 20020
342 Ga0500595_006740 3300053119 Bacteria 4841
343 Ga0500595_033629 3300053119 Bacteria 1700
344 Ga0500597_008941 3300053120 Bacteria 3495
345 Ga0500642_0001274 3300053130 Bacteria 7206
346 Ga0500559_0095443 3300053136 Bacteria 1365
347 Ga0500559_0112895 3300053136 Bacteria 1260
348 Ga0500573_0000022 3300053140 Bacteria 154562
349 Ga0500573_0200050 3300053140 Bacteria 1061
350 Ga0500619_030993 3300053154 Bacteria 1629
351 Ga0500624_000003 3300053157 Bacteria 253364
352 Ga0500636_0082437 3300053177 Bacteria 1851
353 Ga0500637_0000038 3300053178 Bacteria 47386
354 Ga0500645_002595 3300053730 Bacteria 7942
355 Ga0500596_002616 3300053735 Bacteria 3533

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046460 Ga0495638_0342988 Ga0495638_0342988_190_780 184
2 iso_pu_bacteria 2928526807 2928529338 191
3 3300025940 Ga0207691_10225983 Ga0207691_102259832 193
4 3300048913 Ga0496110_0297141 Ga0496110_0297141_813_1436 195
5 3300053091 Ga0500647_0312110 Ga0500647_0312110_27_650 195
6 3300003215 JGI25153J46596_10000005 JGI25153J46596_10000005185 196
7 3300025297 Ga0209758_1000001 Ga0209758_1000001188 196
8 3300031911 Ga0307412_10036244 Ga0307412_100362445 196
9 3300037471 Ga0395905_0621961 Ga0395905_0621961_28_645 199
10 3300006186 Ga0075369_10200113 Ga0075369_102001132 209
11 3300025919 Ga0207657_10486333 Ga0207657_104863332 209
12 3300046524 Ga0495648_0000024 Ga0495648_0000024_201532_202197 209
13 3300046660 Ga0495625_0000774 Ga0495625_0000774_42756_43421 209
14 3300047470 Ga0495681_0035382 Ga0495681_0035382_842_1507 209
15 3300053130 Ga0500642_0001274 Ga0500642_0001274_908_1573 209
16 3300046524 Ga0495648_0289086 Ga0495648_0289086_77_751 210
17 iso_pu_bacteria 2879163058 2879165114 210
18 3300005548 Ga0070665_100000021 Ga0070665_100000021100 212
19 3300028379 Ga0268266_10000015 Ga0268266_10000015351 212
20 3300048923 Ga0496120_0140066 Ga0496120_0140066_225_881 212
21 3300048927 Ga0496124_0002241 Ga0496124_0002241_24413_25069 212
22 iso_pu_bacteria 2751185897 2753767128 213
23 3300046471 Ga0495650_0090015 Ga0495650_0090015_27_680 214
24 3300001915 JGI24741J21665_1000775 JGI24741J21665_10007758 215
25 3300001979 JGI24740J21852_10051252 JGI24740J21852_100512522 215
26 3300001990 JGI24737J22298_10011196 JGI24737J22298_100111963 215
27 3300005327 Ga0070658_10026692 Ga0070658_100266924 215
28 3300005339 Ga0070660_100002485 Ga0070660_10000248515 215
29 3300005339 Ga0070660_100075904 Ga0070660_1000759043 215
30 3300005344 Ga0070661_100223361 Ga0070661_1002233612 215
31 3300005364 Ga0070673_100430232 Ga0070673_1004302322 215
32 3300005366 Ga0070659_100144291 Ga0070659_1001442912 215
33 3300005455 Ga0070663_100077760 Ga0070663_1000777602 215
34 3300005535 Ga0070684_100109344 Ga0070684_1001093443 215
35 3300005539 Ga0068853_100219888 Ga0068853_1002198882 215
36 3300025261 Ga0209233_1021410 Ga0209233_10214102 215
37 3300025919 Ga0207657_10010024 Ga0207657_1001002413 215
38 iso_pu_bacteria 2885429604 2885432045 215
39 3300053119 Ga0500595_000700 Ga0500595_000700_15522_16190 216
40 iso_pu_bacteria 2599185359 2600228280 216
