F424406

General Info

Members Datasets Scaffolds Average Seq Length
367 261 361 323

Family's Representative Sequence

Representative Sequence 3300032002|Ga0307416_100012888|Ga0307416_1000128884
Length 373
Sequence MYGLYLNYQRVSKRPRAFGSRGSNAGSSIFRQTVCDQCQGFYIDPLSADIMQYRTFGRTQFKVSEIGYGMWGLAGWTGTDTRELDRALDRSVALGCNFYDTAWGYGAGKSEQILGELVKRHPDKTLYHATKIPPKNLQWPSKSHFRLEDCFPYDHIIEYTEKSLKNLDVDCIDLQQFHVWEDSWAQNDEWKRAVEKLKKDGKIRFMGVSVNRWEPDNVLDTLKTGLIDAVQVIYNIFDQAPEDNLFPLCRKLNIGVIARVPFDEGSLTGTLTKQTTFPKDDWRSTYFVPENLNSSVEHADALRPLIPAGMTMPEMALRFILENDAVHTIIPGMRKLRNVEGNMAASDGKRLDAGVVRKLKNHRWDRTPTSWSQ

Samples

Sample ID Description Type Environment
1 2511231014 Pseudomonas sp. GM48 Isolate Nodule
2 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
3 2687453257 Planctomyces sp. SH-PL62 Isolate Unclassified
4 2889415604 Paludisphaera rhizosphaerae JC665 Isolate Rhizosphere
5 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
6 2920107658 Aquisphaera insulae JC669 Isolate Rhizosphere
7 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
8 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
15 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
16 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
21 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
42 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
43 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
44 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
45 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
73 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
109 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
110 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
114 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
116 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
160 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
164 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
165 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
166 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
167 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
168 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
169 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
170 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
171 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
172 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
173 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
174 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
175 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
176 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
177 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
178 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
180 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
181 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
182 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
183 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
184 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
185 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
186 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
187 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
188 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
189 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
190 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
191 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
192 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
193 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
194 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
195 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
196 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
197 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
198 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
199 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
200 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
201 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
202 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
203 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
204 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
205 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
206 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
207 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
208 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
209 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
210 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
211 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
212 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
213 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
214 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
215 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
216 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
217 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
218 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
219 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
220 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
221 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
222 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
223 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
224 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
225 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
226 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
227 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
228 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
229 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
230 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
231 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
232 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
233 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
240 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
241 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
243 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
