F424388

General Info

Members Datasets Scaffolds Average Seq Length
367 223 358 276

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10110333|Ga0265338_101103333
Length 315
Sequence MPHQPGRLASRRRIQIRPPMNRPRLGTNFGEKQRVTPSSQLTFTLLVGLGSLVGGFLGALTGLGGGVVIVPMLTLLFGIDIRYAIGASLVSVIATSSGAAAAYVREGYSNIRIGMFLEIATTLGALVGAWLAGIAPTHLIAIIFGLVLLFSAISSLRHPADRPGPEKPDRIAERLRLDSTYPSPNGPVKYHVTGVIPGFVLMHLAGILSGLLGIGSGAIKVLAMDQAMRLPFKVSTTTSNFMIGVTAAASAGIYLNRGYVDPGLAMPVMLGVLIGATAGARLLAGAKVRILRLVFGLVILALGIEMIYSGWTEKL

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2617270889 Nostoc punctiforme PCC 73102 Isolate Unclassified
3 2831426010 Nostoc sp. 106C Isolate Unclassified
4 2848694841 Nostoc sp. RF31YmG Isolate Unclassified
5 2849660919 Nostoc sp. T09 Isolate Unclassified
6 2886627955 Nostoc sp. PA-18-2419 JC1668 Isolate Unclassified
7 2913912277 Desmonostoc muscorum LEGE 12446 Isolate Unclassified
8 2913939268 Nostoc sp. LEGE 12447 Isolate Unclassified
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
96 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
97 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
98 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
99 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
100 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
148 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
149 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
152 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
153 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
154 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
155 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
156 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
157 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
158 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
159 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
160 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
161 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
162 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
163 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
164 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
165 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
166 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
167 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
168 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
169 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
170 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
171 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
173 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
174 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
175 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
176 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
177 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
178 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
179 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
180 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
181 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
182 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
183 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
184 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
185 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
186 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
187 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
188 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
189 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