41 iso_pu_bacteria 2818991466 2819714775 216
42 iso_pu_bacteria 2928968154 2928968824 216
43 3300003316 rootH1_10093282 rootH1_100932822 217
44 3300005617 Ga0068859_100006308 Ga0068859_1000063089 217
45 3300005719 Ga0068861_100000271 Ga0068861_10000027123 217
46 3300005985 Ga0081539_10016379 Ga0081539_100163794 217
47 3300006846 Ga0075430_100007354 Ga0075430_1000073545 217
48 3300006931 Ga0097620_100006308 Ga0097620_1000063089 217
49 3300009177 Ga0105248_10025328 Ga0105248_100253282 217
50 3300009545 Ga0105237_10004010 Ga0105237_100040104 217
51 3300014326 Ga0157380_10313841 Ga0157380_103138412 217
52 3300014968 Ga0157379_10014589 Ga0157379_100145897 217
53 3300025914 Ga0207671_10002252 Ga0207671_1000225214 217
54 3300025941 Ga0207711_10012992 Ga0207711_1001299211 217
55 3300026118 Ga0207675_100000038 Ga0207675_10000003867 217
56 3300050509 nmdc:mga0qj67_11035_c1 nmdc:mga0qj67_11035_c1_4021_4695 217
57 3300005327 Ga0070658_10208667 Ga0070658_102086672 219
58 3300005617 Ga0068859_100053773 Ga0068859_1000537732 219
59 3300005841 Ga0068863_100029844 Ga0068863_1000298441 219
60 3300005843 Ga0068860_100008125 Ga0068860_1000081251 219
61 3300005844 Ga0068862_100000059 Ga0068862_1000000596 219
62 3300006931 Ga0097620_100053773 Ga0097620_1000537732 219
63 3300009101 Ga0105247_10004620 Ga0105247_100046206 219
64 3300009553 Ga0105249_10000065 Ga0105249_10000065102 219
65 3300014326 Ga0157380_10742010 Ga0157380_107420102 219
66 3300025900 Ga0207710_10002558 Ga0207710_100025586 219
67 3300025909 Ga0207705_10339120 Ga0207705_103391202 219
68 3300025961 Ga0207712_10000002 Ga0207712_10000002271 219
69 3300026088 Ga0207641_10027160 Ga0207641_100271605 219
70 3300028380 Ga0268265_10000141 Ga0268265_1000014139 219
71 3300028381 Ga0268264_10000788 Ga0268264_100007886 219
72 3300031456 Ga0307513_10023204 Ga0307513_100232042 219
73 3300037471 Ga0395905_0573856 Ga0395905_0573856_101_778 219
74 3300002244 JGI24742J22300_10001491 JGI24742J22300_100014912 220
75 3300003762 Ga0055542_1000088 Ga0055542_1000088105 220
76 3300003762 Ga0055542_1000293 Ga0055542_10002938 220
77 3300003763 Ga0055529_1000034 Ga0055529_1000034105 220
78 3300005367 Ga0070667_100055889 Ga0070667_1000558894 220
79 3300005457 Ga0070662_100134473 Ga0070662_1001344733 220
80 3300005459 Ga0068867_100391424 Ga0068867_1003914241 220
81 3300005563 Ga0068855_100313731 Ga0068855_1003137312 220
82 3300005578 Ga0068854_100013179 Ga0068854_1000131795 220
83 3300005578 Ga0068854_100135107 Ga0068854_1001351073 220
84 3300005616 Ga0068852_100555846 Ga0068852_1005558462 220
85 3300005834 Ga0068851_10052262 Ga0068851_100522623 220
86 3300006237 Ga0097621_100083685 Ga0097621_1000836851 220
87 3300009148 Ga0105243_10000030 Ga0105243_10000030129 220
88 3300009174 Ga0105241_10005131 Ga0105241_100051319 220
89 3300009176 Ga0105242_10467238 Ga0105242_104672382 220
90 3300009545 Ga0105237_10010310 Ga0105237_100103104 220
91 3300011119 Ga0105246_10301227 Ga0105246_103012272 220
92 3300013102 Ga0157371_10000043 Ga0157371_10000043128 220
93 3300017792 Ga0163161_10166110 Ga0163161_101661102 220
