F424461

General Info

Members Datasets Scaffolds Average Seq Length
367 250 734 273

Family's Representative Sequence

Representative Sequence 3300046520|Ga0495637_0020457|Ga0495637_0020457_1238_2218
Length 306
Sequence VDAGTGGPVDGSVGSVDEWPVQGVPGSGTLGSRQGTYARVRDGVRAYRMIAAMWIRSTMAYRASFVMTTFGNFAATALDFVAVLLMFSRVDRLGGYSLPEVAFLYGISATSFGITDLAVGSMDRLGRRVRDGTLDTLLVRPVPVLAQVAADRFALRRLGRVTQGLLVLVYAMAVLDIDWTPLRVLMVPLMLLCGAAVFAAVFVAGGAFQFVAQDASEVQNSFTYGGTTLLQYPPTVFAKDLVRGVTYVLPLAFVNWLPGLYVLGRPYPLDLPTWVAFTPPLVAAGCCALAGVAWRAGLRSYRSTGS

Samples

Sample ID Description Type Environment
1 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
2 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
5 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
6 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
7 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
8 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
9 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
10 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
11 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
12 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
13 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
14 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
15 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
16 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
17 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
18 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
19 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
20 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
21 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
27 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
28 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
29 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
30 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
31 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
32 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
33 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
34 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
35 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
36 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
37 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
38 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
39 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
40 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
41 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
42 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
43 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
44 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
45 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
46 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
47 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
48 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
49 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
50 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
51 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
52 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
53 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
54 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
55 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
56 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
57 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
58 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
59 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
60 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
61 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
62 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
63 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
64 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
65 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
66 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
67 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
68 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
69 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
70 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
71 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
72 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
73 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
74 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
75 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
76 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
77 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
78 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
79 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
80 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
81 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
82 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
83 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
84 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
85 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
