F424414

General Info

Members Datasets Scaffolds Average Seq Length
367 220 734 367

Family's Representative Sequence

Representative Sequence 3300037068|Ga0373925_0000010|Ga0373925_0000010_113006_114481
Length 428
Sequence MRVVLAGGGSAGHIEPALALADALREADSSIQVTCLGTQRGLETRLVPLRGYDLELIPAVPLPRSVTPKLLAVPGRLAGAVHATGKILDRVRADVLVGFGGYVATPAYLAAKRHNVPIVVHEANPFAGIANRLGAHLTTYVFTGQPETKLRNSRYLGLPIRRQIADLDRFALGDKARAHFGLRPDLPVLLVFGGSQGAKSLNRALAGAAGAIRSAGVQILHVTGPKNLGESQQADGTLSPGPGLASTASNAVPYVALPYVDRMDLAYAAADFALCRAGAMTCAELTAVGLPAAYVPLPIGNGEQRLNALPIVQHGGGLLVEDAELTADWIKNALLPVLTNIDQVAGMSEAAAAMGRKDADRWLAKAVIEIVAQPGSLFTPHGTRQQPXXXATPRTPRGMSDGGASVSGRPKPPGGQPASGGGRHRHAR

Samples

Sample ID Description Type Environment
1 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
67 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
109 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
110 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
111 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
112 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
113 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
114 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
115 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
116 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
117 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
118 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
119 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
120 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
121 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
122 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
123 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
124 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
125 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
126 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
127 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
128 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
129 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
130 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
131 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
132 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
133 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
134 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
135 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
136 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
137 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
138 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
139 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
140 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
141 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
142 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
143 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
144 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
145 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
146 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
147 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
148 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
149 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
150 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
151 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
152 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
153 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
154 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
155 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
156 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
157 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
158 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
159 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
160 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
161 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
162 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
163 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
164 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
165 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
166 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
167 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
168 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
169 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
170 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
171 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
172 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
173 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
174 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
175 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