94 3300025246 Ga0209646_1002469 Ga0209646_10024692 220
95 3300025253 Ga0209677_112012 Ga0209677_1120122 220
96 3300025254 Ga0209148_1000093 Ga0209148_1000093110 220
97 3300025272 Ga0209455_1000045 Ga0209455_1000045251 220
98 3300025321 Ga0207656_10000833 Ga0207656_1000083312 220
99 3300025904 Ga0207647_10018510 Ga0207647_100185104 220
100 3300025904 Ga0207647_10144267 Ga0207647_101442672 220
101 3300025909 Ga0207705_10025529 Ga0207705_100255292 220
102 3300025911 Ga0207654_10003313 Ga0207654_100033139 220
103 3300025913 Ga0207695_10057203 Ga0207695_100572034 220
104 3300025914 Ga0207671_10003710 Ga0207671_100037109 220
105 3300025914 Ga0207671_10008821 Ga0207671_1000882111 220
106 3300025919 Ga0207657_10100264 Ga0207657_101002643 220
107 3300025924 Ga0207694_10069023 Ga0207694_100690235 220
108 3300025925 Ga0207650_10202941 Ga0207650_102029412 220
109 3300025932 Ga0207690_10009709 Ga0207690_100097094 220
110 3300025933 Ga0207706_10178512 Ga0207706_101785121 220
111 3300025935 Ga0207709_10000018 Ga0207709_10000018364 220
112 3300025937 Ga0207669_10000519 Ga0207669_1000051910 220
113 3300025945 Ga0207679_10504334 Ga0207679_105043342 220
114 3300025949 Ga0207667_10000069 Ga0207667_1000006937 220
115 3300025960 Ga0207651_10431281 Ga0207651_104312812 220
116 3300025981 Ga0207640_10001029 Ga0207640_1000102914 220
117 3300025981 Ga0207640_10013409 Ga0207640_100134094 220
118 3300025986 Ga0207658_10048831 Ga0207658_100488314 220
119 3300026041 Ga0207639_10009327 Ga0207639_100093274 220
120 3300026067 Ga0207678_10002303 Ga0207678_100023037 220
121 3300026078 Ga0207702_10014385 Ga0207702_100143856 220
122 3300026116 Ga0207674_10057130 Ga0207674_100571303 220
123 3300026121 Ga0207683_10149797 Ga0207683_101497973 220
124 3300026142 Ga0207698_10072177 Ga0207698_100721775 220
125 3300028786 Ga0307517_10085079 Ga0307517_100850792 220
126 3300033180 Ga0307510_10100106 Ga0307510_101001063 220
127 3300046471 Ga0495650_0000879 Ga0495650_0000879_1074_1772 220
128 3300046491 Ga0495584_0102052 Ga0495584_0102052_90_788 220
129 3300046492 Ga0495585_0068676 Ga0495585_0068676_734_1432 220
130 3300046492 Ga0495585_0077946 Ga0495585_0077946_393_1091 220
131 3300046506 Ga0495583_0009822 Ga0495583_0009822_3998_4696 220
132 3300046506 Ga0495583_0049302 Ga0495583_0049302_728_1426 220
133 3300046506 Ga0495583_0073199 Ga0495583_0073199_102_800 220
134 3300046507 Ga0495606_0000372 Ga0495606_0000372_29709_30407 220
135 3300046507 Ga0495606_0053863 Ga0495606_0053863_1576_2274 220
136 3300046513 Ga0495616_0044147 Ga0495616_0044147_417_1115 220
137 3300046522 Ga0495643_0007640 Ga0495643_0007640_5527_6225 220
138 3300046522 Ga0495643_0008168 Ga0495643_0008168_4796_5494 220
139 3300046524 Ga0495648_0112570 Ga0495648_0112570_103_801 220
140 3300046525 Ga0495663_0019544 Ga0495663_0019544_1062_1760 220
141 3300046528 Ga0495642_0003570 Ga0495642_0003570_376_1074 220
142 3300046557 Ga0495622_0050908 Ga0495622_0050908_1097_1795 220
143 3300046558 Ga0495633_0006344 Ga0495633_0006344_5595_6293 220