86 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
87 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
88 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
89 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
90 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
91 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
92 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
93 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
94 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
95 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
96 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
97 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
98 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
99 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
100 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
101 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
102 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
103 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
104 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
105 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
106 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
107 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
108 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
109 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
110 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
111 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
112 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
113 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
114 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
115 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
116 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
117 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
118 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
119 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
120 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
121 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
122 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
123 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
124 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
125 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
126 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
127 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
128 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
129 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
130 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
131 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
132 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
133 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
134 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
135 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
136 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
137 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
138 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
139 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
140 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
141 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
142 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
143 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
144 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
145 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
146 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
147 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
148 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
149 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
150 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
151 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
152 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
153 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
163 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
164 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
165 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
166 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
168 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
169 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
170 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
171 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
172 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
173 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
174 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
175 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
176 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
177 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
178 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
179 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
180 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
181 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
182 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
183 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
184 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
185 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
186 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
187 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
188 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
189 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
190 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
191 2643221548 Streptomyces sp. Root55 Isolate Unclassified
192 2643221578 Streptomyces sp. Root63 Isolate Unclassified
193 2643221647 Streptomyces sp. Root369 Isolate Unclassified
194 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
195 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
196 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
197 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
198 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
199 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
200 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
201 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
202 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
203 2808606448 Streptomyces sp. 193411 Isolate Unclassified
204 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
205 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
206 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
207 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
208 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
209 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
210 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
211 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
212 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
213 2867369537 Streptomyces sp. Z26 Isolate Unclassified
214 2867428634 Streptomyces sp. RP5T Isolate Unclassified
215 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
216 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
217 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
218 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
219 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
220 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
221 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
222 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
223 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
224 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
225 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
226 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
227 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
228 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
229 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
230 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
231 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
232 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
233 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
234 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
235 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
236 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
237 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
238 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
239 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
240 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
241 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
242 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
243 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
244 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
245 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
246 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
247 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
248 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
249 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
250 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.74
Metatranscriptomes 0.27
Isolates 17.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.27
Nodule 0.82
Rhizoplane 2.18
Rhizosphere 77.66
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495637_0020457 3300046520 Bacteria 3045
2 Ga0006562J51391_1043956 3300003578 Bacteria 1810
3 Ga0070683_100216706 3300005329 Bacteria 1819
4 Ga0068856_100550561 3300005614 Bacteria 1175
5 Ga0070702_100196594 3300005615 Bacteria 1331
6 Ga0068866_10153188 3300005718 Bacteria 1337
7 Ga0081455_10080729 3300005937 Bacteria 2665
8 Ga0075363_100004732 3300006048 Bacteria 5994
9 Ga0075363_100009251 3300006048 Bacteria 4628
10 Ga0075367_10010444 3300006178 Bacteria 4878
11 Ga0099826_10073568 3300006948 Bacteria 2159
12 Ga0105251_10003022 3300009011 Bacteria 12546
13 Ga0105243_10335859 3300009148 Bacteria 1382
14 Ga0105238_10151275 3300009551 Bacteria 2296
15 Ga0105238_10183307 3300009551 Bacteria 2070
16 Ga0157372_10064368 3300013307 Bacteria 4115
17 Ga0163163_10033828 3300014325 Bacteria 4947
18 Ga0182006_1017789 3300015261 Bacteria 3014
19 Ga0182007_10000849 3300015262 Bacteria 16947