244 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
245 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
246 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
247 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
248 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
249 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
250 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
251 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
252 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
253 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
254 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
255 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
256 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
257 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
258 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
259 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
260 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
261 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.82
Metatranscriptomes 0
Isolates 2.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.08
Nodule 0.27
Rhizoplane 2.72
Rhizosphere 82.02
Stem 0
Stem Tuber 0
Unclassified 4.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25154J39366_1000227 3300002738 Bacteria 37673
2 JGI25153J46596_10003831 3300003215 Bacteria 8291
3 rootH1_10042163 3300003316 Bacteria 2483
4 rootH1_10054911 3300003316 Bacteria 39663
5 rootH1_10054911 3300003323 Unclassified 4728
6 rootH2_10011821 3300003320 Bacteria 27973
7 rootL2_10077722 3300003322 Bacteria 6085
8 rootH1_10010049 3300003323 Bacteria 56441
9 rootH1_10013865 3300003323 Bacteria 59066
10 rootH1_10024619 3300003323 Bacteria 6325
11 rootH1_10063766 3300003316 Bacteria 9737
12 rootH1_10063766 3300003323 Bacteria 1469
13 rootH1_10073800 3300003323 Bacteria 3023
14 Ga0055526_1008824 3300003771 Bacteria 4957
15 Ga0055536_1009842 3300003781 Bacteria 3889
16 Ga0055528_1000438 3300003790 Bacteria 33416
17 Ga0055530_10000718 3300003791 Bacteria 27839
18 Ga0055530_10023873 3300003791 Bacteria 1747
19 Ga0055531_10030756 3300003794 Unclassified 1793
20 Ga0065165_1000022 3300005262 Bacteria 253404
21 Ga0065165_1000057 3300005262 Bacteria 185971
22 Ga0065165_1000546 3300005262 Bacteria 56702
23 Ga0065165_1026372 3300005262 Bacteria 1913
24 Ga0065712_10003128 3300005290 Bacteria 6195
25 Ga0065715_10164793 3300005293 Bacteria 1596
26 Ga0065707_10012772 3300005295 Bacteria 2070
27 Ga0070658_10008114 3300005327 Bacteria 8445
28 Ga0070690_100004422 3300005330 Bacteria 7802
29 Ga0070690_100032941 3300005330 Bacteria 3240
30 Ga0070670_100170958 3300005331 Unclassified 1885
31 Ga0068869_100006911 3300005334 Bacteria 7219
32 Ga0070666_10000566 3300005335 Bacteria 22401
33 Ga0068868_100004867 3300005338 Bacteria 9427
34 Ga0068868_100178682 3300005338 Bacteria 1760
35 Ga0070660_100010709 3300005339 Bacteria 6489
36 Ga0070689_100045782 3300005340 Bacteria 3370
37 Ga0070689_100266831 3300005340 Bacteria 1416
38 Ga0070687_100030069 3300005343 Bacteria 2652
39 Ga0070661_100016113 3300005344 Bacteria 5276
40 Ga0070669_100033661 3300005353 Bacteria 3707
41 Ga0070675_100021702 3300005354 Bacteria 5130
42 Ga0070671_100071094 3300005355 Bacteria 2904
43 Ga0070671_100073255 3300005355 Unclassified 2861
44 Ga0070674_100021240 3300005356 Bacteria 4164
45 Ga0070674_100366933 3300005356 Bacteria 1167
46 Ga0070673_100050785 3300005364 Bacteria 3244
47 Ga0070688_100023383 3300005365 Bacteria 3634
48 Ga0070659_100003429 3300005366 Bacteria 11291
49 Ga0070667_100029068 3300005367 Bacteria 4603
50 Ga0070667_100140099 3300005367 Bacteria 2117
51 Ga0070709_10030569 3300005434 Bacteria 3233
52 Ga0070714_100138493 3300005435 Unclassified 2182
53 Ga0070713_100049819 3300005436 Bacteria 3457
54 Ga0070711_100096574 3300005439 Bacteria 2141
55 Ga0070711_100097312 3300005439 Bacteria 2134
56 Ga0070708_100007060 3300005445 Bacteria 8963
57 Ga0070662_100004871 3300005457 Bacteria 8518
58 Ga0070681_10039885 3300005458 Bacteria 4707
59 Ga0068867_100071358 3300005459 Unclassified 2598
60 Ga0070699_100003062 3300005518 Bacteria 14827
61 Ga0070679_100052735 3300005530 Bacteria 4049
62 Ga0070679_100147628 3300005530 Bacteria 2329
63 Ga0068853_100023700 3300005539 Bacteria 5142
64 Ga0070672_100087898 3300005543 Unclassified 2501
65 Ga0070686_100068074 3300005544 Unclassified 2322
66 Ga0070695_100220832 3300005545 Bacteria 1365
67 Ga0070693_100205517 3300005547 Bacteria 1282
68 Ga0070665_100002455 3300005548 Bacteria 20430
69 Ga0068855_100011479 3300005563 Bacteria 10705
70 Ga0070664_100010490 3300005564 Bacteria 7508
71 Ga0070664_100161149 3300005564 Bacteria 1985
72 Ga0068857_100007104 3300005577 Bacteria 9644
73 Ga0068857_100276627 3300005577 Bacteria 1543
74 Ga0068854_100067313 3300005578 Bacteria 2609
75 Ga0068854_100388764 3300005578 Bacteria 1151
76 Ga0068856_100089492 3300005614 Bacteria 3061
77 Ga0070702_100122903 3300005615 Bacteria 1628
78 Ga0068852_100001989 3300005616 Bacteria 13934
79 Ga0068859_100000026 3300005617 Bacteria 188742
80 Ga0068859_100062716 3300005617 Bacteria 3747
81 Ga0068859_100155877 3300005617 Bacteria 2361
82 Ga0068864_100012129 3300005618 Bacteria 7119
83 Ga0068851_10085457 3300005834 Bacteria 1654
84 Ga0068863_100004512 3300005841 Bacteria 13734
85 Ga0068858_100005551 3300005842 Bacteria 12343
86 Ga0068860_100007533 3300005843 Bacteria 10890
87 Ga0068860_100012563 3300005843 Bacteria 8337
88 Ga0068860_100018785 3300005843 Bacteria 6716
89 Ga0068860_100439552 3300005843 Bacteria 1296
90 Ga0068862_100026443 3300005844 Bacteria 4877
91 Ga0081539_10001707 3300005985 Bacteria 35373
92 Ga0075432_10006198 3300006058 Unclassified 4065
93 Ga0070715_10080369 3300006163 Bacteria 1478
94 Ga0070712_100215681 3300006175 Bacteria 1516
95 Ga0097621_100002699 3300006237 Bacteria 12141
96 Ga0097621_100007256 3300006237 Bacteria 7914
97 Ga0068871_100190113 3300006358 Bacteria 1768
98 Ga0068871_100331170 3300006358 Bacteria 1343
99 Ga0068871_100333492 3300006358 Bacteria 1338
100 Ga0075428_100004169 3300006844 Bacteria 15907