144 3300046616 Ga0495668_0000084 Ga0495668_0000084_66510_67208 220
145 3300046660 Ga0495625_0151584 Ga0495625_0151584_567_1265 220
146 3300046660 Ga0495625_0188758 Ga0495625_0188758_638_1336 220
147 3300046665 Ga0495661_0139523 Ga0495661_0139523_549_1247 220
148 3300046689 Ga0495613_0578398 Ga0495613_0578398_23_721 220
149 3300046694 Ga0495649_0093277 Ga0495649_0093277_573_1271 220
150 3300046809 Ga0495600_0000952 Ga0495600_0000952_13665_14363 220
151 3300047323 Ga0495683_0015896 Ga0495683_0015896_2379_3077 220
152 3300047443 Ga0495687_000300 Ga0495687_000300_1021_1719 220
153 3300047445 Ga0495677_0033916 Ga0495677_0033916_1032_1730 220
154 3300048904 Ga0496101_0233596 Ga0496101_0233596_303_1001 220
155 3300048905 Ga0496102_0000647 Ga0496102_0000647_1024_1722 220
156 3300048906 Ga0496103_0000478 Ga0496103_0000478_874_1572 220
157 3300048907 Ga0496104_0079050 Ga0496104_0079050_1809_2507 220
158 3300048908 Ga0496105_0061245 Ga0496105_0061245_715_1413 220
159 3300048914 Ga0496111_0007233 Ga0496111_0007233_5640_6338 220
160 3300048916 Ga0496113_0107465 Ga0496113_0107465_850_1548 220
161 3300048918 Ga0496115_0000061 Ga0496115_0000061_99720_100418 220
162 3300048919 Ga0496116_0023237 Ga0496116_0023237_2990_3688 220
163 3300048920 Ga0496117_0000281 Ga0496117_0000281_778_1476 220
164 3300048921 Ga0496118_0000555 Ga0496118_0000555_933_1631 220
165 3300048923 Ga0496120_0024787 Ga0496120_0024787_2200_2898 220
166 3300048924 Ga0496121_0049600 Ga0496121_0049600_1825_2523 220
167 3300048925 Ga0496122_0024115 Ga0496122_0024115_886_1584 220
168 3300048926 Ga0496123_0083314 Ga0496123_0083314_545_1243 220
169 3300048926 Ga0496123_0114855 Ga0496123_0114855_499_1179 220
170 3300048927 Ga0496124_0000266 Ga0496124_0000266_99737_100435 220
171 3300048927 Ga0496124_0003039 Ga0496124_0003039_547_1227 220
172 3300048927 Ga0496124_0042634 Ga0496124_0042634_2999_3679 220
173 3300048928 Ga0496125_0015947 Ga0496125_0015947_878_1576 220
174 3300048928 Ga0496125_0231716 Ga0496125_0231716_15_695 220
175 3300048929 Ga0496126_0001074 Ga0496126_0001074_1034_1732 220
176 3300053119 Ga0500595_006740 Ga0500595_006740_3297_3995 220
177 3300053154 Ga0500619_030993 Ga0500619_030993_687_1385 220
178 3300053177 Ga0500636_0082437 Ga0500636_0082437_456_1154 220
179 iso_pu_bacteria 2889306138 2889307456 220
180 iso_pu_bacteria 2889306138 2889309940 220
181 iso_pu_bacteria 2902405164 2902409371 220
182 iso_pu_bacteria 641522639 641646945 220
183 iso_pu_bacteria 8057101203 8057105557 221
184 3300005842 Ga0068858_100002166 Ga0068858_10000216611 222
185 3300009177 Ga0105248_10004882 Ga0105248_1000488211 222
186 3300013306 Ga0163162_10023676 Ga0163162_100236767 222
187 3300025315 Ga0207697_10013606 Ga0207697_100136062 222
188 3300025933 Ga0207706_10071534 Ga0207706_100715342 222
189 3300025941 Ga0207711_10004240 Ga0207711_100042408 222
190 3300026035 Ga0207703_10000938 Ga0207703_1000093811 222
191 3300035118 Ga0373954_0113621 Ga0373954_0113621_55_735 223
192 3300005262 Ga0065165_1012136 Ga0065165_10121366 224
193 3300005331 Ga0070670_100504452 Ga0070670_1005044521 224