20 Ga0183367_1006 3300015688 Bacteria 648044
21 Ga0209758_1009748 3300025297 Bacteria 5897
22 Ga0207426_1053029 3300025302 Bacteria 1198
23 Ga0207647_10010998 3300025904 Bacteria 6366
24 Ga0207694_10110242 3300025924 Bacteria 2189
25 Ga0207694_10114383 3300025924 Bacteria 2149
26 Ga0207687_10062294 3300025927 Bacteria 2637
27 Ga0207661_10203922 3300025944 Bacteria 1740
28 Ga0207677_10189582 3300026023 Bacteria 1625
29 Ga0209813_10007800 3300027866 Bacteria 2679
30 Ga0307517_10024102 3300028786 Bacteria 7522
31 Ga0307517_10024558 3300028786 Bacteria 7417
32 Ga0307512_10018985 3300030522 Bacteria 6270
33 Ga0307513_10242141 3300031456 Bacteria 1607
34 Ga0307509_10161575 3300031507 Bacteria 2136
35 Ga0307508_10006583 3300031616 Bacteria 10909
36 Ga0307514_10007370 3300031649 Bacteria 9475
37 Ga0307514_10088378 3300031649 Bacteria 2268
38 Ga0307516_10006276 3300031730 Bacteria 13973
39 Ga0307516_10087808 3300031730 Bacteria 2943
40 Ga0307518_10086001 3300031838 Bacteria 2266
41 Ga0307518_10165767 3300031838 Bacteria 1512
42 Ga0307409_100087022 3300031995 Bacteria 2545
43 Ga0307409_100321203 3300031995 Bacteria 1449
44 Ga0307416_100114446 3300032002 Bacteria 2386
45 Ga0307414_10508947 3300032004 Bacteria 1067
46 Ga0307507_10022380 3300033179 Bacteria 6983
47 Ga0307510_10037031 3300033180 Bacteria 5421
48 Ga0307510_10213239 3300033180 Bacteria 1451
49 Ga0307510_10273041 3300033180 Bacteria 1165
50 Ga0395898_0009518 3300037466 Bacteria 10201
51 Ga0395898_0831772 3300037466 Bacteria 863
52 Ga0436364_0847955 3300037853 Bacteria 10877
53 Ga0395901_0015971 3300038443 Bacteria 7649
54 Ga0439436_0007185 3300041404 Bacteria 3426
55 Ga0439436_0050098 3300041404 Bacteria 1182
56 Ga0439439_0001029 3300041406 Bacteria 5255
57 Ga0439439_0001604 3300041406 Bacteria 4565
58 Ga0451837_0505358 3300041494 Bacteria 3542
59 Ga0451853_0139085 3300041512 Bacteria 4147
60 Ga0451853_1752034 3300041512 Bacteria 1812
61 Ga0451853_2163973 3300041512 Bacteria 2572
62 Ga0439433_0011224 3300041999 Bacteria 1961
63 Ga0439442_017819 3300042002 Bacteria 1466
64 Ga0439448_0003430 3300042005 Bacteria 4391
65 Ga0439449_0000447 3300042007 Bacteria 15359
66 Ga0439449_0026238 3300042007 Bacteria 2174
67 Ga0439455_0000400 3300042012 Bacteria 5740
68 Ga0439457_000407 3300042014 Bacteria 12286
69 Ga0439457_000984 3300042014 Bacteria 8566
70 Ga0439457_007438 3300042014 Bacteria 2627
71 Ga0450894_000626 3300042131 Bacteria 5942
72 Ga0450896_006025 3300042133 Bacteria 1658
73 Ga0450898_001412 3300042134 Bacteria 3158
74 Ga0450899_000281 3300042135 Bacteria 5527
75 Ga0450903_000188 3300042138 Bacteria 13674
76 Ga0450907_004260 3300042146 Bacteria 2471
77 Ga0450908_003756 3300042184 Bacteria 2941
78 Ga0466972_0003966 3300044658 Bacteria 7375
79 Ga0466972_0008316 3300044658 Bacteria 5201
80 Ga0466972_0186461 3300044658 Bacteria 972
81 Ga0466965_0009647 3300044683 Bacteria 4489
82 Ga0466966_0000993 3300044684 Bacteria 18195
83 Ga0466961_0002381 3300044693 Bacteria 11678
84 Ga0466961_0007163 3300044693 Bacteria 7095
85 Ga0466961_0034532 3300044693 Bacteria 3247
86 Ga0466963_0006200 3300044694 Bacteria 7062
87 Ga0466964_0249166 3300044706 Bacteria 875
88 Ga0466971_0013271 3300044719 Bacteria 3616
89 Ga0466971_0025531 3300044719 Bacteria 2638
90 Ga0466968_0003347 3300044735 Bacteria 5923
91 Ga0466970_0006945 3300044765 Bacteria 5668
92 Ga0466970_0074530 3300044765 Bacteria 1827
93 Ga0466957_0003558 3300044842 Bacteria 8582
94 Ga0466957_0084492 3300044842 Bacteria 1981
95 Ga0466959_0001670 3300045049 Bacteria 13743
96 Ga0466959_0043109 3300045049 Bacteria 3328
97 Ga0466958_0009229 3300045836 Bacteria 5489
98 Ga0466967_0032142 3300045976 Bacteria 4427
99 Ga0466967_0063181 3300045976 Bacteria 3289
100 Ga0495617_022895 3300046452 Bacteria 2111
101 Ga0495627_015751 3300046453 Bacteria 2605
102 Ga0495592_0016849 3300046454 Bacteria 5549
103 Ga0495592_0058970 3300046454 Bacteria 2829
104 Ga0495603_0003149 3300046455 Bacteria 9808
105 Ga0495603_0006806 3300046455 Bacteria 6856
106 Ga0495603_0013344 3300046455 Bacteria 4970
107 Ga0495603_0020595 3300046455 Bacteria 3995
108 Ga0495603_0040499 3300046455 Bacteria 2788
109 Ga0495629_0000765 3300046459 Bacteria 25909
110 Ga0495629_0003305 3300046459 Bacteria 12181
111 Ga0495629_0014715 3300046459 Bacteria 5628
112 Ga0495629_0038019 3300046459 Bacteria 3391
113 Ga0495629_0038602 3300046459 Bacteria 3363
114 Ga0495629_0095534 3300046459 Bacteria 2073
115 Ga0495629_0151881 3300046459 Bacteria 1609
116 Ga0495638_0195218 3300046460 Bacteria 1146
117 Ga0495651_0115090 3300046462 Bacteria 1983
118 Ga0495580_0153279 3300046472 Bacteria 1596
119 Ga0495582_0160411 3300046473 Bacteria 1278
120 Ga0495582_0321544 3300046473 Bacteria 890
121 Ga0495605_0004512 3300046474 Bacteria 8155
122 Ga0495605_0077280 3300046474 Bacteria 1562
123 Ga0495639_0009436 3300046475 Bacteria 4186
124 Ga0495662_0010324 3300046476 Bacteria 4576
125 Ga0495662_0011685 3300046476 Bacteria 4292
126 Ga0495664_0003874 3300046477 Bacteria 8163
127 Ga0495664_0091437 3300046477 Bacteria 1829