176 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
177 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
178 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
179 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
180 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
181 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
182 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
183 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
184 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
185 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
186 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
187 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
188 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
189 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
190 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
191 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
192 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
193 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
194 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
195 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
196 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
200 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
201 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
202 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
203 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
204 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
205 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
206 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
207 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
208 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
209 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
211 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
212 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
213 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
214 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
215 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
216 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
217 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
218 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
219 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
220 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.91
Metatranscriptomes 0.54
Isolates 0.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.54
Rhizosphere 85.56
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373925_0000010 3300037068 Bacteria 229059
2 Ga0070658_10036446 3300005327 Bacteria 3965
3 Ga0070658_10297895 3300005327 Bacteria 1375
4 Ga0070683_100004764 3300005329 Bacteria 11227
5 Ga0070683_100090993 3300005329 Bacteria 2865
6 Ga0070683_100229355 3300005329 Bacteria 1765
7 Ga0070682_100015304 3300005337 Bacteria 4442
8 Ga0068868_100029631 3300005338 Bacteria 4192
9 Ga0070660_100130981 3300005339 Bacteria 2007
10 Ga0070687_100011698 3300005343 Bacteria 3850
11 Ga0070661_100172028 3300005344 Bacteria 1645
12 Ga0070692_10000448 3300005345 Bacteria 12552
13 Ga0070692_10019535 3300005345 Bacteria 3271
14 Ga0070675_100047461 3300005354 Bacteria 3519
15 Ga0070688_100111597 3300005365 Bacteria 1819
16 Ga0070659_100053561 3300005366 Bacteria 3176
17 Ga0070667_100106837 3300005367 Bacteria 2423
18 Ga0070709_10002663 3300005434 Bacteria 9640
19 Ga0070709_10020563 3300005434 Bacteria 3831
20 Ga0070714_100000290 3300005435 Bacteria 38379
21 Ga0070714_100004099 3300005435 Bacteria 10957
22 Ga0070714_100143504 3300005435 Bacteria 2145
23 Ga0070714_100233169 3300005435 Bacteria 1696
24 Ga0070713_100006088 3300005436 Bacteria 8318
25 Ga0070713_100057305 3300005436 Bacteria 3243
26 Ga0070701_10002899 3300005438 Bacteria 6681
27 Ga0070711_100030181 3300005439 Bacteria 3586
28 Ga0070700_100005193 3300005441 Bacteria 6882
29 Ga0070708_100077476 3300005445 Bacteria 3004
30 Ga0070708_100249251 3300005445 Bacteria 1668
31 Ga0070681_10096427 3300005458 Bacteria 2905
32 Ga0068867_100011402 3300005459 Bacteria 6271
33 Ga0070685_10029212 3300005466 Bacteria 3061
34 Ga0070706_100001516 3300005467 Bacteria 24353
35 Ga0070706_100003733 3300005467 Bacteria 14884
36 Ga0070706_100023521 3300005467 Bacteria 5675
37 Ga0070706_100046169 3300005467 Bacteria 4021
38 Ga0070706_100070777 3300005467 Bacteria 3226
39 Ga0070706_100076210 3300005467 Bacteria 3104
40 Ga0070707_100000199 3300005468 Bacteria 60047
41 Ga0070707_100003290 3300005468 Bacteria 15267
42 Ga0070707_100009855 3300005468 Bacteria 8891
43 Ga0070707_100052893 3300005468 Bacteria 3893
44 Ga0070707_100156741 3300005468 Bacteria 2218
45 Ga0070698_100000192 3300005471 Bacteria 58336
46 Ga0070698_100000264 3300005471 Bacteria 52985