101 Ga0075430_100160578 3300006846 Unclassified 1871
102 Ga0075433_10037498 3300006852 Bacteria 4182
103 Ga0075429_100190929 3300006880 Bacteria 1795
104 Ga0068865_100034383 3300006881 Bacteria 3400
105 Ga0068865_100067135 3300006881 Bacteria 2532
106 Ga0068865_100342998 3300006881 Unclassified 1208
107 Ga0097620_100000026 3300006931 Bacteria 188742
108 Ga0097620_100062713 3300006931 Bacteria 3747
109 Ga0097620_100155883 3300006931 Bacteria 2361
110 Ga0075435_100013925 3300007076 Bacteria 5998
111 Ga0099794_10002031 3300007265 Bacteria 7320
112 Ga0105240_10292883 3300009093 Bacteria 1865
113 Ga0111539_10002180 3300009094 Bacteria 26174
114 Ga0111539_10024467 3300009094 Bacteria 7408
115 Ga0111539_10332114 3300009094 Unclassified 1770
116 Ga0105245_10156768 3300009098 Unclassified 2157
117 Ga0114129_10033181 3300009147 Bacteria 7296
118 Ga0114129_10033336 3300009147 Bacteria 7278
119 Ga0114129_10703590 3300009147 Bacteria 1298
120 Ga0105241_10002748 3300009174 Bacteria 13193
121 Ga0105241_10070064 3300009174 Unclassified 2720
122 Ga0105242_10156137 3300009176 Bacteria 1993
123 Ga0105242_10362207 3300009176 Bacteria 1342
124 Ga0105237_10011985 3300009545 Bacteria 9160
125 Ga0105237_10510257 3300009545 Bacteria 1209
126 Ga0105249_10013311 3300009553 Bacteria 7264
127 Ga0105249_10019136 3300009553 Bacteria 6106
128 Ga0105239_10051482 3300010375 Bacteria 4514
129 Ga0105239_10192255 3300010375 Unclassified 2284
130 Ga0105239_10297766 3300010375 Bacteria 1817
131 Ga0105246_10014353 3300011119 Unclassified 4981
132 Ga0105246_10081316 3300011119 Bacteria 2309
133 Ga0157371_10039795 3300013102 Bacteria 3361
134 Ga0157371_10073567 3300013102 Unclassified 2420
135 Ga0157370_10025007 3300013104 Bacteria 5909
136 Ga0157370_10039722 3300013104 Bacteria 4546
137 Ga0157369_10036358 3300013105 Bacteria 5396
138 Ga0157374_10122132 3300013296 Bacteria 2515
139 Ga0157378_10007165 3300013297 Bacteria 9738
140 Ga0157378_10007361 3300013297 Bacteria 9617
141 Ga0157378_10009835 3300013297 Bacteria 8338
142 Ga0157378_10070977 3300013297 Bacteria 3127
143 Ga0157378_10075484 3300013297 Unclassified 3035
144 Ga0157378_10081412 3300013297 Bacteria 2926
145 Ga0157378_10571883 3300013297 Bacteria 1138
146 Ga0163162_10001684 3300013306 Bacteria 20736
147 Ga0163162_10011640 3300013306 Bacteria 8577
148 Ga0163162_10087131 3300013306 Bacteria 3201
149 Ga0163162_10353225 3300013306 Bacteria 1603
150 Ga0157372_10066577 3300013307 Bacteria 4047
151 Ga0157375_10150433 3300013308 Unclassified 2463
152 Ga0157375_10274232 3300013308 Bacteria 1849
153 Ga0157375_10277460 3300013308 Bacteria 1839
154 Ga0163163_10114536 3300014325 Unclassified 2727
155 Ga0163163_10156852 3300014325 Unclassified 2320
156 Ga0157380_10009413 3300014326 Bacteria 6999
157 Ga0157380_10475755 3300014326 Bacteria 1207
158 Ga0157377_10001614 3300014745 Bacteria 9826
159 Ga0157379_10046875 3300014968 Bacteria 3857
160 Ga0157379_10237953 3300014968 Bacteria 1651
161 Ga0157379_10298415 3300014968 Bacteria 1468
162 Ga0157376_10000005 3300014969 Bacteria 443695
163 Ga0157376_10000716 3300014969 Bacteria 21448
164 Ga0157376_10019987 3300014969 Bacteria 5172
165 Ga0157376_10048810 3300014969 Bacteria 3504
166 Ga0209646_1000009 3300025246 Bacteria 652154
167 Ga0209026_1000188 3300025250 Bacteria 90347
168 Ga0209673_1000287 3300025273 Bacteria 94132
169 Ga0209676_1000448 3300025292 Bacteria 69928
170 Ga0209564_1003883 3300025295 Bacteria 9606
171 Ga0209564_1015025 3300025295 Unclassified 3177
172 Ga0209758_1002873 3300025297 Bacteria 16695
173 Ga0209758_1010704 3300025297 Bacteria 5444
174 Ga0209758_1010911 3300025297 Bacteria 5353
175 Ga0209050_1000755 3300025298 Bacteria 46537
176 Ga0209050_1011585 3300025298 Bacteria 4157
177 Ga0209050_1030860 3300025298 Bacteria 1683
178 Ga0207426_1000203 3300025302 Bacteria 142379
179 Ga0207426_1000846 3300025302 Bacteria 32226
180 Ga0207426_1007479 3300025302 Bacteria 4568
181 Ga0209051_1012234 3300025303 Unclassified 4161
182 Ga0209257_1001979 3300025304 Bacteria 22030
183 Ga0207656_10022937 3300025321 Bacteria 2508
184 Ga0207710_10002388 3300025900 Bacteria 8761
185 Ga0207688_10011112 3300025901 Unclassified 4899
186 Ga0207680_10000145 3300025903 Bacteria 33969
187 Ga0207680_10177232 3300025903 Bacteria 1439
188 Ga0207645_10021939 3300025907 Bacteria 4160
189 Ga0207643_10027684 3300025908 Bacteria 3144
190 Ga0207705_10034172 3300025909 Bacteria 3635
191 Ga0207654_10001951 3300025911 Bacteria 10699
192 Ga0207695_10262626 3300025913 Bacteria 1624
193 Ga0207671_10004079 3300025914 Bacteria 14141
194 Ga0207663_10095045 3300025916 Bacteria 1987
195 Ga0207662_10132772 3300025918 Bacteria 1571
196 Ga0207657_10019184 3300025919 Bacteria 6503
197 Ga0207649_10017941 3300025920 Bacteria 4014
198 Ga0207652_10445204 3300025921 Bacteria 1168
199 Ga0207694_10073577 3300025924 Bacteria 2674
200 Ga0207650_10023863 3300025925 Unclassified 4342
201 Ga0207659_10199174 3300025926 Bacteria 1598
202 Ga0207700_10034785 3300025928 Bacteria 3621
203 Ga0207664_10123953 3300025929 Unclassified 2167
204 Ga0207644_10221980 3300025931 Unclassified 1498
205 Ga0207706_10010912 3300025933 Bacteria 8289
206 Ga0207706_10262622 3300025933 Bacteria 1507
207 Ga0207670_10084425 3300025936 Bacteria 2229
208 Ga0207669_10011919 3300025937 Unclassified 4253
209 Ga0207691_10032332 3300025940 Unclassified 4879
210 Ga0207689_10012838 3300025942 Bacteria 7151
211 Ga0207661_10014132 3300025944 Bacteria 5843
212 Ga0207679_10045552 3300025945 Unclassified 3173
213 Ga0207679_10268681 3300025945 Bacteria 1458
214 Ga0207712_10019418 3300025961 Bacteria 4438
215 Ga0207712_10345143 3300025961 Bacteria 1236
216 Ga0207658_10048441 3300025986 Bacteria 3116
217 Ga0207658_10117072 3300025986 Bacteria 2117
218 Ga0207677_10019871 3300026023 Bacteria 4066
219 Ga0207703_10008892 3300026035 Bacteria 7913
220 Ga0207678_10109400 3300026067 Bacteria 2357
221 Ga0207708_10140899 3300026075 Bacteria 1891
222 Ga0207702_10125274 3300026078 Bacteria 2305
223 Ga0207641_10000155 3300026088 Bacteria 97385