128 Ga0495594_0003436 3300046499 Bacteria 8176
129 Ga0495594_0019368 3300046499 Bacteria 3615
130 Ga0495596_0026048 3300046500 Bacteria 2359
131 Ga0495607_0090669 3300046501 Bacteria 1656
132 Ga0495583_0011011 3300046506 Bacteria 5216
133 Ga0495606_0012056 3300046507 Bacteria 6975
134 Ga0495616_0006581 3300046513 Bacteria 7020
135 Ga0495620_0006445 3300046515 Bacteria 6448
136 Ga0495620_0018593 3300046515 Bacteria 3438
137 Ga0495620_0096325 3300046515 Bacteria 1183
138 Ga0495628_0179601 3300046516 Bacteria 1601
139 Ga0495628_0419450 3300046516 Bacteria 975
140 Ga0495631_0017064 3300046518 Bacteria 3441
141 Ga0495637_0051458 3300046520 Bacteria 1724
142 Ga0495643_0002640 3300046522 Bacteria 13914
143 Ga0495643_0011586 3300046522 Bacteria 5361
144 Ga0495648_0015858 3300046524 Bacteria 5447
145 Ga0495648_0020066 3300046524 Bacteria 4675
146 Ga0495652_0052271 3300046529 Bacteria 3485
147 Ga0495654_0039589 3300046530 Bacteria 2352
148 Ga0495640_0007544 3300046533 Bacteria 8546
149 Ga0495640_0017819 3300046533 Bacteria 5283
150 Ga0495586_0051395 3300046535 Bacteria 2231
151 Ga0495587_0011380 3300046536 Bacteria 5639
152 Ga0495587_0075827 3300046536 Bacteria 1953
153 Ga0495645_0093752 3300046543 Bacteria 2142
154 Ga0495622_0011156 3300046557 Bacteria 4149
155 Ga0495622_0033176 3300046557 Bacteria 2410
156 Ga0495622_0150661 3300046557 Bacteria 1052
157 Ga0495633_0029784 3300046558 Bacteria 2654
158 Ga0495667_0090309 3300046559 Bacteria 1985
159 Ga0495668_0011353 3300046616 Bacteria 5339
160 Ga0495668_0028699 3300046616 Bacteria 3146
161 Ga0495634_0003293 3300046642 Bacteria 13023
162 Ga0495634_0118308 3300046642 Bacteria 1698
163 Ga0495611_0053482 3300046648 Bacteria 1822
164 Ga0495611_0082901 3300046648 Bacteria 1476
165 Ga0495625_0010681 3300046660 Bacteria 7566
166 Ga0495635_0017812 3300046663 Bacteria 4962
167 Ga0495635_0020335 3300046663 Bacteria 4624
168 Ga0495661_0079984 3300046665 Bacteria 1887
169 Ga0495661_0218315 3300046665 Bacteria 989
170 Ga0495588_0001776 3300046674 Bacteria 9184
171 Ga0495588_0014584 3300046674 Bacteria 3763
172 Ga0495657_0007690 3300046675 Bacteria 8297
173 Ga0495599_0043563 3300046678 Bacteria 2817
174 Ga0495599_0079674 3300046678 Bacteria 2045
175 Ga0495623_0007397 3300046679 Bacteria 7130
176 Ga0495646_0005855 3300046680 Bacteria 7796
177 Ga0495613_0002721 3300046689 Bacteria 13263
178 Ga0495613_0007698 3300046689 Bacteria 8012
179 Ga0495613_0018903 3300046689 Bacteria 5133
180 Ga0495613_0104394 3300046689 Bacteria 2046
181 Ga0495624_0102810 3300046690 Bacteria 1758
182 Ga0495670_0006432 3300046691 Bacteria 5769
183 Ga0495670_0021578 3300046691 Bacteria 3177
184 Ga0495671_0040231 3300046692 Bacteria 2358
185 Ga0495671_0046072 3300046692 Bacteria 2181
186 Ga0495649_0017018 3300046694 Bacteria 4113
187 Ga0495589_0007178 3300046794 Bacteria 5837
188 Ga0495589_0054159 3300046794 Bacteria 1978
189 Ga0495589_0135759 3300046794 Bacteria 1179
190 Ga0495589_0150746 3300046794 Bacteria 1110
191 Ga0495660_0006779 3300046810 Bacteria 6755
192 Ga0495660_0030512 3300046810 Bacteria 3036
193 Ga0495581_0082640 3300047315 Bacteria 1860
194 Ga0495581_0088152 3300047315 Bacteria 1799
195 Ga0495581_0154379 3300047315 Bacteria 1341
196 Ga0495604_0001475 3300047317 Bacteria 19376
197 Ga0495604_0107144 3300047317 Bacteria 2043
198 Ga0495604_0135233 3300047317 Bacteria 1767
199 Ga0495636_0003842 3300047318 Bacteria 5856
200 Ga0495636_0004020 3300047318 Bacteria 5748
201 Ga0495636_0011064 3300047318 Bacteria 3570
202 Ga0495636_0180613 3300047318 Bacteria 957
203 Ga0495674_0100813 3300047319 Bacteria 2457
204 Ga0495674_0330791 3300047319 Bacteria 1240
205 Ga0495672_0045618 3300047320 Bacteria 2621
206 Ga0495676_0004973 3300047321 Bacteria 12190
207 Ga0495676_0011881 3300047321 Bacteria 7855
208 Ga0495676_0015672 3300047321 Bacteria 6740
209 Ga0495676_0054109 3300047321 Bacteria 3192
210 Ga0495680_0010306 3300047322 Bacteria 8337
211 Ga0495683_0064297 3300047323 Bacteria 1811
212 Ga0495687_003978 3300047443 Bacteria 10308
213 Ga0495687_027795 3300047443 Bacteria 2642
214 Ga0495687_064978 3300047443 Bacteria 1487
215 Ga0495687_086751 3300047443 Bacteria 1209
216 Ga0495675_0026214 3300047444 Bacteria 3717
217 Ga0495677_0017250 3300047445 Bacteria 2618
218 Ga0495677_0078711 3300047445 Bacteria 1234
219 Ga0495679_017942 3300047446 Bacteria 2523
220 Ga0495679_084680 3300047446 Bacteria 896
221 Ga0495685_000621 3300047447 Bacteria 10839
222 Ga0495685_002257 3300047447 Bacteria 6007
223 Ga0495685_003184 3300047447 Bacteria 5212
224 Ga0495685_005438 3300047447 Bacteria 4160
225 Ga0495685_013205 3300047447 Bacteria 2802
226 Ga0495685_016663 3300047447 Bacteria 2512
227 Ga0495681_0001543 3300047470 Bacteria 17190
228 Ga0495681_0017233 3300047470 Bacteria 4020
229 Ga0495686_0018403 3300047472 Bacteria 4689
230 Ga0495686_0079180 3300047472 Bacteria 2010
231 Ga0495686_0091967 3300047472 Bacteria 1841
232 Ga0495593_0002888 3300047673 Bacteria 10358
233 Ga0495593_0037133 3300047673 Bacteria 2637
234 Ga0495593_0140352 3300047673 Bacteria 1224