47 Ga0070698_100000354 3300005471 Bacteria 47476
48 Ga0070699_100206801 3300005518 Bacteria 1746
49 Ga0070679_100004884 3300005530 Bacteria 12366
50 Ga0070679_100379602 3300005530 Bacteria 1360
51 Ga0070684_100050002 3300005535 Bacteria 3629
52 Ga0070684_100067428 3300005535 Bacteria 3143
53 Ga0068853_100363242 3300005539 Bacteria 1349
54 Ga0070665_100024999 3300005548 Bacteria 6021
55 Ga0070665_100156120 3300005548 Bacteria 2284
56 Ga0068855_100323879 3300005563 Bacteria 1703
57 Ga0070664_100034626 3300005564 Bacteria 4236
58 Ga0068857_100116805 3300005577 Bacteria 2400
59 Ga0068852_100004600 3300005616 Bacteria 9770
60 Ga0068864_100026808 3300005618 Bacteria 4860
61 Ga0068866_10006879 3300005718 Bacteria 4751
62 Ga0068861_100023085 3300005719 Bacteria 4485
63 Ga0068870_10006944 3300005840 Bacteria 5021
64 Ga0068862_100096750 3300005844 Bacteria 2577
65 Ga0081540_1000601 3300005983 Bacteria 34296
66 Ga0070717_10021614 3300006028 Bacteria 5073
67 Ga0070717_10127422 3300006028 Bacteria 2186
68 Ga0070717_10228421 3300006028 Bacteria 1638
69 Ga0070715_10019336 3300006163 Bacteria 2611
70 Ga0070715_10024815 3300006163 Bacteria 2367
71 Ga0070716_100007162 3300006173 Bacteria 5482
72 Ga0070712_100075112 3300006175 Bacteria 2430
73 Ga0068865_100003974 3300006881 Bacteria 8873
74 Ga0068865_100007160 3300006881 Bacteria 6850
75 Ga0075436_100006214 3300006914 Bacteria 8192
76 Ga0099795_10041036 3300007788 Bacteria 1647
77 Ga0105245_10028119 3300009098 Bacteria 4956
78 Ga0105243_10007974 3300009148 Bacteria 8135
79 Ga0105242_10162873 3300009176 Bacteria 1954
80 Ga0105248_10141218 3300009177 Bacteria 2717
81 Ga0105248_10193342 3300009177 Bacteria 2293
82 Ga0105238_10294073 3300009551 Bacteria 1607
83 Ga0105249_10035645 3300009553 Bacteria 4511
84 Ga0105249_10089357 3300009553 Bacteria 2879
85 Ga0105249_10157523 3300009553 Bacteria 2191
86 Ga0099796_10008876 3300010159 Bacteria 2697
87 Ga0105239_10012763 3300010375 Bacteria 9346
88 Ga0105239_10021779 3300010375 Bacteria 7065
89 Ga0157370_10087380 3300013104 Bacteria 2928
90 Ga0157369_10040332 3300013105 Bacteria 5096
91 Ga0157369_10093396 3300013105 Bacteria 3211
92 Ga0157369_10167212 3300013105 Bacteria 2319
93 Ga0163162_10028201 3300013306 Bacteria 5553
94 Ga0157372_10001787 3300013307 Bacteria 23352
95 Ga0157375_10087512 3300013308 Bacteria 3168
96 Ga0163163_10131670 3300014325 Bacteria 2541
97 Ga0157380_10020268 3300014326 Bacteria 4970
98 Ga0157377_10009627 3300014745 Bacteria 4752
99 Ga0157377_10100633 3300014745 Bacteria 1722
100 Ga0157376_10190884 3300014969 Bacteria 1878
101 Ga0213875_10000582 3300021388 Bacteria 29614
102 Ga0213875_10001776 3300021388 Bacteria 13496
103 Ga0213875_10002331 3300021388 Bacteria 11484
104 Ga0213875_10012810 3300021388 Bacteria 4131
105 Ga0213875_10074169 3300021388 Bacteria 1588
106 Ga0224712_10007224 3300022467 Bacteria 3221
107 Ga0224712_10020580 3300022467 Bacteria 2243
108 Ga0207692_10158374 3300025898 Bacteria 1303
109 Ga0207642_10007355 3300025899 Bacteria 3714
110 Ga0207688_10002364 3300025901 Bacteria 10151
111 Ga0207699_10001461 3300025906 Bacteria 11224
112 Ga0207699_10044978 3300025906 Bacteria 2574
113 Ga0207699_10095380 3300025906 Bacteria 1876
114 Ga0207705_10005558 3300025909 Bacteria 9420
115 Ga0207684_10001458 3300025910 Bacteria 25491
116 Ga0207684_10005062 3300025910 Bacteria 12284
117 Ga0207684_10108928 3300025910 Bacteria 2371
118 Ga0207693_10025059 3300025915 Bacteria 4731
119 Ga0207693_10085460 3300025915 Bacteria 2471
120 Ga0207663_10034607 3300025916 Bacteria 3023
121 Ga0207660_10037846 3300025917 Bacteria 3365
122 Ga0207662_10016440 3300025918 Bacteria 4176
123 Ga0207657_10061503 3300025919 Bacteria 3219
124 Ga0207649_10102325 3300025920 Bacteria 1898
125 Ga0207652_10015414 3300025921 Bacteria 6209
126 Ga0207646_10000278 3300025922 Bacteria 70066
127 Ga0207646_10009763 3300025922 Bacteria 9455
128 Ga0207646_10045705 3300025922 Bacteria 3930
129 Ga0207659_10151114 3300025926 Bacteria 1813
130 Ga0207687_10057302 3300025927 Bacteria 2737
131 Ga0207700_10004742 3300025928 Bacteria 8066
132 Ga0207700_10009747 3300025928 Bacteria 6021
133 Ga0207700_10017587 3300025928 Bacteria 4781
134 Ga0207700_10028895 3300025928 Bacteria 3907
135 Ga0207700_10064406 3300025928 Bacteria 2792
136 Ga0207700_10253208 3300025928 Bacteria 1505
137 Ga0207664_10017288 3300025929 Bacteria 5283
138 Ga0207664_10017911 3300025929 Bacteria 5204
139 Ga0207690_10036940 3300025932 Bacteria 3167
140 Ga0207706_10354230 3300025933 Bacteria 1276
141 Ga0207704_10011456 3300025938 Bacteria 4365
142 Ga0207704_10030441 3300025938 Bacteria 3026
143 Ga0207665_10003669 3300025939 Bacteria 10253
144 Ga0207665_10005968 3300025939 Bacteria 8101