190 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
191 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
192 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
193 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
194 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
195 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
196 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
197 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
198 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
199 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
200 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
201 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
202 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
203 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
204 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
210 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
211 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
212 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
214 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
215 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
216 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
217 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
218 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
219 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
220 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
221 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
222 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
223 642555144 Nostoc punctiforme PCC 73102 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97
Metatranscriptomes 0.54
Isolates 2.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.54
Nodule 0
Rhizoplane 5.72
Rhizosphere 89.37
Stem 0
Stem Tuber 0
Unclassified 4.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_2134205 2162886011 Bacteria 1054
2 rootH2_10060361 3300003320 Bacteria 22290
3 Ga0065712_10090419 3300005290 Bacteria 2405
4 Ga0065715_10133730 3300005293 Bacteria 1967
5 Ga0065715_10200326 3300005293 Bacteria 1365
6 Ga0065715_10258630 3300005293 Unclassified 1145
7 Ga0070658_10505478 3300005327 Bacteria 1044
8 Ga0070676_10015069 3300005328 Bacteria 4260
9 Ga0070683_100086273 3300005329 Bacteria 2943
10 Ga0070683_100183594 3300005329 Bacteria 1986
11 Ga0070666_10055277 3300005335 Bacteria 2679
12 Ga0070682_100020565 3300005337 Bacteria 3885
13 Ga0068868_100013662 3300005338 Bacteria 5963
14 Ga0068868_100112442 3300005338 Bacteria 2214
15 Ga0070660_100027548 3300005339 Bacteria 4242
16 Ga0070689_100046668 3300005340 Bacteria 3338
17 Ga0070691_10028477 3300005341 Bacteria 2611
18 Ga0070661_100021395 3300005344 Bacteria 4618
19 Ga0070661_100146856 3300005344 Bacteria 1781
20 Ga0070668_100009924 3300005347 Bacteria 7052
21 Ga0070671_100147722 3300005355 Bacteria 1985
22 Ga0070673_100450428 3300005364 Bacteria 1158
23 Ga0070659_100008550 3300005366 Bacteria 7482
24 Ga0070659_100054951 3300005366 Bacteria 3137
25 Ga0070667_100007050 3300005367 Bacteria 9345
26 Ga0070667_100063024 3300005367 Bacteria 3141
27 Ga0070709_10202754 3300005434 Bacteria 1406
28 Ga0070710_10183320 3300005437 Bacteria 1312
29 Ga0070711_100004405 3300005439 Bacteria 8307
30 Ga0070711_100043221 3300005439 Unclassified 3051
31 Ga0070705_100017510 3300005440 Bacteria 3741
32 Ga0070694_100146856 3300005444 Bacteria 1718
33 Ga0070708_100000932 3300005445 Bacteria 22137
34 Ga0070708_100004601 3300005445 Bacteria 10862