235 Ga0495593_0165886 3300047673 Bacteria 1114
236 Ga0495602_0020104 3300048088 Bacteria 6604
237 Ga0495614_0000230 3300048089 Bacteria 21721
238 Ga0495614_0028832 3300048089 Bacteria 2389
239 Ga0495614_0032644 3300048089 Bacteria 2240
240 Ga0495626_0013113 3300048091 Bacteria 4317
241 Ga0495626_0079575 3300048091 Bacteria 1458
242 Ga0496101_0082453 3300048904 Bacteria 2380
243 Ga0496104_0113546 3300048907 Bacteria 2598
244 Ga0496108_0059981 3300048911 Bacteria 3200
245 Ga0496109_0028917 3300048912 Bacteria 4962
246 Ga0496110_0047967 3300048913 Bacteria 3742
247 Ga0496111_0062710 3300048914 Bacteria 2695
248 Ga0496113_0284120 3300048916 Bacteria 1323
249 Ga0496114_0173039 3300048917 Bacteria 1882
250 Ga0495678_045312 3300049459 Bacteria 1735
251 Ga0495682_0030583 3300049460 Bacteria 1992
252 Ga0501032_0115426 3300049569 Bacteria 1776
253 Ga0501033_0004555 3300049570 Bacteria 11096
254 Ga0501033_0005593 3300049570 Bacteria 9930
255 Ga0501033_0341087 3300049570 Bacteria 1050
256 Ga0501034_0002674 3300049571 Bacteria 21031
257 Ga0501034_0022322 3300049571 Bacteria 6451
258 Ga0501034_0314641 3300049571 Bacteria 1499
259 Ga0501036_0001835 3300049572 Bacteria 16492
260 Ga0501036_0011181 3300049572 Bacteria 7427
261 Ga0501036_0387000 3300049572 Bacteria 1167
262 Ga0501037_0041010 3300049573 Bacteria 3406
263 Ga0501038_0001097 3300049574 Bacteria 24498
264 Ga0501038_0068510 3300049574 Bacteria 3016
265 Ga0501039_0002635 3300049575 Bacteria 13398
266 Ga0501043_0036588 3300049579 Bacteria 3862
267 Ga0501043_0251402 3300049579 Bacteria 1361
268 Ga0501047_0021929 3300049581 Bacteria 6133
269 Ga0501047_0185405 3300049581 Bacteria 1946
270 Ga0501047_0190055 3300049581 Bacteria 1917
271 Ga0501068_0035562 3300049584 Bacteria 2974
272 Ga0501070_0069932 3300049586 Bacteria 2906
273 Ga0501070_0277162 3300049586 Bacteria 1369
274 Ga0501074_0005053 3300049590 Bacteria 9465
275 Ga0501080_0052862 3300049742 Bacteria 3781
276 Ga0501035_0007893 3300049822 Bacteria 9937
277 Ga0501035_0012083 3300049822 Bacteria 7983
278 Ga0501035_0015459 3300049822 Bacteria 7040
279 Ga0501035_0130123 3300049822 Bacteria 2195
280 Ga0501044_0029299 3300049823 Bacteria 5805
281 Ga0501044_0031288 3300049823 Bacteria 5602
282 Ga0501044_0160356 3300049823 Bacteria 2226
283 nmdc:mga06z11_5926_c1 3300050494 Bacteria 4937
284 nmdc:mga04h51_7787_c1 3300050495 Bacteria 2842
285 Ga0500578_0012474 3300053086 Bacteria 5483
286 Ga0500566_0065180 3300053094 Bacteria 2055
287 Ga0500654_017529 3300053099 Bacteria 4672
288 Ga0500660_036661 3300053100 Bacteria 2524
289 Ga0500553_102922 3300053101 Bacteria 1223
290 Ga0500621_023982 3300053126 Bacteria 2371
291 Ga0500652_000512 3300053131 Bacteria 13658
292 Ga0500658_0001785 3300053134 Bacteria 8489
293 Ga0500561_0000217 3300053137 Bacteria 10468
294 Ga0500600_0103511 3300053149 Bacteria 1497
295 Ga0500600_0158452 3300053149 Bacteria 1116
296 Ga0500616_0003853 3300053153 Bacteria 11076
297 Ga0500633_0000370 3300053160 Bacteria 6868
298 Ga0500634_0002137 3300053161 Bacteria 8191
299 Ga0500656_000562 3300053732 Bacteria 2822
300 Ga0466962_0002637 3300061719 Bacteria 8525
301 Ga0466962_0145968 3300061719 Bacteria 1147
302 2547407109 2547132111 Bacteria 8013147
303 2554258334 2554235005 Bacteria 6457341
304 2585299073 2582581312 Bacteria 7308206
305 2585309931 2582581313 Bacteria 10042643
306 2585315751 2582581314 Bacteria 11452267
307 2616697508 2616644814 Bacteria 11555299
308 2643765392 2643221548 Bacteria 8053412
309 2643898191 2643221578 Bacteria 9213798
310 2644264560 2643221647 Bacteria 10741251
311 2644409336 2643221673 Bacteria 9196637
312 2644462537 2643221682 Bacteria 6743283
313 2768641980 2767802112 Bacteria 6465194
314 2784588162 2784132148 Bacteria 8627943
315 2785343903 2784746763 Bacteria 9783172
316 2785368931 2784746768 Bacteria 10036182
317 2786670108 2786546132 Bacteria 10419719
318 2804847572 2802429296 Bacteria 7227771
319 2808920124 2808606375 Bacteria 9466072
320 2809231774 2808606448 Bacteria 8656184
321 2811848532 2808606982 Bacteria 7791042
322 2812358666 2811994879 Bacteria 9313447
323 2812480988 2811994917 Bacteria 7761064
324 2819693395 2818991463 Bacteria 7948711
325 2852642392 2852635781 Bacteria 8251373
326 2862293231 2862290372 Bacteria 7471434
327 2862390003 2862382967 Bacteria 10317375
328 2862515012 2862507626 Bacteria 9425308
329 2863405189 2863404153 Bacteria 9672205
330 2867371461 2867369537 Bacteria 6501581
331 2867431212 2867428634 Bacteria 9590268
332 2873156235 2873151551 Bacteria 8625867
333 2875394079 2875391855 Bacteria 7600475
334 2877681602 2877676314 Bacteria 9512378
335 2912720538 2912715099 Bacteria 9460473
336 2912724724 2912723979 Bacteria 8557534
337 2912760179 2912757875 Bacteria 7940295
338 2946050535 2946045630 Bacteria 8527308
339 2946067207 2946064051 Bacteria 8957905
340 2946075488 2946072368 Bacteria 8999607
341 2947230031 2947224130 Bacteria 9938529
342 2954386729 2954380949 Bacteria 10050426
343 2954676443 2954673503 Bacteria 9685905
344 2954687724 2954682443 Bacteria 9862841