145 Ga0207665_10162456 3300025939 Bacteria 1607
146 Ga0207691_10002443 3300025940 Bacteria 18168
147 Ga0207661_10012377 3300025944 Bacteria 6197
148 Ga0207661_10087074 3300025944 Bacteria 2593
149 Ga0207661_10208156 3300025944 Bacteria 1723
150 Ga0207679_10158009 3300025945 Bacteria 1853
151 Ga0207679_10229579 3300025945 Bacteria 1566
152 Ga0207712_10212988 3300025961 Bacteria 1540
153 Ga0207640_10030111 3300025981 Bacteria 3339
154 Ga0207677_10033359 3300026023 Bacteria 3321
155 Ga0207703_10261038 3300026035 Bacteria 1566
156 Ga0207639_10188027 3300026041 Bacteria 1762
157 Ga0207678_10025077 3300026067 Bacteria 5207
158 Ga0207678_10058810 3300026067 Bacteria 3307
159 Ga0207678_10081930 3300026067 Bacteria 2761
160 Ga0207678_10121710 3300026067 Bacteria 2227
161 Ga0207708_10000642 3300026075 Bacteria 26799
162 Ga0207648_10016322 3300026089 Bacteria 6789
163 Ga0207676_10078015 3300026095 Bacteria 2681
164 Ga0207674_10015093 3300026116 Bacteria 8502
165 Ga0207674_10068887 3300026116 Bacteria 3559
166 Ga0207675_100001682 3300026118 Bacteria 22122
167 Ga0207683_10051353 3300026121 Bacteria 3612
168 Ga0207428_10175311 3300027907 Bacteria 1622
169 Ga0268266_10001087 3300028379 Bacteria 34089
170 Ga0268265_10070405 3300028380 Bacteria 2720
171 Ga0265337_1000181 3300028556 Bacteria 33204
172 Ga0265326_10000982 3300028558 Bacteria 10287
173 Ga0265319_1000235 3300028563 Bacteria 41448
174 Ga0265334_10000367 3300028573 Bacteria 24159
175 Ga0265323_10009842 3300028653 Bacteria 3889
176 Ga0265336_10001654 3300028666 Bacteria 9860
177 Ga0307515_10033425 3300028794 Bacteria 8468
178 Ga0265338_10005351 3300028800 Bacteria 16785
179 Ga0265338_10008811 3300028800 Bacteria 12175
180 Ga0265338_10009528 3300028800 Bacteria 11562
181 Ga0265324_10000535 3300029957 Bacteria 26053
182 Ga0265332_10000225 3300031238 Bacteria 45458
183 Ga0265325_10035396 3300031241 Bacteria 2652
184 Ga0265340_10021866 3300031247 Bacteria 3275
185 Ga0265339_10017002 3300031249 Bacteria 4317
186 Ga0265316_10077705 3300031344 Bacteria 2548
187 Ga0265313_10012432 3300031595 Bacteria 5197
188 Ga0265314_10001593 3300031711 Bacteria 24946
189 Ga0265342_10026443 3300031712 Bacteria 3636
190 Ga0316214_1001901 3300033545 Bacteria 2516
191 Ga0373926_0006383 3300035083 Bacteria 3917
192 Ga0373934_0005298 3300035086 Bacteria 4771
193 Ga0373923_0035438 3300035111 Bacteria 2031
194 Ga0373936_0000417 3300035113 Bacteria 14325
195 Ga0373945_0000067 3300035116 Bacteria 23561
196 Ga0373954_0036787 3300035118 Bacteria 2273
197 Ga0373956_0002865 3300035119 Bacteria 6984
198 Ga0373956_0023741 3300035119 Bacteria 2634
199 Ga0373957_0003214 3300035120 Bacteria 4799
200 Ga0373943_0000965 3300035170 Bacteria 12772
201 Ga0373946_0001423 3300035171 Bacteria 8308
202 Ga0373955_0007934 3300035172 Bacteria 4903
203 Ga0373955_0017519 3300035172 Bacteria 3547
204 Ga0373924_0050446 3300035410 Bacteria 1723
205 Ga0373935_0008867 3300035692 Bacteria 6019
206 Ga0373935_0032926 3300035692 Bacteria 3223
207 Ga0373935_0126416 3300035692 Bacteria 1713
208 Ga0373927_0005245 3300035695 Bacteria 8962
209 Ga0373933_0027727 3300035724 Bacteria 3264
210 Ga0373947_0046933 3300035725 Bacteria 2587
211 Ga0395898_0044178 3300037466 Bacteria 4389
212 Ga0436364_0117460 3300037853 Bacteria 1318
213 Ga0436364_0332089 3300037853 Bacteria 5316
214 Ga0436364_0377556 3300037853 Bacteria 1358
215 Ga0436364_0640945 3300037853 Bacteria 3000
216 Ga0436364_0805657 3300037853 Bacteria 63201
217 Ga0436364_1314906 3300037853 Bacteria 24323
218 Ga0436364_1379051 3300037853 Bacteria 11374
219 Ga0466969_0034433 3300044656 Bacteria 2566
220 Ga0466965_0006911 3300044683 Bacteria 5192
221 Ga0466966_0024045 3300044684 Bacteria 3988
222 Ga0466963_0053400 3300044694 Bacteria 2683
223 Ga0466963_0167437 3300044694 Bacteria 1531
224 Ga0466963_0182374 3300044694 Bacteria 1466
225 Ga0466964_0018982 3300044706 Bacteria 2642
226 Ga0466970_0008721 3300044765 Bacteria 5107
227 Ga0466970_0010016 3300044765 Bacteria 4801
228 Ga0466967_0001494 3300045976 Bacteria 13648
229 Ga0466967_0019587 3300045976 Bacteria 5446
230 Ga0466967_0036367 3300045976 Bacteria 4203
231 Ga0466967_0047124 3300045976 Bacteria 3756
232 Ga0466967_0054681 3300045976 Bacteria 3515
233 Ga0466967_0173364 3300045976 Bacteria 2031
234 Ga0466967_0367045 3300045976 Bacteria 1396
235 Ga0495592_0049486 3300046454 Bacteria 3124
236 Ga0495592_0163554 3300046454 Bacteria 1529
237 Ga0495651_0061517 3300046462 Bacteria 2873
238 Ga0495651_0062904 3300046462 Bacteria 2838
239 Ga0495653_0007748 3300046463 Bacteria 8788
240 Ga0495653_0028350 3300046463 Bacteria 4476
241 Ga0495662_0050169 3300046476 Bacteria 2014
242 Ga0495664_0005310 3300046477 Bacteria 7065
243 Ga0495608_0019383 3300046511 Bacteria 4681