194 3300005336 Ga0070680_100023453 Ga0070680_1000234531 224
195 3300005344 Ga0070661_100000764 Ga0070661_1000007644 224
196 3300005434 Ga0070709_10217892 Ga0070709_102178922 224
197 3300005436 Ga0070713_100235744 Ga0070713_1002357443 224
198 3300005458 Ga0070681_10019073 Ga0070681_100190734 224
199 3300005530 Ga0070679_100000001 Ga0070679_100000001466 224
200 3300006173 Ga0070716_100391237 Ga0070716_1003912372 224
201 3300013306 Ga0163162_11300539 Ga0163162_113005391 224
202 3300025915 Ga0207693_10047360 Ga0207693_100473602 224
203 3300025917 Ga0207660_10004252 Ga0207660_100042522 224
204 3300025920 Ga0207649_10000027 Ga0207649_1000002752 224
205 3300025921 Ga0207652_10000003 Ga0207652_1000000363 224
206 3300025939 Ga0207665_10209181 Ga0207665_102091812 224
207 3300025944 Ga0207661_10056673 Ga0207661_100566737 224
208 3300038443 Ga0395901_0278309 Ga0395901_0278309_448_1140 224
209 3300038443 Ga0395901_0544445 Ga0395901_0544445_119_811 224
210 3300039450 Ga0436363_0533682 Ga0436363_0533682_2100_2792 224
211 3300044901 Ga0466960_0067655 Ga0466960_0067655_411_1103 224
212 3300053140 Ga0500573_0200050 Ga0500573_0200050_221_913 224
213 3300009093 Ga0105240_10029747 Ga0105240_100297479 225
214 3300009093 Ga0105240_10036683 Ga0105240_100366832 225
215 3300009545 Ga0105237_10008128 Ga0105237_100081287 225
216 3300010375 Ga0105239_10000031 Ga0105239_10000031201 225
217 3300013297 Ga0157378_10578863 Ga0157378_105788632 225
218 3300025913 Ga0207695_10020416 Ga0207695_100204169 225
219 3300025913 Ga0207695_10060121 Ga0207695_100601215 225
220 3300025914 Ga0207671_10017838 Ga0207671_100178382 225
221 3300025924 Ga0207694_10059432 Ga0207694_100594322 225
222 3300028786 Ga0307517_10036460 Ga0307517_100364607 225
223 3300041486 Ga0451807_0086616 Ga0451807_0086616_346_1041 225
224 3300047472 Ga0495686_0001274 Ga0495686_0001274_21546_22241 225
225 3300048920 Ga0496117_0186618 Ga0496117_0186618_98_793 225
226 3300048921 Ga0496118_0079110 Ga0496118_0079110_54_749 225
227 3300048924 Ga0496121_0000069 Ga0496121_0000069_226149_226844 225
228 3300048929 Ga0496126_0002142 Ga0496126_0002142_5721_6416 225
229 3300048929 Ga0496126_0252508 Ga0496126_0252508_404_1099 225
230 3300048929 Ga0496126_0349804 Ga0496126_0349804_351_1046 225
231 3300053120 Ga0500597_008941 Ga0500597_008941_639_1337 225
232 3300053157 Ga0500624_000003 Ga0500624_000003_8001_8699 225
233 3300053178 Ga0500637_0000038 Ga0500637_0000038_7972_8670 225
234 3300053730 Ga0500645_002595 Ga0500645_002595_33_728 225
235 3300003214 JGI25165J46597_1000138 JGI25165J46597_10001387 226
236 3300003759 Ga0055525_1000037 Ga0055525_1000037198 226
237 3300005327 Ga0070658_10310771 Ga0070658_103107711 226
238 3300005367 Ga0070667_100000098 Ga0070667_10000009855 226
239 3300005530 Ga0070679_100278663 Ga0070679_1002786632 226
240 3300005548 Ga0070665_100359958 Ga0070665_1003599582 226
241 3300005842 Ga0068858_100000318 Ga0068858_10000031824 226
242 3300005843 Ga0068860_100000164 Ga0068860_10000016455 226
243 3300009098 Ga0105245_10001471 Ga0105245_1000147118 226