345 2954697544 2954691527 Bacteria 10720516
346 2954716705 2954711539 Bacteria 10867210
347 2954726652 2954721474 Bacteria 10456478
348 2954735143 2954731030 Bacteria 10243860
349 2954745574 2954740390 Bacteria 10229294
350 2954754014 2954749733 Bacteria 10366972
351 2954764549 2954759201 Bacteria 9358192
352 2966603003 2966598605 Bacteria 7676064
353 2990048707 2990044586 Bacteria 6603797
354 2990062870 2990059506 Bacteria 9321252
355 2990094266 2990088156 Bacteria 6657676
356 3006396236 3006393351 Bacteria 6615579
357 3006496461 3006493962 Bacteria 8825450
358 8008559875 8008558824 Bacteria 10610750
359 8008579285 8008574985 Bacteria 7815457
360 8025417370 8025413630 Bacteria 7014048
361 8025533168 8025530807 Bacteria 8495698
362 8033690557 8033684223 Bacteria 6906479
363 8048132780 8048127548 Bacteria 11053136
364 8048413222 8048406513 Bacteria 8936924
365 8056450894 8056447290 Bacteria 7680491
366 8056668079 8056667051 Bacteria 6953971
367 8056830357 8056829672 Bacteria 9045328
368 Ga0495637_0020457
369 Ga0006562J51391_1043956
370 Ga0070683_100216706
371 Ga0068856_100550561
372 Ga0070702_100196594
373 Ga0068866_10153188
374 Ga0081455_10080729
375 Ga0075363_100004732
376 Ga0075363_100009251
377 Ga0075367_10010444
378 Ga0099826_10073568
379 Ga0105251_10003022
380 Ga0105243_10335859
381 Ga0105238_10151275
382 Ga0105238_10183307
383 Ga0157372_10064368
384 Ga0163163_10033828
385 Ga0182006_1017789
386 Ga0182007_10000849
387 Ga0183367_1006
388 Ga0209758_1009748
389 Ga0207426_1053029
390 Ga0207647_10010998
391 Ga0207694_10110242
392 Ga0207694_10114383
393 Ga0207687_10062294
394 Ga0207661_10203922
395 Ga0207677_10189582
396 Ga0209813_10007800
397 Ga0307517_10024102
398 Ga0307517_10024558
399 Ga0307512_10018985
400 Ga0307513_10242141
401 Ga0307509_10161575
402 Ga0307508_10006583
403 Ga0307514_10007370
404 Ga0307514_10088378
405 Ga0307516_10006276
406 Ga0307516_10087808
407 Ga0307518_10086001
408 Ga0307518_10165767
409 Ga0307409_100087022
410 Ga0307409_100321203
411 Ga0307416_100114446
412 Ga0307414_10508947
413 Ga0307507_10022380
414 Ga0307510_10037031
415 Ga0307510_10213239
416 Ga0307510_10273041
417 Ga0395898_0009518
418 Ga0395898_0831772
419 Ga0436364_0847955
420 Ga0395901_0015971
421 Ga0439436_0007185
422 Ga0439436_0050098
423 Ga0439439_0001029
424 Ga0439439_0001604
425 Ga0451837_0505358
426 Ga0451853_0139085
427 Ga0451853_1752034
428 Ga0451853_2163973
429 Ga0439433_0011224
430 Ga0439442_017819
431 Ga0439448_0003430
432 Ga0439449_0000447
433 Ga0439449_0026238
434 Ga0439455_0000400
435 Ga0439457_000407
436 Ga0439457_000984
437 Ga0439457_007438
438 Ga0450894_000626
439 Ga0450896_006025
440 Ga0450898_001412
441 Ga0450899_000281
442 Ga0450903_000188
443 Ga0450907_004260
444 Ga0450908_003756
445 Ga0466972_0003966
446 Ga0466972_0008316
447 Ga0466972_0186461
448 Ga0466965_0009647
449 Ga0466966_0000993
450 Ga0466961_0002381
451 Ga0466961_0007163
452 Ga0466961_0034532
453 Ga0466963_0006200
454 Ga0466964_0249166
455 Ga0466971_0013271
456 Ga0466971_0025531
457 Ga0466968_0003347
458 Ga0466970_0006945
459 Ga0466970_0074530
460 Ga0466957_0003558
461 Ga0466957_0084492
462 Ga0466959_0001670
463 Ga0466959_0043109
464 Ga0466958_0009229
465 Ga0466967_0032142
466 Ga0466967_0063181
467 Ga0495617_022895
468 Ga0495627_015751
469 Ga0495592_0016849
470 Ga0495592_0058970
471 Ga0495603_0003149
472 Ga0495603_0006806
473 Ga0495603_0013344
474 Ga0495603_0020595
475 Ga0495603_0040499
476 Ga0495629_0000765
477 Ga0495629_0003305
478 Ga0495629_0014715
479 Ga0495629_0038019
480 Ga0495629_0038602
481 Ga0495629_0095534
482 Ga0495629_0151881
483 Ga0495638_0195218
484 Ga0495651_0115090
485 Ga0495580_0153279
486 Ga0495582_0160411
487 Ga0495582_0321544
488 Ga0495605_0004512
489 Ga0495605_0077280
490 Ga0495639_0009436
491 Ga0495662_0010324
492 Ga0495662_0011685
493 Ga0495664_0003874
494 Ga0495664_0091437
495 Ga0495594_0003436
496 Ga0495594_0019368
497 Ga0495596_0026048
498 Ga0495607_0090669
499 Ga0495583_0011011
500 Ga0495606_0012056
501 Ga0495616_0006581
502 Ga0495620_0006445
503 Ga0495620_0018593
504 Ga0495620_0096325
505 Ga0495628_0179601
506 Ga0495628_0419450
507 Ga0495631_0017064
508 Ga0495637_0051458
509 Ga0495643_0002640
510 Ga0495643_0011586
511 Ga0495648_0015858
512 Ga0495648_0020066
513 Ga0495652_0052271
514 Ga0495654_0039589
515 Ga0495640_0007544
516 Ga0495640_0017819
517 Ga0495586_0051395
518 Ga0495587_0011380
519 Ga0495587_0075827
520 Ga0495645_0093752
521 Ga0495622_0011156
522 Ga0495622_0033176
523 Ga0495622_0150661
524 Ga0495633_0029784
525 Ga0495667_0090309
526 Ga0495668_0011353
527 Ga0495668_0028699
528 Ga0495634_0003293
529 Ga0495634_0118308
530 Ga0495611_0053482
531 Ga0495611_0082901
532 Ga0495625_0010681
533 Ga0495635_0017812
534 Ga0495635_0020335
535 Ga0495661_0079984
536 Ga0495661_0218315
537 Ga0495588_0001776
538 Ga0495588_0014584
539 Ga0495657_0007690
540 Ga0495599_0043563
541 Ga0495599_0079674
542 Ga0495623_0007397
543 Ga0495646_0005855
544 Ga0495613_0002721
545 Ga0495613_0007698
546 Ga0495613_0018903
547 Ga0495613_0104394
548 Ga0495624_0102810
549 Ga0495670_0006432