244 Ga0495608_0020784 3300046511 Bacteria 4510
245 Ga0495608_0049475 3300046511 Bacteria 2790
246 Ga0495618_0022653 3300046514 Bacteria 3880
247 Ga0495618_0098026 3300046514 Bacteria 1875
248 Ga0495628_0045625 3300046516 Bacteria 3483
249 Ga0495628_0085044 3300046516 Bacteria 2454
250 Ga0495630_0059264 3300046517 Bacteria 2872
251 Ga0495630_0170823 3300046517 Bacteria 1656
252 Ga0495652_0014529 3300046529 Bacteria 7065
253 Ga0495652_0024501 3300046529 Bacteria 5342
254 Ga0495652_0183278 3300046529 Bacteria 1604
255 Ga0495665_0026490 3300046531 Bacteria 3113
256 Ga0495640_0128150 3300046533 Bacteria 1644
257 Ga0495587_0017475 3300046536 Bacteria 4455
258 Ga0495645_0031948 3300046543 Bacteria 3838
259 Ga0495667_0001523 3300046559 Bacteria 15323
260 Ga0495667_0051134 3300046559 Bacteria 2726
261 Ga0495667_0116669 3300046559 Bacteria 1724
262 Ga0495634_0007848 3300046642 Bacteria 7974
263 Ga0495634_0010255 3300046642 Bacteria 6864
264 Ga0495635_0008472 3300046663 Bacteria 7181
265 Ga0495657_0027821 3300046675 Bacteria 3984
266 Ga0495657_0123388 3300046675 Bacteria 1629
267 Ga0495599_0017645 3300046678 Bacteria 4438
268 Ga0495599_0036102 3300046678 Bacteria 3103
269 Ga0495623_0147732 3300046679 Bacteria 1392
270 Ga0495646_0106345 3300046680 Bacteria 1602
271 Ga0495613_0066732 3300046689 Bacteria 2627
272 Ga0495624_0012702 3300046690 Bacteria 5750
273 Ga0495600_0011479 3300046809 Bacteria 5521
274 Ga0495581_0045691 3300047315 Bacteria 2531
275 Ga0495604_0008857 3300047317 Bacteria 7953
276 Ga0495674_0000849 3300047319 Bacteria 29202
277 Ga0495674_0023463 3300047319 Bacteria 5684
278 Ga0495674_0220589 3300047319 Bacteria 1567
279 Ga0495676_0009129 3300047321 Bacteria 9043
280 Ga0495680_0030802 3300047322 Bacteria 4374
281 Ga0495680_0033675 3300047322 Bacteria 4145
282 Ga0495680_0070829 3300047322 Bacteria 2656
283 Ga0495684_0002340 3300047471 Bacteria 15142
284 Ga0495684_0007390 3300047471 Bacteria 8515
285 Ga0495684_0092300 3300047471 Bacteria 2293
286 Ga0495684_0247323 3300047471 Bacteria 1298
287 Ga0495602_0048167 3300048088 Bacteria 3834
288 Ga0495602_0054002 3300048088 Bacteria 3551
289 Ga0495602_0066674 3300048088 Bacteria 3100
290 Ga0496101_0014848 3300048904 Bacteria 5241
291 Ga0496101_0018429 3300048904 Bacteria 4747
292 Ga0496101_0063507 3300048904 Bacteria 2688
293 Ga0496102_0003823 3300048905 Bacteria 12734
294 Ga0496102_0041863 3300048905 Bacteria 4149
295 Ga0496102_0085632 3300048905 Bacteria 2910
296 Ga0496102_0434896 3300048905 Bacteria 1232
297 Ga0496102_0448066 3300048905 Bacteria 1211
298 Ga0496103_0023520 3300048906 Bacteria 3716
299 Ga0496104_0074037 3300048907 Bacteria 3241
300 Ga0496105_0000874 3300048908 Bacteria 20619
301 Ga0496106_0186857 3300048909 Bacteria 1646
302 Ga0496106_0207932 3300048909 Bacteria 1558
303 Ga0496107_0032809 3300048910 Bacteria 3712
304 Ga0496107_0036633 3300048910 Bacteria 3518
305 Ga0496107_0214168 3300048910 Bacteria 1433
306 Ga0496108_0024635 3300048911 Bacteria 4956
307 Ga0496108_0060600 3300048911 Bacteria 3184
308 Ga0496109_0006806 3300048912 Bacteria 9634
309 Ga0496109_0023899 3300048912 Bacteria 5427
310 Ga0496109_0037601 3300048912 Bacteria 4373
311 Ga0496109_0043877 3300048912 Bacteria 4054
312 Ga0496109_0090227 3300048912 Bacteria 2834
313 Ga0496109_0105667 3300048912 Bacteria 2615
314 Ga0496111_0014507 3300048914 Bacteria 5385
315 Ga0496113_0086696 3300048916 Bacteria 2406
316 Ga0496113_0132777 3300048916 Bacteria 1955
317 Ga0496114_0006707 3300048917 Bacteria 9071
318 Ga0496114_0062235 3300048917 Bacteria 3123
319 Ga0496114_0134334 3300048917 Bacteria 2138
320 Ga0496114_0268866 3300048917 Bacteria 1502
321 Ga0496115_0043545 3300048918 Bacteria 3580
322 Ga0496115_0059721 3300048918 Bacteria 3071
323 Ga0496115_0132109 3300048918 Bacteria 2058
324 Ga0496115_0169516 3300048918 Bacteria 1805
325 Ga0496119_0042271 3300048922 Bacteria 2892
326 Ga0496119_0140769 3300048922 Bacteria 1303
327 Ga0501031_0008048 3300049568 Bacteria 6866
328 Ga0501034_0166701 3300049571 Bacteria 2171
329 Ga0501034_0335353 3300049571 Bacteria 1443
330 Ga0501047_0037848 3300049581 Bacteria 4666
331 Ga0501067_0001990 3300049583 Bacteria 11247
332 Ga0501067_0013341 3300049583 Bacteria 4550
333 Ga0501067_0017517 3300049583 Bacteria 3964
334 Ga0501068_0017269 3300049584 Bacteria 4171
335 Ga0501069_0017282 3300049585 Bacteria 3880
336 Ga0501070_0001346 3300049586 Bacteria 21986
337 Ga0501070_0004544 3300049586 Bacteria 11909
338 Ga0501070_0008184 3300049586 Bacteria 8843
339 Ga0501070_0173005 3300049586 Bacteria 1778
340 Ga0501071_0014887 3300049587 Bacteria 5329
341 Ga0501072_0029658 3300049588 Bacteria 4274
342 Ga0501073_0019209 3300049589 Bacteria 4936
343 Ga0501073_0119538 3300049589 Bacteria 1826