35 Ga0070708_100073162 3300005445 Unclassified 3089
36 Ga0070708_100353029 3300005445 Bacteria 1386
37 Ga0070708_100591474 3300005445 Bacteria 1046
38 Ga0070663_100020796 3300005455 Bacteria 4350
39 Ga0070662_100005192 3300005457 Bacteria 8309
40 Ga0068867_100011467 3300005459 Bacteria 6255
41 Ga0070706_100001716 3300005467 Bacteria 22776
42 Ga0070706_100043486 3300005467 Bacteria 4151
43 Ga0070706_100137027 3300005467 Bacteria 2285
44 Ga0070707_100003339 3300005468 Bacteria 15156
45 Ga0070707_100077288 3300005468 Unclassified 3212
46 Ga0070698_100000941 3300005471 Bacteria 31848
47 Ga0070699_100088665 3300005518 Unclassified 2702
48 Ga0070679_100123785 3300005530 Bacteria 2569
49 Ga0070684_100017001 3300005535 Bacteria 5960
50 Ga0070697_100000739 3300005536 Bacteria 24386
51 Ga0070697_100026037 3300005536 Bacteria 4667
52 Ga0070697_100048098 3300005536 Bacteria 3458
53 Ga0068853_100013101 3300005539 Bacteria 6765
54 Ga0068853_100096163 3300005539 Bacteria 2613
55 Ga0070665_100012938 3300005548 Bacteria 8403
56 Ga0070665_100106732 3300005548 Bacteria 2803
57 Ga0070665_100349188 3300005548 Bacteria 1485
58 Ga0068855_100016229 3300005563 Bacteria 8956
59 Ga0070664_100023284 3300005564 Bacteria 5115
60 Ga0070664_100169046 3300005564 Bacteria 1939
61 Ga0068857_100022628 3300005577 Bacteria 5528
62 Ga0068854_100344847 3300005578 Bacteria 1217
63 Ga0068856_100011231 3300005614 Bacteria 8693
64 Ga0068856_100026960 3300005614 Bacteria 5605
65 Ga0068852_100179605 3300005616 Bacteria 1989
66 Ga0068852_100534908 3300005616 Bacteria 1171
67 Ga0068859_100079744 3300005617 Bacteria 3314
68 Ga0068864_100047773 3300005618 Bacteria 3678
69 Ga0068861_100186659 3300005719 Bacteria 1730
70 Ga0068851_10045181 3300005834 Bacteria 2225
71 Ga0068863_100556601 3300005841 Bacteria 1133
72 Ga0068860_100002912 3300005843 Bacteria 17733
73 Ga0068860_100010483 3300005843 Bacteria 9160
74 Ga0068860_100307155 3300005843 Bacteria 1555
75 Ga0068862_100024412 3300005844 Bacteria 5073
76 Ga0070717_10171021 3300006028 Bacteria 1890
77 Ga0070717_10280524 3300006028 Bacteria 1478
78 Ga0070716_100160935 3300006173 Bacteria 1454
79 Ga0070712_100000167 3300006175 Bacteria 35889
80 Ga0097621_100008525 3300006237 Bacteria 7382
81 Ga0097621_100018537 3300006237 Bacteria 5320
82 Ga0097621_100316214 3300006237 Bacteria 1382
83 Ga0068871_100003384 3300006358 Bacteria 10964
84 Ga0068871_100007853 3300006358 Bacteria 7647
85 Ga0075430_100291794 3300006846 Unclassified 1349
86 Ga0075433_10016444 3300006852 Bacteria 6099
87 Ga0075434_100000063 3300006871 Bacteria 55215
88 Ga0075434_100030297 3300006871 Bacteria 5327
89 Ga0075434_100082184 3300006871 Bacteria 3219
90 Ga0068865_100012489 3300006881 Bacteria 5346
91 Ga0075436_100027532 3300006914 Bacteria 3911
92 Ga0097620_100079747 3300006931 Bacteria 3314
93 Ga0075435_100001228 3300007076 Bacteria 16420
94 Ga0075435_100175542 3300007076 Bacteria 1809
95 Ga0099794_10014729 3300007265 Bacteria 3433
96 Ga0099794_10111012 3300007265 Unclassified 1374
97 Ga0105240_10043898 3300009093 Bacteria 5685
98 Ga0105240_10044179 3300009093 Bacteria 5665
99 Ga0105240_10055130 3300009093 Bacteria 4978
100 Ga0105240_10070830 3300009093 Bacteria 4312
101 Ga0111539_10017480 3300009094 Bacteria 8879
102 Ga0105245_10003427 3300009098 Bacteria 14208
103 Ga0105245_10396342 3300009098 Bacteria 1378
104 Ga0105245_10403191 3300009098 Bacteria 1367
105 Ga0105247_10019234 3300009101 Bacteria 4099
106 Ga0114129_10086409 3300009147 Unclassified 4350
107 Ga0114129_10242904 3300009147 Bacteria 2420