224 Ga0207641_10012580 3300026088 Bacteria 6937
225 Ga0207676_10126213 3300026095 Unclassified 2167
226 Ga0207674_10032699 3300026116 Bacteria 5453
227 Ga0207674_10060599 3300026116 Bacteria 3826
228 Ga0207683_10015542 3300026121 Bacteria 6481
229 Ga0207698_10060679 3300026142 Bacteria 2942
230 Ga0207698_10241747 3300026142 Unclassified 1646
231 Ga0209588_1000234 3300027671 Bacteria 14858
232 Ga0207428_10042666 3300027907 Unclassified 3667
233 Ga0268266_10000299 3300028379 Bacteria 79882
234 Ga0268265_10059953 3300028380 Bacteria 2914
235 Ga0268264_10006893 3300028381 Bacteria 9537
236 Ga0268264_10007633 3300028381 Bacteria 9015
237 Ga0268264_10009357 3300028381 Bacteria 8108
238 Ga0268264_10601102 3300028381 Bacteria 1084
239 Ga0307515_10000009 3300028794 Bacteria 653206
240 Ga0307515_10050320 3300028794 Bacteria 6244
241 Ga0265327_10062848 3300031251 Bacteria 1888
242 Ga0307513_10171857 3300031456 Bacteria 2043
243 Ga0307408_100156766 3300031548 Bacteria 1804
244 Ga0307408_100203545 3300031548 Bacteria 1604
245 Ga0316579_10033271 3300031691 Bacteria 2367
246 Ga0316579_10035231 3300031691 Bacteria 2306
247 Ga0307405_10057814 3300031731 Bacteria 2438
248 Ga0316577_10054503 3300031733 Bacteria 2231
249 Ga0307413_10017192 3300031824 Bacteria 3761
250 Ga0307416_100012888 3300032002 Bacteria 5658
251 Ga0307416_100030403 3300032002 Bacteria 4052
252 Ga0307414_10316800 3300032004 Bacteria 1326
253 Ga0307411_10101879 3300032005 Bacteria 2033
254 Ga0316574_0065937 3300035398 Bacteria 2280
255 Ga0373931_0077354 3300035691 Bacteria 1829
256 Ga0373937_0160030 3300036401 Bacteria 2111
257 Ga0316582_0108977 3300036647 Bacteria 1841
258 Ga0316582_0167604 3300036647 Bacteria 1490
259 Ga0373925_0114755 3300037068 Bacteria 2085
260 Ga0395905_0219886 3300037471 Bacteria 1778
261 Ga0316581_0011455 3300037588 Bacteria 2480
262 Ga0439447_000641 3300041407 Bacteria 13009
263 Ga0439466_0000549 3300041411 Bacteria 14176
264 Ga0439465_0012132 3300041413 Bacteria 2697
265 Ga0439432_000133 3300042006 Bacteria 24925
266 Ga0439451_000049 3300042009 Bacteria 23821
267 Ga0439452_000926 3300042010 Bacteria 13282
268 Ga0439456_000420 3300042013 Bacteria 9493
269 Ga0439463_000364 3300042016 Bacteria 12555
270 Ga0450911_000482 3300042115 Bacteria 12722
271 Ga0450919_000010 3300042121 Bacteria 17785
272 Ga0450922_000184 3300042124 Bacteria 6510
273 Ga0450890_000288 3300042127 Bacteria 7393
274 Ga0450903_000276 3300042138 Bacteria 11305
275 Ga0450906_001114 3300042145 Bacteria 5955
276 Ga0450907_000204 3300042146 Bacteria 21393
277 Ga0439446_0000083 3300042156 Bacteria 15643
278 Ga0450908_000120 3300042184 Bacteria 16012
279 Ga0450909_000038 3300042185 Bacteria 10783
280 Ga0439434_0004435 3300042435 Bacteria 4103
281 Ga0439464_0003661 3300042439 Bacteria 3898
282 Ga0439460_0000346 3300042461 Bacteria 9733
283 Ga0451577_0149281 3300042876 Bacteria 2103
284 Ga0466972_0012124 3300044658 Bacteria 4331
285 Ga0453684_0022387 3300044712 Bacteria 9378
286 Ga0453684_0022516 3300044712 Bacteria 9341
287 Ga0453684_0362279 3300044712 Bacteria 1632
288 Ga0453684_0379730 3300044712 Bacteria 1587
289 Ga0453684_0851566 3300044712 Bacteria 980
290 Ga0451576_0015721 3300045051 Bacteria 8377
291 Ga0451576_0104783 3300045051 Bacteria 2942
292 Ga0495592_0244436 3300046454 Bacteria 1189
293 Ga0495603_0018948 3300046455 Bacteria 4166
294 Ga0495603_0061696 3300046455 Bacteria 2214
295 Ga0495629_0056118 3300046459 Bacteria 2754
296 Ga0495638_0000040 3300046460 Bacteria 241883
297 Ga0495641_0114052 3300046461 Bacteria 1205
298 Ga0495580_0001866 3300046472 Bacteria 18532
299 Ga0495580_0014378 3300046472 Bacteria 6003
300 Ga0495580_0016112 3300046472 Bacteria 5618
301 Ga0495580_0348101 3300046472 Bacteria 1004
302 Ga0495582_0001408 3300046473 Bacteria 13557
303 Ga0495585_0001954 3300046492 Bacteria 15390
304 Ga0495594_0011693 3300046499 Bacteria 4563
305 Ga0495618_0105229 3300046514 Bacteria 1807
306 Ga0495628_0039616 3300046516 Bacteria 3768
307 Ga0495630_0032803 3300046517 Bacteria 3871
308 Ga0495640_0015177 3300046533 Bacteria 5802
309 Ga0495586_0049520 3300046535 Bacteria 2272
310 Ga0495645_0010771 3300046543 Bacteria 6423
311 Ga0495613_0032479 3300046689 Bacteria 3878
312 Ga0495581_0041506 3300047315 Bacteria 2662
313 Ga0495674_0055100 3300047319 Bacteria 3488
314 Ga0495684_0203835 3300047471 Bacteria 1457
315 Ga0495614_0057358 3300048089 Bacteria 1672
316 Ga0496100_0095784 3300048903 Bacteria 2035
317 Ga0496104_0168121 3300048907 Bacteria 2103
318 Ga0496104_0583842 3300048907 Bacteria 1028
319 Ga0496105_0085918 3300048908 Bacteria 2600
320 Ga0496106_0152236 3300048909 Bacteria 1825
321 Ga0496107_0063758 3300048910 Bacteria 2671
322 Ga0496114_0030933 3300048917 Bacteria 4404
323 Ga0496115_0015305 3300048918 Bacteria 5817
324 Ga0496115_0080221 3300048918 Bacteria 2657
325 Ga0496115_0101913 3300048918 Bacteria 2354
326 Ga0501033_0050560 3300049570 Bacteria 3083
327 Ga0501034_0001340 3300049571 Bacteria 33293
328 Ga0501034_0002231 3300049571 Bacteria 23870
329 Ga0501034_0120845 3300049571 Bacteria 2606
330 Ga0501036_0059509 3300049572 Bacteria 3237
331 Ga0501037_0053647 3300049573 Bacteria 2949
332 Ga0501043_0011632 3300049579 Bacteria 6888
333 Ga0501043_0032048 3300049579 Bacteria 4131
334 Ga0501043_0117387 3300049579 Bacteria 2088
335 Ga0501046_0109212 3300049580 Bacteria 2115
336 Ga0501257_004249 3300049686 Bacteria 3119
337 Ga0501083_0162851 3300049744 Bacteria 1459
338 Ga0501035_0031413 3300049822 Bacteria 4837
339 Ga0501035_0086517 3300049822 Bacteria 2762
340 Ga0501044_0001323 3300049823 Bacteria 29174
341 nmdc:mga05p37_333763_c1 3300050507 Bacteria 1790
342 nmdc:mga05p37_93931_c1 3300050507 Bacteria 3696
343 nmdc:mga08y16_3426_c1 3300050511 Bacteria 16458
344 nmdc:mga0rr50_23340_c1 3300050513 Bacteria 4264
345 nmdc:mga0a205_67431_c1 3300050515 Bacteria 3457
346 Ga0495601_0184227 3300053077 Bacteria 1365
347 Ga0495612_0096512 3300053078 Bacteria 1256
348 Ga0495619_0181381 3300053085 Bacteria 1457
349 Ga0500578_0111518 3300053086 Bacteria 1724
350 Ga0500583_0071293 3300053092 Bacteria 1662