344 Ga0501074_0002740 3300049590 Bacteria 12326
345 Ga0501074_0004189 3300049590 Bacteria 10304
346 Ga0501074_0011316 3300049590 Bacteria 6487
347 Ga0501080_0006370 3300049742 Bacteria 10587
348 Ga0501080_0022792 3300049742 Bacteria 5802
349 Ga0501080_0096875 3300049742 Bacteria 2739
350 Ga0501080_0422171 3300049742 Bacteria 1198
351 Ga0501083_0000782 3300049744 Bacteria 20897
352 Ga0501083_0027524 3300049744 Bacteria 3923
353 Ga0501035_0152341 3300049822 Bacteria 2006
354 Ga0501044_0336560 3300049823 Bacteria 1431
355 nmdc:mga08y16_224943_c1 3300050511 Bacteria 1942
356 nmdc:mga0n895_333237_c1 3300050512 Bacteria 1537
357 Ga0495601_0006734 3300053077 Bacteria 6726
358 Ga0495595_0057839 3300053084 Bacteria 1809
359 Ga0495595_0115989 3300053084 Bacteria 1302
360 Ga0495619_0110674 3300053085 Bacteria 1877
361 Ga0501084_0010996 3300054114 Bacteria 7496
362 Ga0501084_0099002 3300054114 Bacteria 2448
363 Ga0501082_0005798 3300060353 Bacteria 10721
364 Ga0501082_0077797 3300060353 Bacteria 2860
365 Ga0530510_0059885 3300061734 Bacteria 2755
366 2917743670 2917736166 Bacteria 9690793
367 8056062032 8056060235 Bacteria 7259403
368 Ga0373925_0000010
369 Ga0070658_10036446
370 Ga0070658_10297895
371 Ga0070683_100004764
372 Ga0070683_100090993
373 Ga0070683_100229355
374 Ga0070682_100015304
375 Ga0068868_100029631
376 Ga0070660_100130981
377 Ga0070687_100011698
378 Ga0070661_100172028
379 Ga0070692_10000448
380 Ga0070692_10019535
381 Ga0070675_100047461
382 Ga0070688_100111597
383 Ga0070659_100053561
384 Ga0070667_100106837
385 Ga0070709_10002663
386 Ga0070709_10020563
387 Ga0070714_100000290
388 Ga0070714_100004099
389 Ga0070714_100143504
390 Ga0070714_100233169
391 Ga0070713_100006088
392 Ga0070713_100057305
393 Ga0070701_10002899
394 Ga0070711_100030181
395 Ga0070700_100005193
396 Ga0070708_100077476
397 Ga0070708_100249251
398 Ga0070681_10096427
399 Ga0068867_100011402
400 Ga0070685_10029212
401 Ga0070706_100001516
402 Ga0070706_100003733
403 Ga0070706_100023521
404 Ga0070706_100046169
405 Ga0070706_100070777
406 Ga0070706_100076210
407 Ga0070707_100000199
408 Ga0070707_100003290
409 Ga0070707_100009855
410 Ga0070707_100052893
411 Ga0070707_100156741
412 Ga0070698_100000192
413 Ga0070698_100000264
414 Ga0070698_100000354
415 Ga0070699_100206801
416 Ga0070679_100004884
417 Ga0070679_100379602
418 Ga0070684_100050002
419 Ga0070684_100067428
420 Ga0068853_100363242
421 Ga0070665_100024999
422 Ga0070665_100156120
423 Ga0068855_100323879
424 Ga0070664_100034626
425 Ga0068857_100116805
426 Ga0068852_100004600
427 Ga0068864_100026808
428 Ga0068866_10006879
429 Ga0068861_100023085
430 Ga0068870_10006944
431 Ga0068862_100096750
432 Ga0081540_1000601
433 Ga0070717_10021614
434 Ga0070717_10127422
435 Ga0070717_10228421
436 Ga0070715_10019336
437 Ga0070715_10024815
438 Ga0070716_100007162
439 Ga0070712_100075112
440 Ga0068865_100003974
441 Ga0068865_100007160
442 Ga0075436_100006214
443 Ga0099795_10041036
444 Ga0105245_10028119
445 Ga0105243_10007974
446 Ga0105242_10162873
447 Ga0105248_10141218
448 Ga0105248_10193342
449 Ga0105238_10294073
450 Ga0105249_10035645
451 Ga0105249_10089357
452 Ga0105249_10157523
453 Ga0099796_10008876
454 Ga0105239_10012763
455 Ga0105239_10021779
456 Ga0157370_10087380
457 Ga0157369_10040332
458 Ga0157369_10093396
459 Ga0157369_10167212
460 Ga0163162_10028201
461 Ga0157372_10001787
462 Ga0157375_10087512
463 Ga0163163_10131670
464 Ga0157380_10020268
465 Ga0157377_10009627
466 Ga0157377_10100633
467 Ga0157376_10190884
468 Ga0213875_10000582
469 Ga0213875_10001776
470 Ga0213875_10002331
471 Ga0213875_10012810
472 Ga0213875_10074169
473 Ga0224712_10007224
474 Ga0224712_10020580
475 Ga0207692_10158374
476 Ga0207642_10007355
477 Ga0207688_10002364
478 Ga0207699_10001461
479 Ga0207699_10044978
480 Ga0207699_10095380
481 Ga0207705_10005558
482 Ga0207684_10001458
483 Ga0207684_10005062
484 Ga0207684_10108928
485 Ga0207693_10025059
486 Ga0207693_10085460
487 Ga0207663_10034607
488 Ga0207660_10037846
489 Ga0207662_10016440
490 Ga0207657_10061503
491 Ga0207649_10102325
492 Ga0207652_10015414
493 Ga0207646_10000278
494 Ga0207646_10009763
495 Ga0207646_10045705
496 Ga0207659_10151114
497 Ga0207687_10057302
498 Ga0207700_10004742
499 Ga0207700_10009747
500 Ga0207700_10017587
501 Ga0207700_10028895
502 Ga0207700_10064406
503 Ga0207700_10253208
504 Ga0207664_10017288
505 Ga0207664_10017911
506 Ga0207690_10036940
507 Ga0207706_10354230
508 Ga0207704_10011456
509 Ga0207704_10030441
510 Ga0207665_10003669
511 Ga0207665_10005968
512 Ga0207665_10162456
513 Ga0207691_10002443
514 Ga0207661_10012377
515 Ga0207661_10087074
516 Ga0207661_10208156
517 Ga0207679_10158009
518 Ga0207679_10229579
519 Ga0207712_10212988
520 Ga0207640_10030111
521 Ga0207677_10033359