244 3300009148 Ga0105243_10065420 Ga0105243_100654204 226
245 3300009176 Ga0105242_10342134 Ga0105242_103421342 226
246 3300013297 Ga0157378_10121452 Ga0157378_101214523 226
247 3300013297 Ga0157378_10250730 Ga0157378_102507302 226
248 3300013306 Ga0163162_10519686 Ga0163162_105196861 226
249 3300025230 Ga0209563_100053 Ga0209563_100053273 226
250 3300025233 Ga0209437_103131 Ga0209437_1031312 226
251 3300025261 Ga0209233_1000182 Ga0209233_100018217 226
252 3300025921 Ga0207652_10481563 Ga0207652_104815631 226
253 3300025927 Ga0207687_10001257 Ga0207687_100012579 226
254 3300025934 Ga0207686_10164921 Ga0207686_101649212 226
255 3300025949 Ga0207667_10749622 Ga0207667_107496222 226
256 3300025986 Ga0207658_10000196 Ga0207658_1000019654 226
257 3300026035 Ga0207703_10004368 Ga0207703_100043684 226
258 3300026088 Ga0207641_10009799 Ga0207641_100097993 226
259 3300028379 Ga0268266_10238344 Ga0268266_102383442 226
260 3300028381 Ga0268264_10000228 Ga0268264_1000022860 226
261 3300031456 Ga0307513_10036971 Ga0307513_100369714 226
262 3300031507 Ga0307509_10280702 Ga0307509_102807023 226
263 3300031616 Ga0307508_10000550 Ga0307508_1000055039 226
264 3300031911 Ga0307412_10001509 Ga0307412_100015093 226
265 3300046522 Ga0495643_0150601 Ga0495643_0150601_256_954 226
266 3300046524 Ga0495648_0206066 Ga0495648_0206066_182_907 226
267 3300046525 Ga0495663_0108989 Ga0495663_0108989_61_780 226
268 3300046660 Ga0495625_0001098 Ga0495625_0001098_33955_34653 226
269 3300046660 Ga0495625_0167943 Ga0495625_0167943_102_821 226
270 3300047472 Ga0495686_0101990 Ga0495686_0101990_590_1309 226
271 3300048918 Ga0496115_0280241 Ga0496115_0280241_406_1104 226
272 3300048924 Ga0496121_0028474 Ga0496121_0028474_466_1185 226
273 3300053119 Ga0500595_033629 Ga0500595_033629_710_1408 226
274 3300053136 Ga0500559_0095443 Ga0500559_0095443_373_1071 226
275 3300053136 Ga0500559_0112895 Ga0500559_0112895_370_1068 226
276 3300053735 Ga0500596_002616 Ga0500596_002616_823_1521 226
277 3300005347 Ga0070668_100124855 Ga0070668_1001248552 227
278 3300025972 Ga0207668_10104406 Ga0207668_101044063 227
279 3300053140 Ga0500573_0000022 Ga0500573_0000022_153313_154014 227
280 3300001904 JGI24736J21556_1000009 JGI24736J21556_100000932 229
281 3300001976 JGI24752J21851_1000043 JGI24752J21851_10000434 229
282 3300001979 JGI24740J21852_10010122 JGI24740J21852_100101223 229
283 3300001990 JGI24737J22298_10025350 JGI24737J22298_100253502 229
284 3300002070 JGI24750J21931_1001696 JGI24750J21931_10016962 229
285 3300002074 JGI24748J21848_1000026 JGI24748J21848_1000026118 229
286 3300002075 JGI24738J21930_10001213 JGI24738J21930_100012133 229
287 3300002076 JGI24749J21850_1000317 JGI24749J21850_100031712 229
288 3300002239 JGI24034J26672_10000015 JGI24034J26672_1000001545 229
289 3300002244 JGI24742J22300_10004442 JGI24742J22300_100044421 229
290 3300002459 JGI24751J29686_10021950 JGI24751J29686_100219502 229
291 3300005327 Ga0070658_10019332 Ga0070658_100193323 229
292 3300005330 Ga0070690_100000025 Ga0070690_10000002543 229
293 3300005335 Ga0070666_10000015 Ga0070666_10000015184 229