351 Ga0500562_012397 3300053108 Bacteria 2168
352 Ga0500652_025953 3300053131 Bacteria 2251
353 Ga0500655_001520 3300053133 Bacteria 4389
354 Ga0500604_0000716 3300053151 Bacteria 9075
355 Ga0500616_0000013 3300053153 Bacteria 674172
356 Ga0500616_0010701 3300053153 Bacteria 5473
357 Ga0500622_0000009 3300053156 Bacteria 419980
358 Ga0500622_0000016 3300053156 Bacteria 337983
359 Ga0500627_0008663 3300053158 Bacteria 3627
360 Ga0590071_016001 3300059421 Bacteria 1759
361 Ga0590077_005450 3300059426 Bacteria 2608

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049744 Ga0501083_0162851 Ga0501083_0162851_510_1409 294
2 3300031731 Ga0307405_10057814 Ga0307405_100578143 296
3 3300031824 Ga0307413_10017192 Ga0307413_100171925 296
4 3300032005 Ga0307411_10101879 Ga0307411_101018792 296
5 3300031548 Ga0307408_100203545 Ga0307408_1002035451 298
6 3300044658 Ga0466972_0012124 Ga0466972_0012124_211_1125 298
7 3300044712 Ga0453684_0362279 Ga0453684_0362279_39_953 298
8 3300044712 Ga0453684_0851566 Ga0453684_0851566_29_943 298
9 3300046472 Ga0495580_0348101 Ga0495580_0348101_27_941 298
10 3300049822 Ga0501035_0086517 Ga0501035_0086517_910_1824 298
11 3300053092 Ga0500583_0071293 Ga0500583_0071293_250_1164 298
12 3300053108 Ga0500562_012397 Ga0500562_012397_1200_2114 298
13 3300042876 Ga0451577_0149281 Ga0451577_0149281_321_1247 302
14 3300050511 nmdc:mga08y16_3426_c1 nmdc:mga08y16_3426_c1_13539_14465 302
15 3300009553 Ga0105249_10019136 Ga0105249_100191362 304
16 3300014326 Ga0157380_10009413 Ga0157380_100094131 304
17 3300014745 Ga0157377_10001614 Ga0157377_1000161410 304
18 3300013297 Ga0157378_10081412 Ga0157378_100814123 305
19 3300007265 Ga0099794_10002031 Ga0099794_100020315 307
20 3300027671 Ga0209588_1000234 Ga0209588_10002348 307
21 3300005434 Ga0070709_10030569 Ga0070709_100305693 311
22 3300005435 Ga0070714_100138493 Ga0070714_1001384933 311
23 3300005436 Ga0070713_100049819 Ga0070713_1000498193 311
24 3300025928 Ga0207700_10034785 Ga0207700_100347852 311
25 3300025929 Ga0207664_10123953 Ga0207664_101239533 311
26 3300046516 Ga0495628_0039616 Ga0495628_0039616_2746_3717 311
27 3300046543 Ga0495645_0010771 Ga0495645_0010771_4542_5513 311
28 3300059421 Ga0590071_016001 Ga0590071_016001_572_1579 312
29 3300059426 Ga0590077_005450 Ga0590077_005450_1059_2066 312
30 3300005293 Ga0065715_10164793 Ga0065715_101647932 313
31 iso_pu_bacteria 2511231014 2511316858 313
32 iso_pu_bacteria 2522125168 2522547883 313
33 iso_pu_bacteria 2687453257 2688068444 313
34 iso_pu_bacteria 2889415604 2889419117 313
35 iso_pu_bacteria 2910245624 2910247927 313
36 iso_pu_bacteria 2920107658 2920110763 313
37 iso_pu_bacteria 2929921140 2929924204 313
38 iso_pu_bacteria 8003151029 8003152548 313
39 3300032002 Ga0307416_100030403 Ga0307416_1000304034 314
40 3300005290 Ga0065712_10003128 Ga0065712_100031284 315
41 3300005340 Ga0070689_100045782 Ga0070689_1000457823 315
42 3300005353 Ga0070669_100033661 Ga0070669_1000336613 315
43 3300005354 Ga0070675_100021702 Ga0070675_1000217024 315
44 3300005356 Ga0070674_100366933 Ga0070674_1003669331 315
45 3300005365 Ga0070688_100023383 Ga0070688_1000233832 315
46 3300005577 Ga0068857_100276627 Ga0068857_1002766272 315
47 3300005844 Ga0068862_100026443 Ga0068862_1000264434 315
48 3300013308 Ga0157375_10274232 Ga0157375_102742322 315
49 3300025907 Ga0207645_10021939 Ga0207645_100219393 315
50 3300025908 Ga0207643_10027684 Ga0207643_100276841 315
51 3300025933 Ga0207706_10262622 Ga0207706_102626221 315
52 3300025936 Ga0207670_10084425 Ga0207670_100844252 315
53 3300025961 Ga0207712_10345143 Ga0207712_103451432 315
54 3300026116 Ga0207674_10060599 Ga0207674_100605991 315
55 3300028380 Ga0268265_10059953 Ga0268265_100599532 315
56 3300036647 Ga0316582_0167604 Ga0316582_0167604_211_1182 315
57 3300003323 rootH1_10073800 rootH1_100738003 316
58 3300006844 Ga0075428_100004169 Ga0075428_1000041693 316
59 3300006880 Ga0075429_100190929 Ga0075429_1001909292 316
60 3300006881 Ga0068865_100342998 Ga0068865_1003429982 316
61 3300009147 Ga0114129_10033336 Ga0114129_100333363 316
62 3300026067 Ga0207678_10109400 Ga0207678_101094002 316
63 3300050507 nmdc:mga05p37_333763_c1 nmdc:mga05p37_333763_c1_594_1565 316
64 3300002738 JGI25154J39366_1000227 JGI25154J39366_10002271 317
65 3300003215 JGI25153J46596_10003831 JGI25153J46596_100038314 317
66 3300003316 rootH1_10042163 rootH1_100421631 317
67 3300003316 rootH1_10054911 rootH1_1005491111 317
68 3300003320 rootH2_10011821 rootH2_1001182116 317
69 3300003322 rootL2_10077722 rootL2_100777222 317
70 3300003323 rootH1_10010049 rootH1_1001004935 317
71 3300003323 rootH1_10013865 rootH1_1001386523 317
72 3300003323 rootH1_10024619 rootH1_100246195 317
73 3300003323 rootH1_10063766 rootH1_100637661 317
74 3300003771 Ga0055526_1008824 Ga0055526_10088244 317
75 3300003781 Ga0055536_1009842 Ga0055536_10098423 317
76 3300003790 Ga0055528_1000438 Ga0055528_100043815 317
77 3300003791 Ga0055530_10000718 Ga0055530_1000071817 317
78 3300003791 Ga0055530_10023873 Ga0055530_100238731 317
79 3300003794 Ga0055531_10030756 Ga0055531_100307562 317
80 3300005262 Ga0065165_1000022 Ga0065165_1000022125 317
81 3300005262 Ga0065165_1000057 Ga0065165_100005765 317
82 3300005262 Ga0065165_1000546 Ga0065165_100054638 317
83 3300005262 Ga0065165_1026372 Ga0065165_10263722 317
84 3300005295 Ga0065707_10012772 Ga0065707_100127722 317
85 3300005327 Ga0070658_10008114 Ga0070658_100081141 317
86 3300005330 Ga0070690_100004422 Ga0070690_1000044222 317
87 3300005330 Ga0070690_100032941 Ga0070690_1000329415 317
88 3300005331 Ga0070670_100170958 Ga0070670_1001709582 317
89 3300005334 Ga0068869_100006911 Ga0068869_1000069117 317
90 3300005335 Ga0070666_10000566 Ga0070666_1000056616 317
91 3300005338 Ga0068868_100004867 Ga0068868_10000486711 317
92 3300005338 Ga0068868_100178682 Ga0068868_1001786821 317
93 3300005339 Ga0070660_100010709 Ga0070660_1000107095 317
94 3300005340 Ga0070689_100266831 Ga0070689_1002668311 317
95 3300005343 Ga0070687_100030069 Ga0070687_1000300692 317