522 Ga0207703_10261038
523 Ga0207639_10188027
524 Ga0207678_10025077
525 Ga0207678_10058810
526 Ga0207678_10081930
527 Ga0207678_10121710
528 Ga0207708_10000642
529 Ga0207648_10016322
530 Ga0207676_10078015
531 Ga0207674_10015093
532 Ga0207674_10068887
533 Ga0207675_100001682
534 Ga0207683_10051353
535 Ga0207428_10175311
536 Ga0268266_10001087
537 Ga0268265_10070405
538 Ga0265337_1000181
539 Ga0265326_10000982
540 Ga0265319_1000235
541 Ga0265334_10000367
542 Ga0265323_10009842
543 Ga0265336_10001654
544 Ga0307515_10033425
545 Ga0265338_10005351
546 Ga0265338_10008811
547 Ga0265338_10009528
548 Ga0265324_10000535
549 Ga0265332_10000225
550 Ga0265325_10035396
551 Ga0265340_10021866
552 Ga0265339_10017002
553 Ga0265316_10077705
554 Ga0265313_10012432
555 Ga0265314_10001593
556 Ga0265342_10026443
557 Ga0316214_1001901
558 Ga0373926_0006383
559 Ga0373934_0005298
560 Ga0373923_0035438
561 Ga0373936_0000417
562 Ga0373945_0000067
563 Ga0373954_0036787
564 Ga0373956_0002865
565 Ga0373956_0023741
566 Ga0373957_0003214
567 Ga0373943_0000965
568 Ga0373946_0001423
569 Ga0373955_0007934
570 Ga0373955_0017519
571 Ga0373924_0050446
572 Ga0373935_0008867
573 Ga0373935_0032926
574 Ga0373935_0126416
575 Ga0373927_0005245
576 Ga0373933_0027727
577 Ga0373947_0046933
578 Ga0395898_0044178
579 Ga0436364_0117460
580 Ga0436364_0332089
581 Ga0436364_0377556
582 Ga0436364_0640945
583 Ga0436364_0805657
584 Ga0436364_1314906
585 Ga0436364_1379051
586 Ga0466969_0034433
587 Ga0466965_0006911
588 Ga0466966_0024045
589 Ga0466963_0053400
590 Ga0466963_0167437
591 Ga0466963_0182374
592 Ga0466964_0018982
593 Ga0466970_0008721
594 Ga0466970_0010016
595 Ga0466967_0001494
596 Ga0466967_0019587
597 Ga0466967_0036367
598 Ga0466967_0047124
599 Ga0466967_0054681
600 Ga0466967_0173364
601 Ga0466967_0367045
602 Ga0495592_0049486
603 Ga0495592_0163554
604 Ga0495651_0061517
605 Ga0495651_0062904
606 Ga0495653_0007748
607 Ga0495653_0028350
608 Ga0495662_0050169
609 Ga0495664_0005310
610 Ga0495608_0019383
611 Ga0495608_0020784
612 Ga0495608_0049475
613 Ga0495618_0022653
614 Ga0495618_0098026
615 Ga0495628_0045625
616 Ga0495628_0085044
617 Ga0495630_0059264
618 Ga0495630_0170823
619 Ga0495652_0014529
620 Ga0495652_0024501
621 Ga0495652_0183278
622 Ga0495665_0026490
623 Ga0495640_0128150
624 Ga0495587_0017475
625 Ga0495645_0031948
626 Ga0495667_0001523
627 Ga0495667_0051134
628 Ga0495667_0116669
629 Ga0495634_0007848
630 Ga0495634_0010255
631 Ga0495635_0008472
632 Ga0495657_0027821
633 Ga0495657_0123388
634 Ga0495599_0017645
635 Ga0495599_0036102
636 Ga0495623_0147732
637 Ga0495646_0106345
638 Ga0495613_0066732
639 Ga0495624_0012702
640 Ga0495600_0011479
641 Ga0495581_0045691
642 Ga0495604_0008857
643 Ga0495674_0000849
644 Ga0495674_0023463
645 Ga0495674_0220589
646 Ga0495676_0009129
647 Ga0495680_0030802
648 Ga0495680_0033675
649 Ga0495680_0070829
650 Ga0495684_0002340
651 Ga0495684_0007390
652 Ga0495684_0092300
653 Ga0495684_0247323
654 Ga0495602_0048167
655 Ga0495602_0054002
656 Ga0495602_0066674
657 Ga0496101_0014848
658 Ga0496101_0018429
659 Ga0496101_0063507
660 Ga0496102_0003823
661 Ga0496102_0041863
662 Ga0496102_0085632
663 Ga0496102_0434896
664 Ga0496102_0448066
665 Ga0496103_0023520
666 Ga0496104_0074037
667 Ga0496105_0000874
668 Ga0496106_0186857
669 Ga0496106_0207932
670 Ga0496107_0032809
671 Ga0496107_0036633
672 Ga0496107_0214168
673 Ga0496108_0024635
674 Ga0496108_0060600
675 Ga0496109_0006806
676 Ga0496109_0023899
677 Ga0496109_0037601
678 Ga0496109_0043877
679 Ga0496109_0090227
680 Ga0496109_0105667
681 Ga0496111_0014507
682 Ga0496113_0086696
683 Ga0496113_0132777
684 Ga0496114_0006707
685 Ga0496114_0062235
686 Ga0496114_0134334
687 Ga0496114_0268866
688 Ga0496115_0043545
689 Ga0496115_0059721
690 Ga0496115_0132109
691 Ga0496115_0169516
692 Ga0496119_0042271
693 Ga0496119_0140769
694 Ga0501031_0008048
695 Ga0501034_0166701
696 Ga0501034_0335353
697 Ga0501047_0037848
698 Ga0501067_0001990
699 Ga0501067_0013341
700 Ga0501067_0017517
701 Ga0501068_0017269
702 Ga0501069_0017282
703 Ga0501070_0001346
704 Ga0501070_0004544
705 Ga0501070_0008184
706 Ga0501070_0173005
707 Ga0501071_0014887
708 Ga0501072_0029658
709 Ga0501073_0019209
710 Ga0501073_0119538
711 Ga0501074_0002740
712 Ga0501074_0004189
713 Ga0501074_0011316
714 Ga0501080_0006370
715 Ga0501080_0022792
716 Ga0501080_0096875
717 Ga0501080_0422171
718 Ga0501083_0000782
719 Ga0501083_0027524
720 Ga0501035_0152341
721 Ga0501044_0336560
722 nmdc:mga08y16_224943_c1
723 nmdc:mga0n895_333237_c1
724 Ga0495601_0006734
725 Ga0495595_0057839
726 Ga0495595_0115989
727 Ga0495619_0110674
728 Ga0501084_0010996
729 Ga0501084_0099002
730 Ga0501082_0005798
731 Ga0501082_0077797
732 Ga0530510_0059885
733 2917743670
734 8056062032