108 Ga0114129_10379840 3300009147 Bacteria 1866
109 Ga0105241_10002566 3300009174 Bacteria 13638
110 Ga0105241_10006823 3300009174 Bacteria 8395
111 Ga0105242_10025178 3300009176 Bacteria 4705
112 Ga0105242_10211559 3300009176 Bacteria 1728
113 Ga0105242_10627391 3300009176 Bacteria 1042
114 Ga0105248_10006914 3300009177 Bacteria 12434
115 Ga0105248_10018486 3300009177 Bacteria 7704
116 Ga0105248_10155391 3300009177 Bacteria 2581
117 Ga0105248_10236419 3300009177 Bacteria 2057
118 Ga0105248_10316986 3300009177 Bacteria 1756
119 Ga0105237_10149998 3300009545 Unclassified 2327
120 Ga0105237_10242347 3300009545 Unclassified 1804
121 Ga0105238_10054468 3300009551 Bacteria 4016
122 Ga0105238_10058134 3300009551 Bacteria 3877
123 Ga0105238_10459367 3300009551 Bacteria 1271
124 Ga0105249_10020982 3300009553 Bacteria 5845
125 Ga0105249_10950254 3300009553 Bacteria 927
126 Ga0105239_10000468 3300010375 Bacteria 59019
127 Ga0105239_10063784 3300010375 Bacteria 4045
128 Ga0105239_10218945 3300010375 Bacteria 2135
129 Ga0105239_10249093 3300010375 Bacteria 1995
130 Ga0157373_10338145 3300013100 Bacteria 1073
131 Ga0157371_10026459 3300013102 Bacteria 4217
132 Ga0157371_10136652 3300013102 Bacteria 1746
133 Ga0157370_10011298 3300013104 Bacteria 9358
134 Ga0157369_10027935 3300013105 Bacteria 6248
135 Ga0157374_10027754 3300013296 Bacteria 5111
136 Ga0157374_10043278 3300013296 Bacteria 4159
137 Ga0157378_10000399 3300013297 Bacteria 42664
138 Ga0157378_10005707 3300013297 Bacteria 10892
139 Ga0157378_10022978 3300013297 Bacteria 5489
140 Ga0157378_10089861 3300013297 Bacteria 2791
141 Ga0163162_10002812 3300013306 Bacteria 16555
142 Ga0163162_10019485 3300013306 Bacteria 6656
143 Ga0163162_10126002 3300013306 Bacteria 2667
144 Ga0163162_10150112 3300013306 Bacteria 2448
145 Ga0157372_10005712 3300013307 Bacteria 13244
146 Ga0157372_10031591 3300013307 Bacteria 5798
147 Ga0157372_10049021 3300013307 Bacteria 4695
148 Ga0157372_10470824 3300013307 Bacteria 1464
149 Ga0157375_10038024 3300013308 Bacteria 4618
150 Ga0163163_10068683 3300014325 Bacteria 3526
151 Ga0163163_10560143 3300014325 Bacteria 1206
152 Ga0157379_10006256 3300014968 Bacteria 10251
153 Ga0157376_10012198 3300014969 Bacteria 6370
154 Ga0182006_1011999 3300015261 Unclassified 3795
155 Ga0213872_10014684 3300021361 Bacteria 3650
156 Ga0213874_10039836 3300021377 Bacteria 1401
157 Ga0213871_10005289 3300021441 Bacteria 2649
158 Ga0228598_1001020 3300024227 Bacteria 6143
159 Ga0207656_10090405 3300025321 Bacteria 1389
160 Ga0207642_10034796 3300025899 Bacteria 2145
161 Ga0207680_10006123 3300025903 Bacteria 5798
162 Ga0207680_10064585 3300025903 Bacteria 2245
163 Ga0207647_10019913 3300025904 Bacteria 4505
164 Ga0207647_10079010 3300025904 Bacteria 1975
165 Ga0207699_10156920 3300025906 Bacteria 1511
166 Ga0207699_10160481 3300025906 Bacteria 1496
167 Ga0207684_10002108 3300025910 Bacteria 20390
168 Ga0207684_10023034 3300025910 Bacteria 5319
169 Ga0207684_10135339 3300025910 Bacteria 2116
170 Ga0207654_10008450 3300025911 Bacteria 5206
171 Ga0207695_10059626 3300025913 Bacteria 3956
172 Ga0207695_10077686 3300025913 Bacteria 3370
173 Ga0207695_10328228 3300025913 Bacteria 1419
174 Ga0207671_10149398 3300025914 Bacteria 1805
175 Ga0207693_10000467 3300025915 Bacteria 36905
176 Ga0207663_10036270 3300025916 Bacteria 2965
177 Ga0207663_10124916 3300025916 Unclassified 1768
178 Ga0207660_10024406 3300025917 Bacteria 4094
179 Ga0207657_10002394 3300025919 Bacteria 20283
180 Ga0207657_10004552 3300025919 Bacteria 14655