96 3300005344 Ga0070661_100016113 Ga0070661_1000161135 317
97 3300005355 Ga0070671_100071094 Ga0070671_1000710942 317
98 3300005355 Ga0070671_100073255 Ga0070671_1000732553 317
99 3300005356 Ga0070674_100021240 Ga0070674_1000212403 317
100 3300005364 Ga0070673_100050785 Ga0070673_1000507852 317
101 3300005366 Ga0070659_100003429 Ga0070659_1000034297 317
102 3300005367 Ga0070667_100029068 Ga0070667_1000290682 317
103 3300005367 Ga0070667_100140099 Ga0070667_1001400991 317
104 3300005439 Ga0070711_100096574 Ga0070711_1000965741 317
105 3300005439 Ga0070711_100097312 Ga0070711_1000973122 317
106 3300005445 Ga0070708_100007060 Ga0070708_1000070607 317
107 3300005457 Ga0070662_100004871 Ga0070662_1000048712 317
108 3300005458 Ga0070681_10039885 Ga0070681_100398853 317
109 3300005459 Ga0068867_100071358 Ga0068867_1000713582 317
110 3300005518 Ga0070699_100003062 Ga0070699_10000306215 317
111 3300005530 Ga0070679_100052735 Ga0070679_1000527353 317
112 3300005530 Ga0070679_100147628 Ga0070679_1001476282 317
113 3300005539 Ga0068853_100023700 Ga0068853_1000237004 317
114 3300005543 Ga0070672_100087898 Ga0070672_1000878982 317
115 3300005544 Ga0070686_100068074 Ga0070686_1000680741 317
116 3300005545 Ga0070695_100220832 Ga0070695_1002208322 317
117 3300005547 Ga0070693_100205517 Ga0070693_1002055171 317
118 3300005548 Ga0070665_100002455 Ga0070665_1000024558 317
119 3300005563 Ga0068855_100011479 Ga0068855_1000114798 317
120 3300005564 Ga0070664_100010490 Ga0070664_1000104904 317
121 3300005564 Ga0070664_100161149 Ga0070664_1001611492 317
122 3300005577 Ga0068857_100007104 Ga0068857_1000071043 317
123 3300005578 Ga0068854_100067313 Ga0068854_1000673132 317
124 3300005578 Ga0068854_100388764 Ga0068854_1003887641 317
125 3300005614 Ga0068856_100089492 Ga0068856_1000894923 317
126 3300005615 Ga0070702_100122903 Ga0070702_1001229031 317
127 3300005616 Ga0068852_100001989 Ga0068852_1000019898 317
128 3300005617 Ga0068859_100000026 Ga0068859_10000002685 317
129 3300005617 Ga0068859_100062716 Ga0068859_1000627162 317
130 3300005617 Ga0068859_100155877 Ga0068859_1001558772 317
131 3300005618 Ga0068864_100012129 Ga0068864_1000121299 317
132 3300005834 Ga0068851_10085457 Ga0068851_100854572 317
133 3300005841 Ga0068863_100004512 Ga0068863_1000045124 317
134 3300005842 Ga0068858_100005551 Ga0068858_1000055519 317
135 3300005843 Ga0068860_100007533 Ga0068860_1000075333 317
136 3300005843 Ga0068860_100012563 Ga0068860_10001256310 317
137 3300005843 Ga0068860_100018785 Ga0068860_1000187852 317
138 3300005843 Ga0068860_100439552 Ga0068860_1004395521 317
139 3300005985 Ga0081539_10001707 Ga0081539_1000170729 317
140 3300006058 Ga0075432_10006198 Ga0075432_100061982 317
141 3300006163 Ga0070715_10080369 Ga0070715_100803691 317
142 3300006175 Ga0070712_100215681 Ga0070712_1002156813 317
143 3300006237 Ga0097621_100002699 Ga0097621_1000026995 317
144 3300006237 Ga0097621_100007256 Ga0097621_1000072568 317
145 3300006358 Ga0068871_100190113 Ga0068871_1001901132 317
146 3300006358 Ga0068871_100331170 Ga0068871_1003311701 317
147 3300006358 Ga0068871_100333492 Ga0068871_1003334921 317
148 3300006846 Ga0075430_100160578 Ga0075430_1001605781 317
149 3300006852 Ga0075433_10037498 Ga0075433_100374983 317
150 3300006881 Ga0068865_100034383 Ga0068865_1000343834 317
151 3300006881 Ga0068865_100067135 Ga0068865_1000671353 317
152 3300006931 Ga0097620_100000026 Ga0097620_10000002685 317
153 3300006931 Ga0097620_100062713 Ga0097620_1000627132 317
154 3300006931 Ga0097620_100155883 Ga0097620_1001558832 317
155 3300007076 Ga0075435_100013925 Ga0075435_1000139256 317
156 3300009093 Ga0105240_10292883 Ga0105240_102928831 317
157 3300009094 Ga0111539_10002180 Ga0111539_1000218017 317
158 3300009094 Ga0111539_10024467 Ga0111539_100244677 317
159 3300009094 Ga0111539_10332114 Ga0111539_103321142 317
160 3300009098 Ga0105245_10156768 Ga0105245_101567683 317
161 3300009147 Ga0114129_10033181 Ga0114129_100331814 317
162 3300009147 Ga0114129_10703590 Ga0114129_107035901 317
163 3300009174 Ga0105241_10002748 Ga0105241_100027486 317
164 3300009174 Ga0105241_10070064 Ga0105241_100700642 317
165 3300009176 Ga0105242_10156137 Ga0105242_101561372 317
166 3300009176 Ga0105242_10362207 Ga0105242_103622071 317
167 3300009545 Ga0105237_10011985 Ga0105237_100119855 317
168 3300009545 Ga0105237_10510257 Ga0105237_105102572 317
169 3300009553 Ga0105249_10013311 Ga0105249_100133116 317
170 3300010375 Ga0105239_10051482 Ga0105239_100514821 317
171 3300010375 Ga0105239_10192255 Ga0105239_101922552 317
172 3300010375 Ga0105239_10297766 Ga0105239_102977662 317
173 3300011119 Ga0105246_10014353 Ga0105246_100143532 317
174 3300011119 Ga0105246_10081316 Ga0105246_100813162 317
175 3300013102 Ga0157371_10039795 Ga0157371_100397952 317
176 3300013102 Ga0157371_10073567 Ga0157371_100735672 317
177 3300013104 Ga0157370_10025007 Ga0157370_100250071 317
178 3300013104 Ga0157370_10039722 Ga0157370_100397221 317
179 3300013105 Ga0157369_10036358 Ga0157369_100363581 317
180 3300013296 Ga0157374_10122132 Ga0157374_101221323 317
181 3300013297 Ga0157378_10007165 Ga0157378_100071655 317
182 3300013297 Ga0157378_10007361 Ga0157378_100073617 317
183 3300013297 Ga0157378_10009835 Ga0157378_100098353 317
184 3300013297 Ga0157378_10070977 Ga0157378_100709771 317
185 3300013297 Ga0157378_10075484 Ga0157378_100754842 317
186 3300013297 Ga0157378_10571883 Ga0157378_105718831 317
187 3300013306 Ga0163162_10001684 Ga0163162_1000168410 317
188 3300013306 Ga0163162_10011640 Ga0163162_100116402 317
189 3300013306 Ga0163162_10087131 Ga0163162_100871311 317
190 3300013306 Ga0163162_10353225 Ga0163162_103532252 317
191 3300013307 Ga0157372_10066577 Ga0157372_100665771 317
192 3300013308 Ga0157375_10150433 Ga0157375_101504334 317
193 3300013308 Ga0157375_10277460 Ga0157375_102774602 317
194 3300014325 Ga0163163_10114536 Ga0163163_101145362 317
195 3300014325 Ga0163163_10156852 Ga0163163_101568523 317
196 3300014326 Ga0157380_10475755 Ga0157380_104757551 317
197 3300014968 Ga0157379_10046875 Ga0157379_100468753 317