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03033

Glyco_transf_28

Glycosyltransferase family 28 N-terminal domain

3

143

0.96

PF04101

Glyco_tran_28_C

Glycosyltransferase family 28 C-terminal domain

188

363

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3s2u-assembly1.cif.gz_A crystal structure of the pseudomonas aeruginosa murg:udp-glcnac substrate complex 0.8686 1 349
3eq1-assembly2.cif.gz_B the crystal structure of human porphobilinogen deaminase at 2.8a resolution 0.8681 1 37
3s2u-assembly1.cif.gz_A crystal structure of the pseudomonas aeruginosa murg:udp-glcnac substrate complex 0.8636 1 349
7ccz-assembly2.cif.gz_B crystal structure of the es2 intermediate form of human hydroxymethylbilane synthase 0.8576 1 38
5m6r-assembly2.cif.gz_B human porphobilinogen deaminase in complex with reaction intermediate 0.8554 3 39
ID Description Score Start End Superfamily
af_P9WJK9_231_384_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9439 172 332 3.40.50.2000
af_P9WJK9_36_221_3.65.10.10 Alpha Beta;Alpha-beta prism;UDP-n-acetylglucosamine1-carboxyvinyl-transferase; Chain;Enolpyruvate transferase domain 0.9299 1 160 3.65.10.10
af_P9WJK9_231_384_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9261 172 332 3.40.50.2000
af_P9WJK9_38_202_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9251 4 142 3.40.50.2000
af_P17443_6_162_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9048 1 143 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A4Q4D5L1-F1-model_v4 UDP-N-acetylglucosamine--N-acetylmuramyl-(Pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase 0.989 234 353 GO:0016758
AF-A0A090W3X5-F1-model_v4 UDP-N-acetylglucosamine-N-acetylmuramyl-(Pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase (EC 2.4.1.227) 0.9527 2 130 GO:0005975
GO:0030259
GO:0050511
GO:0051991
GO:1901137
AF-A0A399T4W6-F1-model_v4 deleted 0.95 94 352
AF-A0A1V3WYN4-F1-model_v4 Glycosyltransferase family 28 C-terminal domain protein 0.9482 142 319 GO:0016758
AF-W7T0Q0-F1-model_v4 UDP-N-acetylglucosamine-N-acetylmuramyl-(Pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase 0.9397 177 351 GO:0016758

Map