181 Ga0207649_10021612 3300025920 Bacteria 3707
182 Ga0207652_10123248 3300025921 Bacteria 2308
183 Ga0207652_10195192 3300025921 Bacteria 1821
184 Ga0207652_10436680 3300025921 Bacteria 1180
185 Ga0207646_10004471 3300025922 Bacteria 15154
186 Ga0207646_10240795 3300025922 Bacteria 1634
187 Ga0207694_10029380 3300025924 Bacteria 4194
188 Ga0207687_10008053 3300025927 Bacteria 6895
189 Ga0207687_10119480 3300025927 Unclassified 1969
190 Ga0207700_10070600 3300025928 Bacteria 2686
191 Ga0207664_10053564 3300025929 Bacteria 3195
192 Ga0207690_10086486 3300025932 Bacteria 2203
193 Ga0207706_10000973 3300025933 Bacteria 29233
194 Ga0207706_10038786 3300025933 Bacteria 4225
195 Ga0207686_10063787 3300025934 Bacteria 2344
196 Ga0207686_10070412 3300025934 Bacteria 2247
197 Ga0207686_10203333 3300025934 Bacteria 1420
198 Ga0207670_10253347 3300025936 Bacteria 1361
199 Ga0207704_10023740 3300025938 Bacteria 3311
200 Ga0207704_10076375 3300025938 Bacteria 2146
201 Ga0207665_10011885 3300025939 Bacteria 5716
202 Ga0207665_10101435 3300025939 Bacteria 2010
203 Ga0207711_10014317 3300025941 Bacteria 6587
204 Ga0207711_10107284 3300025941 Bacteria 2479
205 Ga0207711_10285678 3300025941 Bacteria 1520
206 Ga0207661_10016360 3300025944 Bacteria 5471
207 Ga0207661_10188458 3300025944 Bacteria 1807
208 Ga0207661_10189342 3300025944 Bacteria 1803
209 Ga0207679_10654833 3300025945 Bacteria 950
210 Ga0207667_10014547 3300025949 Bacteria 8964
211 Ga0207712_10003681 3300025961 Bacteria 9667
212 Ga0207668_10022548 3300025972 Bacteria 4033
213 Ga0207640_10005830 3300025981 Bacteria 6717
214 Ga0207658_10068066 3300025986 Bacteria 2685
215 Ga0207658_10074100 3300025986 Bacteria 2586
216 Ga0207658_10160628 3300025986 Bacteria 1841
217 Ga0207677_10070157 3300026023 Bacteria 2468
218 Ga0207703_10227887 3300026035 Bacteria 1669
219 Ga0207678_10002113 3300026067 Bacteria 17991
220 Ga0207678_10300352 3300026067 Bacteria 1380
221 Ga0207708_10156258 3300026075 Bacteria 1799
222 Ga0207702_10006145 3300026078 Bacteria 10397
223 Ga0207702_10220218 3300026078 Bacteria 1768
224 Ga0207648_10050734 3300026089 Bacteria 3627
225 Ga0207674_10040757 3300026116 Bacteria 4808
226 Ga0207674_10141061 3300026116 Bacteria 2369
227 Ga0207698_10022003 3300026142 Bacteria 4421
228 Ga0209588_1005673 3300027671 Bacteria 3587
229 Ga0209588_1007590 3300027671 Bacteria 3195
230 Ga0207428_10059270 3300027907 Bacteria 3035
231 Ga0268266_10029264 3300028379 Bacteria 4683
232 Ga0268266_10078076 3300028379 Bacteria 2880
233 Ga0268266_10132703 3300028379 Unclassified 2229
234 Ga0268265_10110583 3300028380 Bacteria 2242
235 Ga0268264_10042139 3300028381 Bacteria 3778
236 Ga0268264_10185582 3300028381 Bacteria 1892
237 Ga0268264_10279111 3300028381 Bacteria 1564
238 Ga0265319_1067854 3300028563 Bacteria 1146
239 Ga0265338_10020998 3300028800 Bacteria 6831
240 Ga0265338_10110333 3300028800 Bacteria 2218
241 Ga0265762_1000130 3300030760 Bacteria 11334
242 Ga0265760_10008865 3300031090 Unclassified 2874
243 Ga0265330_10054052 3300031235 Bacteria 1756
244 Ga0265332_10000162 3300031238 Bacteria 54127
245 Ga0265332_10013532 3300031238 Bacteria 3615
246 Ga0265325_10007497 3300031241 Bacteria 6522
247 Ga0265325_10009784 3300031241 Bacteria 5584
248 Ga0265325_10016110 3300031241 Bacteria 4182
249 Ga0265329_10022854 3300031242 Bacteria 2088
250 Ga0265340_10003511 3300031247 Bacteria 8821
251 Ga0265340_10165159 3300031247 Bacteria 1004
252 Ga0265339_10003417 3300031249 Bacteria 11101
253 Ga0265339_10032320 3300031249 Bacteria 2952