198 3300014968 Ga0157379_10237953 Ga0157379_102379531 317
199 3300014968 Ga0157379_10298415 Ga0157379_102984151 317
200 3300014969 Ga0157376_10000005 Ga0157376_10000005308 317
201 3300014969 Ga0157376_10000716 Ga0157376_100007165 317
202 3300014969 Ga0157376_10019987 Ga0157376_100199872 317
203 3300014969 Ga0157376_10048810 Ga0157376_100488103 317
204 3300025246 Ga0209646_1000009 Ga0209646_10000091 317
205 3300025250 Ga0209026_1000188 Ga0209026_10001881 317
206 3300025273 Ga0209673_1000287 Ga0209673_100028738 317
207 3300025292 Ga0209676_1000448 Ga0209676_100044832 317
208 3300025295 Ga0209564_1003883 Ga0209564_10038836 317
209 3300025295 Ga0209564_1015025 Ga0209564_10150253 317
210 3300025297 Ga0209758_1002873 Ga0209758_10028735 317
211 3300025297 Ga0209758_1010704 Ga0209758_10107042 317
212 3300025297 Ga0209758_1010911 Ga0209758_10109112 317
213 3300025298 Ga0209050_1000755 Ga0209050_100075520 317
214 3300025298 Ga0209050_1011585 Ga0209050_10115853 317
215 3300025298 Ga0209050_1030860 Ga0209050_10308602 317
216 3300025302 Ga0207426_1000203 Ga0207426_1000203112 317
217 3300025302 Ga0207426_1000846 Ga0207426_10008469 317
218 3300025302 Ga0207426_1007479 Ga0207426_10074794 317
219 3300025303 Ga0209051_1012234 Ga0209051_10122343 317
220 3300025304 Ga0209257_1001979 Ga0209257_100197918 317
221 3300025321 Ga0207656_10022937 Ga0207656_100229372 317
222 3300025900 Ga0207710_10002388 Ga0207710_100023884 317
223 3300025901 Ga0207688_10011112 Ga0207688_100111124 317
224 3300025903 Ga0207680_10000145 Ga0207680_1000014515 317
225 3300025903 Ga0207680_10177232 Ga0207680_101772322 317
226 3300025909 Ga0207705_10034172 Ga0207705_100341722 317
227 3300025911 Ga0207654_10001951 Ga0207654_100019516 317
228 3300025913 Ga0207695_10262626 Ga0207695_102626263 317
229 3300025914 Ga0207671_10004079 Ga0207671_100040799 317
230 3300025916 Ga0207663_10095045 Ga0207663_100950452 317
231 3300025918 Ga0207662_10132772 Ga0207662_101327722 317
232 3300025919 Ga0207657_10019184 Ga0207657_100191844 317
233 3300025920 Ga0207649_10017941 Ga0207649_100179412 317
234 3300025921 Ga0207652_10445204 Ga0207652_104452041 317
235 3300025924 Ga0207694_10073577 Ga0207694_100735772 317
236 3300025925 Ga0207650_10023863 Ga0207650_100238634 317
237 3300025926 Ga0207659_10199174 Ga0207659_101991741 317
238 3300025931 Ga0207644_10221980 Ga0207644_102219801 317
239 3300025933 Ga0207706_10010912 Ga0207706_100109125 317
240 3300025937 Ga0207669_10011919 Ga0207669_100119193 317
241 3300025940 Ga0207691_10032332 Ga0207691_100323325 317
242 3300025942 Ga0207689_10012838 Ga0207689_100128383 317
243 3300025944 Ga0207661_10014132 Ga0207661_100141321 317
244 3300025945 Ga0207679_10045552 Ga0207679_100455523 317
245 3300025945 Ga0207679_10268681 Ga0207679_102686811 317
246 3300025961 Ga0207712_10019418 Ga0207712_100194185 317
247 3300025986 Ga0207658_10048441 Ga0207658_100484413 317
248 3300025986 Ga0207658_10117072 Ga0207658_101170721 317
249 3300026023 Ga0207677_10019871 Ga0207677_100198714 317
250 3300026035 Ga0207703_10008892 Ga0207703_100088926 317
251 3300026075 Ga0207708_10140899 Ga0207708_101408993 317
252 3300026078 Ga0207702_10125274 Ga0207702_101252741 317
253 3300026088 Ga0207641_10000155 Ga0207641_1000015526 317
254 3300026088 Ga0207641_10012580 Ga0207641_100125805 317
255 3300026095 Ga0207676_10126213 Ga0207676_101262131 317
256 3300026116 Ga0207674_10032699 Ga0207674_100326993 317
257 3300026121 Ga0207683_10015542 Ga0207683_100155423 317
258 3300026142 Ga0207698_10060679 Ga0207698_100606792 317
259 3300026142 Ga0207698_10241747 Ga0207698_102417472 317
260 3300027907 Ga0207428_10042666 Ga0207428_100426662 317
261 3300028379 Ga0268266_10000299 Ga0268266_1000029920 317
262 3300028381 Ga0268264_10006893 Ga0268264_100068932 317
263 3300028381 Ga0268264_10007633 Ga0268264_100076339 317
264 3300028381 Ga0268264_10009357 Ga0268264_100093571 317
265 3300028381 Ga0268264_10601102 Ga0268264_106011021 317
266 3300028794 Ga0307515_10000009 Ga0307515_1000000987 317
267 3300028794 Ga0307515_10050320 Ga0307515_100503203 317
268 3300031251 Ga0265327_10062848 Ga0265327_100628482 317
269 3300031456 Ga0307513_10171857 Ga0307513_101718572 317
270 3300031548 Ga0307408_100156766 Ga0307408_1001567662 317
271 3300031691 Ga0316579_10033271 Ga0316579_100332712 317
272 3300031691 Ga0316579_10035231 Ga0316579_100352311 317
273 3300031733 Ga0316577_10054503 Ga0316577_100545032 317
274 3300032002 Ga0307416_100012888 Ga0307416_1000128884 317
275 3300032004 Ga0307414_10316800 Ga0307414_103168001 317
276 3300035398 Ga0316574_0065937 Ga0316574_0065937_882_1853 317
277 3300035691 Ga0373931_0077354 Ga0373931_0077354_594_1565 317
278 3300036401 Ga0373937_0160030 Ga0373937_0160030_833_1804 317
279 3300036647 Ga0316582_0108977 Ga0316582_0108977_716_1687 317
280 3300037068 Ga0373925_0114755 Ga0373925_0114755_845_1816 317
281 3300037471 Ga0395905_0219886 Ga0395905_0219886_692_1663 317
282 3300037588 Ga0316581_0011455 Ga0316581_0011455_1357_2328 317
283 3300041407 Ga0439447_000641 Ga0439447_000641_7926_8921 317
284 3300041411 Ga0439466_0000549 Ga0439466_0000549_7926_8921 317
285 3300041413 Ga0439465_0012132 Ga0439465_0012132_406_1401 317
286 3300042006 Ga0439432_000133 Ga0439432_000133_17414_18409 317
287 3300042009 Ga0439451_000049 Ga0439451_000049_17412_18407 317
288 3300042010 Ga0439452_000926 Ga0439452_000926_4362_5357 317
289 3300042013 Ga0439456_000420 Ga0439456_000420_4090_5085 317
290 3300042016 Ga0439463_000364 Ga0439463_000364_5565_6560 317
291 3300042115 Ga0450911_000482 Ga0450911_000482_10566_11561 317
292 3300042121 Ga0450919_000010 Ga0450919_000010_6707_7702 317
293 3300042124 Ga0450922_000184 Ga0450922_000184_50_1045 317
294 3300042127 Ga0450890_000288 Ga0450890_000288_5576_6571 317
295 3300042138 Ga0450903_000276 Ga0450903_000276_6123_7118 317
296 3300042145 Ga0450906_001114 Ga0450906_001114_1171_2166 317
297 3300042146 Ga0450907_000204 Ga0450907_000204_4090_5085 317
298 3300042156 Ga0439446_0000083 Ga0439446_0000083_10081_11076 317
299 3300042184 Ga0450908_000120 Ga0450908_000120_8906_9901 317