550 Ga0495670_0021578
551 Ga0495671_0040231
552 Ga0495671_0046072
553 Ga0495649_0017018
554 Ga0495589_0007178
555 Ga0495589_0054159
556 Ga0495589_0135759
557 Ga0495589_0150746
558 Ga0495660_0006779
559 Ga0495660_0030512
560 Ga0495581_0082640
561 Ga0495581_0088152
562 Ga0495581_0154379
563 Ga0495604_0001475
564 Ga0495604_0107144
565 Ga0495604_0135233
566 Ga0495636_0003842
567 Ga0495636_0004020
568 Ga0495636_0011064
569 Ga0495636_0180613
570 Ga0495674_0100813
571 Ga0495674_0330791
572 Ga0495672_0045618
573 Ga0495676_0004973
574 Ga0495676_0011881
575 Ga0495676_0015672
576 Ga0495676_0054109
577 Ga0495680_0010306
578 Ga0495683_0064297
579 Ga0495687_003978
580 Ga0495687_027795
581 Ga0495687_064978
582 Ga0495687_086751
583 Ga0495675_0026214
584 Ga0495677_0017250
585 Ga0495677_0078711
586 Ga0495679_017942
587 Ga0495679_084680
588 Ga0495685_000621
589 Ga0495685_002257
590 Ga0495685_003184
591 Ga0495685_005438
592 Ga0495685_013205
593 Ga0495685_016663
594 Ga0495681_0001543
595 Ga0495681_0017233
596 Ga0495686_0018403
597 Ga0495686_0079180
598 Ga0495686_0091967
599 Ga0495593_0002888
600 Ga0495593_0037133
601 Ga0495593_0140352
602 Ga0495593_0165886
603 Ga0495602_0020104
604 Ga0495614_0000230
605 Ga0495614_0028832
606 Ga0495614_0032644
607 Ga0495626_0013113
608 Ga0495626_0079575
609 Ga0496101_0082453
610 Ga0496104_0113546
611 Ga0496108_0059981
612 Ga0496109_0028917
613 Ga0496110_0047967
614 Ga0496111_0062710
615 Ga0496113_0284120
616 Ga0496114_0173039
617 Ga0495678_045312
618 Ga0495682_0030583
619 Ga0501032_0115426
620 Ga0501033_0004555
621 Ga0501033_0005593
622 Ga0501033_0341087
623 Ga0501034_0002674
624 Ga0501034_0022322
625 Ga0501034_0314641
626 Ga0501036_0001835
627 Ga0501036_0011181
628 Ga0501036_0387000
629 Ga0501037_0041010
630 Ga0501038_0001097
631 Ga0501038_0068510
632 Ga0501039_0002635
633 Ga0501043_0036588
634 Ga0501043_0251402
635 Ga0501047_0021929
636 Ga0501047_0185405
637 Ga0501047_0190055
638 Ga0501068_0035562
639 Ga0501070_0069932
640 Ga0501070_0277162
641 Ga0501074_0005053
642 Ga0501080_0052862
643 Ga0501035_0007893
644 Ga0501035_0012083
645 Ga0501035_0015459
646 Ga0501035_0130123
647 Ga0501044_0029299
648 Ga0501044_0031288
649 Ga0501044_0160356
650 nmdc:mga06z11_5926_c1
651 nmdc:mga04h51_7787_c1
652 Ga0500578_0012474
653 Ga0500566_0065180
654 Ga0500654_017529
655 Ga0500660_036661
656 Ga0500553_102922
657 Ga0500621_023982
658 Ga0500652_000512
659 Ga0500658_0001785
660 Ga0500561_0000217
661 Ga0500600_0103511
662 Ga0500600_0158452
663 Ga0500616_0003853
664 Ga0500633_0000370
665 Ga0500634_0002137
666 Ga0500656_000562
667 Ga0466962_0002637
668 Ga0466962_0145968
669 2547407109
670 2554258334
671 2585299073
672 2585309931
673 2585315751
674 2616697508
675 2643765392
676 2643898191
677 2644264560
678 2644409336
679 2644462537
680 2768641980
681 2784588162
682 2785343903
683 2785368931
684 2786670108
685 2804847572
686 2808920124
687 2809231774
688 2811848532
689 2812358666
690 2812480988
691 2819693395
692 2852642392
693 2862293231
694 2862390003
695 2862515012
696 2863405189
697 2867371461
698 2867431212
699 2873156235
700 2875394079
701 2877681602
702 2912720538
703 2912724724
704 2912760179
705 2946050535
706 2946067207
707 2946075488
708 2947230031
709 2954386729
710 2954676443
711 2954687724
712 2954697544
713 2954716705
714 2954726652
715 2954735143
716 2954745574
717 2954754014
718 2954764549
719 2966603003
720 2990048707
721 2990062870
722 2990094266
723 3006396236
724 3006496461
725 8008559875
726 8008579285
727 8025417370
728 8025533168
729 8033690557
730 8048132780
731 8048413222
732 8056450894
733 8056668079
734 8056830357

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06182

ABC2_membrane_6

ABC-2 family transporter protein

73

305

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
6oih-assembly1.cif.gz_D crystal structure of o-antigen polysaccharide abc-transporter 0.5418 42 262
8bht-assembly1.cif.gz_A abcg2 turnover-1 state with tariquidar bound 0.5217 59 263
7nez-assembly1.cif.gz_B structure of topotecan-bound abcg2 0.5106 59 259
6eti-assembly1.cif.gz_A structure of inhibitor-bound abcg2 0.5088 59 263
5njg-assembly1.cif.gz_B structure of an abc transporter: part of the structure that could be built de novo 0.5071 56 259
ID Description Score Start End Superfamily
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.548 59 254 3.40.1710.10
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.5103 60 257 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.4942 60 254 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.4207 59 254 3.40.1710.10
af_Q5A5P7_5_125_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.4065 63 215 1.10.3730.20
ID Description Score Start End GO Terms
AF-A0A6B2XRW5-F1-model_v4 Transporter 0.84 56 194 GO:0016020
AF-A0A6B2XRW5-F1-model_v4 Transporter 0.8343 56 194 GO:0016020
AF-A0A6G2UK04-F1-model_v4 Transporter 0.8081 40 267 GO:0016020
AF-A0A6G2UK04-F1-model_v4 Transporter 0.8048 40 267 GO:0016020
AF-A0A5Q0HBR3-F1-model_v4 ABC transporter permease 0.8023 60 267 GO:0016020

Map