254 Ga0265331_10000034 3300031250 Bacteria 200155
255 Ga0265331_10009215 3300031250 Bacteria 5563
256 Ga0265331_10020932 3300031250 Unclassified 3352
257 Ga0265327_10023870 3300031251 Bacteria 3607
258 Ga0265316_10001333 3300031344 Bacteria 26547
259 Ga0265316_10010122 3300031344 Bacteria 8611
260 Ga0265316_10013489 3300031344 Bacteria 7252
261 Ga0265316_10016481 3300031344 Bacteria 6407
262 Ga0265316_10028805 3300031344 Bacteria 4576
263 Ga0265313_10012652 3300031595 Bacteria 5130
264 Ga0265314_10000883 3300031711 Bacteria 35735
265 Ga0265314_10000897 3300031711 Bacteria 35446
266 Ga0265314_10006083 3300031711 Bacteria 10723
267 Ga0265314_10048966 3300031711 Unclassified 2961
268 Ga0265314_10081863 3300031711 Bacteria 2125
269 Ga0265342_10079801 3300031712 Bacteria 1892
270 Ga0316578_10046179 3300031728 Unclassified 2538
271 Ga0373932_0013239 3300035112 Bacteria 2047
272 Ga0373942_0046556 3300035207 Bacteria 1202
273 Ga0373962_0007833 3300035242 Bacteria 2622
274 Ga0373931_0122172 3300035691 Bacteria 1489
275 Ga0373935_0273826 3300035692 Bacteria 1187
276 Ga0373927_0056773 3300035695 Bacteria 2532
277 Ga0316582_0068748 3300036647 Bacteria 2288
278 Ga0373925_0020765 3300037068 Bacteria 4785
279 Ga0436364_0833529 3300037853 Bacteria 5918
280 Ga0395901_0228801 3300038443 Unclassified 1942
281 Ga0395901_0230895 3300038443 Bacteria 1932
282 Ga0237819_04032 3300038705 Bacteria 2485
283 Ga0436365_1649783 3300039437 Bacteria 2381
284 Ga0436365_1865014 3300039437 Unclassified 2518
285 Ga0436360_0801171 3300039438 Bacteria 2534
286 Ga0436360_1062696 3300039438 Bacteria 4433
287 Ga0436360_1141634 3300039438 Bacteria 2699
288 Ga0436360_1346941 3300039438 Bacteria 1999
289 Ga0436361_0068400 3300039447 Bacteria 2501
290 Ga0436361_0619996 3300039447 Bacteria 1505
291 Ga0466966_0278675 3300044684 Bacteria 1006
292 Ga0466971_0003554 3300044719 Bacteria 6661
293 Ga0466959_0028114 3300045049 Bacteria 4170
294 Ga0451576_0419618 3300045051 Unclassified 1404
295 Ga0466967_0157976 3300045976 Bacteria 2126
296 Ga0495629_0025153 3300046459 Bacteria 4235
297 Ga0495580_0000249 3300046472 Bacteria 42609
298 Ga0495580_0017662 3300046472 Bacteria 5329
299 Ga0495580_0071109 3300046472 Unclassified 2430
300 Ga0495580_0212585 3300046472 Bacteria 1330
301 Ga0495582_0012561 3300046473 Bacteria 4668
302 Ga0495652_0357544 3300046529 Bacteria 1044
303 Ga0495645_0017215 3300046543 Bacteria 5177
304 Ga0495667_0321107 3300046559 Bacteria 980
305 Ga0495674_0121246 3300047319 Bacteria 2208
306 Ga0495684_0087961 3300047471 Unclassified 2355
307 Ga0496100_0015179 3300048903 Bacteria 4494
308 Ga0496100_0373419 3300048903 Bacteria 1082
309 Ga0496102_0000641 3300048905 Bacteria 35434
310 Ga0496102_0169224 3300048905 Bacteria 2057
311 Ga0496103_0014547 3300048906 Bacteria 4672
312 Ga0496103_0171931 3300048906 Bacteria 1391
313 Ga0496104_0016683 3300048907 Bacteria 6675
314 Ga0496104_0055599 3300048907 Bacteria 3743
315 Ga0496104_0074825 3300048907 Bacteria 3224
316 Ga0496106_0048604 3300048909 Bacteria 3195
317 Ga0496106_0053161 3300048909 Bacteria 3058
318 Ga0496107_0033033 3300048910 Bacteria 3701
319 Ga0496107_0142251 3300048910 Bacteria 1773
320 Ga0496107_0160165 3300048910 Bacteria 1668
321 Ga0496108_0046247 3300048911 Bacteria 3636
322 Ga0496108_0338393 3300048911 Bacteria 1313
323 Ga0496110_0011617 3300048913 Bacteria 7219
324 Ga0496111_0016848 3300048914 Bacteria 5043
325 Ga0496112_0100618 3300048915 Bacteria 2860
326 Ga0496114_0069907 3300048917 Bacteria 2948
327 Ga0496115_0026250 3300048918 Bacteria 4544