294 3300005337 Ga0070682_100194224 Ga0070682_1001942241 229
295 3300005339 Ga0070660_100019602 Ga0070660_1000196025 229
296 3300005344 Ga0070661_100258136 Ga0070661_1002581361 229
297 3300005353 Ga0070669_100000059 Ga0070669_10000005984 229
298 3300005355 Ga0070671_100009469 Ga0070671_1000094693 229
299 3300005365 Ga0070688_100013459 Ga0070688_1000134593 229
300 3300005366 Ga0070659_100075286 Ga0070659_1000752862 229
301 3300005455 Ga0070663_100168014 Ga0070663_1001680142 229
302 3300005457 Ga0070662_100044820 Ga0070662_1000448202 229
303 3300005466 Ga0070685_10000247 Ga0070685_1000024735 229
304 3300005535 Ga0070684_100220589 Ga0070684_1002205892 229
305 3300005544 Ga0070686_100000006 Ga0070686_10000000669 229
306 3300005548 Ga0070665_100000217 Ga0070665_10000021770 229
307 3300005577 Ga0068857_100183703 Ga0068857_1001837033 229
308 3300005617 Ga0068859_100000937 Ga0068859_1000009373 229
309 3300005618 Ga0068864_100017721 Ga0068864_1000177213 229
310 3300005719 Ga0068861_100006465 Ga0068861_1000064653 229
311 3300005841 Ga0068863_100000108 Ga0068863_10000010857 229
312 3300005842 Ga0068858_100002534 Ga0068858_1000025344 229
313 3300005843 Ga0068860_100000050 Ga0068860_100000050185 229
314 3300005844 Ga0068862_100000062 Ga0068862_10000006244 229
315 3300006931 Ga0097620_100000937 Ga0097620_10000093735 229
316 3300009011 Ga0105251_10093864 Ga0105251_100938642 229
317 3300009092 Ga0105250_10064926 Ga0105250_100649262 229
318 3300009101 Ga0105247_10037189 Ga0105247_100371894 229
319 3300009177 Ga0105248_10021965 Ga0105248_100219655 229
320 3300009553 Ga0105249_10000034 Ga0105249_1000003442 229
321 3300013100 Ga0157373_10026314 Ga0157373_100263142 229
322 3300013306 Ga0163162_10106873 Ga0163162_101068735 229
323 3300013307 Ga0157372_10375760 Ga0157372_103757601 229
324 3300014326 Ga0157380_10000231 Ga0157380_1000023111 229
325 3300014968 Ga0157379_10005954 Ga0157379_100059543 229
326 3300017792 Ga0163161_10000051 Ga0163161_10000051110 229
327 3300025223 Ga0207672_1001009 Ga0207672_10010093 229
328 3300025900 Ga0207710_10052410 Ga0207710_100524102 229
329 3300025903 Ga0207680_10000007 Ga0207680_10000007446 229
330 3300025904 Ga0207647_10001146 Ga0207647_1000114618 229
331 3300025909 Ga0207705_10022866 Ga0207705_100228662 229
332 3300025911 Ga0207654_10001455 Ga0207654_100014558 229
333 3300025913 Ga0207695_10004741 Ga0207695_1000474118 229
334 3300025914 Ga0207671_10000658 Ga0207671_1000065826 229
335 3300025919 Ga0207657_10040155 Ga0207657_100401553 229
336 3300025923 Ga0207681_10000089 Ga0207681_1000008954 229
337 3300025924 Ga0207694_10008129 Ga0207694_100081297 229
338 3300025925 Ga0207650_10126260 Ga0207650_101262602 229
339 3300025931 Ga0207644_10004047 Ga0207644_1000404710 229
340 3300025932 Ga0207690_10082304 Ga0207690_100823043 229
341 3300025941 Ga0207711_10041007 Ga0207711_100410073 229
342 3300025945 Ga0207679_10204615 Ga0207679_102046151 229
343 3300025949 Ga0207667_10046245 Ga0207667_100462452 229
344 3300025961 Ga0207712_10000004 Ga0207712_10000004434 229