300 3300042185 Ga0450909_000038 Ga0450909_000038_898_1893 317
301 3300042435 Ga0439434_0004435 Ga0439434_0004435_999_1994 317
302 3300042439 Ga0439464_0003661 Ga0439464_0003661_1634_2629 317
303 3300042461 Ga0439460_0000346 Ga0439460_0000346_4577_5572 317
304 3300044712 Ga0453684_0022387 Ga0453684_0022387_7691_8662 317
305 3300044712 Ga0453684_0022516 Ga0453684_0022516_7807_8778 317
306 3300044712 Ga0453684_0379730 Ga0453684_0379730_570_1541 317
307 3300045051 Ga0451576_0015721 Ga0451576_0015721_5276_6247 317
308 3300045051 Ga0451576_0104783 Ga0451576_0104783_1340_2311 317
309 3300046454 Ga0495592_0244436 Ga0495592_0244436_18_989 317
310 3300046455 Ga0495603_0018948 Ga0495603_0018948_3055_4026 317
311 3300046455 Ga0495603_0061696 Ga0495603_0061696_1167_2138 317
312 3300046459 Ga0495629_0056118 Ga0495629_0056118_1410_2381 317
313 3300046460 Ga0495638_0000040 Ga0495638_0000040_188301_189272 317
314 3300046461 Ga0495641_0114052 Ga0495641_0114052_82_1053 317
315 3300046472 Ga0495580_0001866 Ga0495580_0001866_8141_9172 317
316 3300046472 Ga0495580_0014378 Ga0495580_0014378_2578_3549 317
317 3300046472 Ga0495580_0016112 Ga0495580_0016112_904_1875 317
318 3300046473 Ga0495582_0001408 Ga0495582_0001408_2203_3234 317
319 3300046492 Ga0495585_0001954 Ga0495585_0001954_5974_6969 317
320 3300046499 Ga0495594_0011693 Ga0495594_0011693_1753_2724 317
321 3300046514 Ga0495618_0105229 Ga0495618_0105229_671_1642 317
322 3300046517 Ga0495630_0032803 Ga0495630_0032803_299_1270 317
323 3300046533 Ga0495640_0015177 Ga0495640_0015177_2452_3423 317
324 3300046535 Ga0495586_0049520 Ga0495586_0049520_144_1115 317
325 3300046689 Ga0495613_0032479 Ga0495613_0032479_2566_3537 317
326 3300047315 Ga0495581_0041506 Ga0495581_0041506_1097_2068 317
327 3300047319 Ga0495674_0055100 Ga0495674_0055100_619_1590 317
328 3300047471 Ga0495684_0203835 Ga0495684_0203835_466_1437 317
329 3300048089 Ga0495614_0057358 Ga0495614_0057358_49_1020 317
330 3300048903 Ga0496100_0095784 Ga0496100_0095784_574_1560 317
331 3300048907 Ga0496104_0168121 Ga0496104_0168121_842_1828 317
332 3300048907 Ga0496104_0583842 Ga0496104_0583842_44_1015 317
333 3300048908 Ga0496105_0085918 Ga0496105_0085918_929_1915 317
334 3300048909 Ga0496106_0152236 Ga0496106_0152236_170_1156 317
335 3300048910 Ga0496107_0063758 Ga0496107_0063758_206_1192 317
336 3300048917 Ga0496114_0030933 Ga0496114_0030933_171_1157 317
337 3300048918 Ga0496115_0015305 Ga0496115_0015305_168_1139 317
338 3300048918 Ga0496115_0080221 Ga0496115_0080221_1481_2452 317
339 3300048918 Ga0496115_0101913 Ga0496115_0101913_557_1543 317
340 3300049570 Ga0501033_0050560 Ga0501033_0050560_1160_2131 317
341 3300049571 Ga0501034_0001340 Ga0501034_0001340_5304_6275 317
342 3300049571 Ga0501034_0002231 Ga0501034_0002231_18402_19373 317
343 3300049571 Ga0501034_0120845 Ga0501034_0120845_1490_2461 317
344 3300049572 Ga0501036_0059509 Ga0501036_0059509_1050_2021 317
345 3300049573 Ga0501037_0053647 Ga0501037_0053647_1300_2271 317
346 3300049579 Ga0501043_0011632 Ga0501043_0011632_2636_3607 317
347 3300049579 Ga0501043_0032048 Ga0501043_0032048_218_1189 317
348 3300049579 Ga0501043_0117387 Ga0501043_0117387_931_1902 317
349 3300049580 Ga0501046_0109212 Ga0501046_0109212_701_1672 317
350 3300049686 Ga0501257_004249 Ga0501257_004249_2005_2976 317
351 3300049822 Ga0501035_0031413 Ga0501035_0031413_461_1432 317
352 3300049823 Ga0501044_0001323 Ga0501044_0001323_23065_24036 317
353 3300050507 nmdc:mga05p37_93931_c1 nmdc:mga05p37_93931_c1_2069_3040 317
354 3300050513 nmdc:mga0rr50_23340_c1 nmdc:mga0rr50_23340_c1_2542_3513 317
355 3300050515 nmdc:mga0a205_67431_c1 nmdc:mga0a205_67431_c1_49_1020 317
356 3300053077 Ga0495601_0184227 Ga0495601_0184227_211_1197 317
357 3300053078 Ga0495612_0096512 Ga0495612_0096512_23_994 317
358 3300053085 Ga0495619_0181381 Ga0495619_0181381_454_1440 317
359 3300053086 Ga0500578_0111518 Ga0500578_0111518_232_1203 317
360 3300053131 Ga0500652_025953 Ga0500652_025953_903_1874 317
361 3300053133 Ga0500655_001520 Ga0500655_001520_2145_3116 317
362 3300053151 Ga0500604_0000716 Ga0500604_0000716_4263_5234 317
363 3300053153 Ga0500616_0000013 Ga0500616_0000013_124864_125835 317
364 3300053153 Ga0500616_0010701 Ga0500616_0010701_1616_2587 317
365 3300053156 Ga0500622_0000009 Ga0500622_0000009_247169_248140 317
366 3300053156 Ga0500622_0000016 Ga0500622_0000016_252863_253834 317
367 3300053158 Ga0500627_0008663 Ga0500627_0008663_1258_2229 317

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

65

363

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4xap-assembly1.cif.gz_A crystal structure of aldo-keto reductase from sinorhizobium meliloti 1021 0.8489 4 313
6ow0-assembly2.cif.gz_B crystal structure of mithramycin 3-side chain keto-reductase mtmw in complex with nad+ and peg 0.8457 1 306
3v0t-assembly1.cif.gz_A crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.8413 1 305
1lqa-assembly1.cif.gz_A tas protein from escherichia coli in complex with nadph 0.839 1 306
7utf-assembly1.cif.gz_A structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.8386 1 306
ID Description Score Start End Superfamily
1ynpB01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8532 1 307 3.20.20.100
af_A0A0R0FWW7_5_106_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8519 3 82 3.20.20.100
af_O14295_4_331_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8506 9 306 3.20.20.100
4xapA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8489 4 313 3.20.20.100
1ynpB01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8449 1 307 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A0F9IUQ6-F1-model_v4 NADP-dependent oxidoreductase domain-containing protein 0.9925 52 206
AF-A0A1H7IDF7-F1-model_v4 Predicted oxidoreductase 0.9868 1 317 GO:0016491
AF-A0A6L9J5N2-F1-model_v4 Aldo/keto reductase 0.9859 1 276
AF-A0A3A0CEY4-F1-model_v4 Aldo/keto reductase 0.984 29 317
AF-A0A1H7IDF7-F1-model_v4 Predicted oxidoreductase 0.9837 1 317 GO:0016491

Feature Viewer

pLDDT pTM Quality
91.52 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map