345 3300025981 Ga0207640_10274257 Ga0207640_102742572 229
346 3300025986 Ga0207658_10002005 Ga0207658_100020053 229
347 3300026035 Ga0207703_10006515 Ga0207703_100065152 229
348 3300026041 Ga0207639_10088489 Ga0207639_100884894 229
349 3300026067 Ga0207678_10072468 Ga0207678_100724683 229
350 3300026078 Ga0207702_10001915 Ga0207702_1000191522 229
351 3300026088 Ga0207641_10000428 Ga0207641_1000042810 229
352 3300026095 Ga0207676_10001679 Ga0207676_100016799 229
353 3300026116 Ga0207674_10776134 Ga0207674_107761341 229
354 3300026118 Ga0207675_100000449 Ga0207675_10000044919 229
355 3300026142 Ga0207698_10019699 Ga0207698_100196992 229
356 3300028379 Ga0268266_10000225 Ga0268266_1000022543 229
357 3300028380 Ga0268265_10000086 Ga0268265_10000086100 229
358 3300028381 Ga0268264_10000003 Ga0268264_10000003448 229
359 3300048905 Ga0496102_0090636 Ga0496102_0090636_275_964 229
360 3300048907 Ga0496104_0383857 Ga0496104_0383857_506_1195 229
361 3300048908 Ga0496105_0101162 Ga0496105_0101162_1525_2214 229
362 3300048910 Ga0496107_0122760 Ga0496107_0122760_817_1506 229
363 3300048914 Ga0496111_0054703 Ga0496111_0054703_1953_2642 229
364 3300048919 Ga0496116_0078398 Ga0496116_0078398_86_775 229
365 3300048921 Ga0496118_0021179 Ga0496118_0021179_1287_1976 229
366 3300048922 Ga0496119_0086175 Ga0496119_0086175_737_1426 229
367 3300048924 Ga0496121_0075182 Ga0496121_0075182_1693_2382 229

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01638

HxlR

HxlR-like helix-turn-helix

39

128

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hs9-assembly1.cif.gz_A crystal structure of the quinone-bound yodb from b. subtilis 0.936 22 112
5hs9-assembly1.cif.gz_B crystal structure of the quinone-bound yodb from b. subtilis 0.9136 24 112
7bze-assembly1.cif.gz_A-2 structure of bacillus subtilis hxlr, k13a mutant 0.9048 22 112
7kd3-assembly1.cif.gz_B structure of an hxlr/duf24 family transcription regulator, cdtr_3200 from hypervirulent clostridioides difficile r20291 0.8967 22 113
7bzd-assembly1.cif.gz_A-2 structure of bacillus subtilis hxlr, wild type 0.8921 22 112
ID Description Score Start End Superfamily
5hs9A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.936 22 112 1.10.10.10
5hs9B00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9136 24 112 1.10.10.10
af_Q58793_322_389_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8951 33 94 1.10.10.10
5hs9A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8859 22 112 1.10.10.10
4lb5A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.881 34 95 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A222WZ50-F1-model_v4 deleted 0.9801 41 225
AF-A0A1B3NAV3-F1-model_v4 HxlR-like helix-turn-helix family protein 0.9761 16 225 GO:0003677
AF-A0A173KVX8-F1-model_v4 Putative HTH-type transcriptional regulator YdeP 0.9594 16 229 GO:0003677
AF-A0A6L3VXI6-F1-model_v4 Transcriptional regulator 0.9578 16 227 GO:0003677
AF-A0A0Q4IY42-F1-model_v4 Transcriptional regulator 0.9542 13 229 GO:0003677

Feature Viewer

pLDDT pTM Quality
88.02 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map