328 Ga0496126_0237370 3300048929 Bacteria 1525
329 Ga0501033_0248528 3300049570 Bacteria 1261
330 Ga0501034_0005190 3300049571 Bacteria 14289
331 Ga0501037_0128510 3300049573 Unclassified 1818
332 Ga0501043_0125329 3300049579 Bacteria 2014
333 Ga0501043_0231844 3300049579 Bacteria 1426
334 Ga0501047_0323226 3300049581 Unclassified 1382
335 Ga0501070_0008900 3300049586 Bacteria 8486
336 Ga0501070_0152089 3300049586 Unclassified 1909
337 Ga0501073_0272437 3300049589 Unclassified 1168
338 Ga0501083_0327013 3300049744 Bacteria 997
339 Ga0501035_0056093 3300049822 Unclassified 3517
340 Ga0501044_0000385 3300049823 Bacteria 54901
341 Ga0501044_0002734 3300049823 Bacteria 20061
342 Ga0501044_0018143 3300049823 Bacteria 7546
343 Ga0501044_0027904 3300049823 Bacteria 5959
344 Ga0501044_0440161 3300049823 Bacteria 1211
345 nmdc:mga05p37_402746_c1 3300050507 Bacteria 1597
346 nmdc:mga05p37_432122_c1 3300050507 Bacteria 1529
347 nmdc:mga0qj67_189244_c1 3300050509 Unclassified 1672
348 nmdc:mga08y16_10478_c1 3300050511 Bacteria 9724
349 nmdc:mga0n895_104478_c1 3300050512 Bacteria 2845
350 nmdc:mga0n895_229763_c1 3300050512 Bacteria 1883
351 nmdc:mga0n895_5686_c1 3300050512 Bacteria 10453
352 nmdc:mga0rr50_233515_c1 3300050513 Bacteria 1522
353 nmdc:mga0rr50_793_c1 3300050513 Bacteria 17040
354 nmdc:mga0a205_207920_c1 3300050515 Bacteria 1846
355 nmdc:mga0a205_6699_c1 3300050515 Bacteria 10422
356 Ga0500590_103774 3300053148 Bacteria 1361
357 Ga0500622_0001188 3300053156 Bacteria 21489
358 Ga0466962_0088684 3300061719 Bacteria 1481

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006871 Ga0075434_100082184 Ga0075434_1000821842 252
2 3300007076 Ga0075435_100175542 Ga0075435_1001755422 252
3 3300050512 nmdc:mga0n895_229763_c1 nmdc:mga0n895_229763_c1_390_1226 252
4 3300050515 nmdc:mga0a205_207920_c1 nmdc:mga0a205_207920_c1_505_1341 252
5 3300006881 Ga0068865_100012489 Ga0068865_1000124893 254
6 3300009176 Ga0105242_10627391 Ga0105242_106273912 254
7 3300025934 Ga0207686_10063787 Ga0207686_100637873 254
8 3300025938 Ga0207704_10023740 Ga0207704_100237402 254
9 3300031728 Ga0316578_10046179 Ga0316578_100461792 256
10 3300005548 Ga0070665_100012938 Ga0070665_1000129383 258
11 3300028379 Ga0268266_10078076 Ga0268266_100780763 258
12 3300031247 Ga0265340_10165159 Ga0265340_101651591 259
13 3300031344 Ga0265316_10016481 Ga0265316_100164816 259
14 3300031711 Ga0265314_10006083 Ga0265314_100060835 259
15 3300045976 Ga0466967_0157976 Ga0466967_0157976_558_1394 259
16 3300005445 Ga0070708_100591474 Ga0070708_1005914741 261
17 3300031238 Ga0265332_10013532 Ga0265332_100135323 261
18 3300031249 Ga0265339_10003417 Ga0265339_100034175 261
19 3300031250 Ga0265331_10009215 Ga0265331_100092152 261
20 3300031711 Ga0265314_10000897 Ga0265314_1000089711 261
21 3300039438 Ga0436360_0801171 Ga0436360_0801171_784_1623 261
22 3300049579 Ga0501043_0231844 Ga0501043_0231844_206_1099 262
23 3300049823 Ga0501044_0027904 Ga0501044_0027904_3817_4710 262
24 3300006846 Ga0075430_100291794 Ga0075430_1002917942 263
25 3300021361 Ga0213872_10014684 Ga0213872_100146844 263
26 3300021441 Ga0213871_10005289 Ga0213871_100052893 263
27 3300039438 Ga0436360_1062696 Ga0436360_1062696_1831_2670 263
28 3300039438 Ga0436360_1346941 Ga0436360_1346941_932_1771 263
29 3300039447 Ga0436361_0068400 Ga0436361_0068400_439_1278 263
30 3300050509 nmdc:mga0qj67_189244_c1 nmdc:mga0qj67_189244_c1_653_1489 263
31 3300031238 Ga0265332_10000162 Ga0265332_1000016243 264
32 3300031242 Ga0265329_10022854 Ga0265329_100228544 264
33 3300031250 Ga0265331_10000034 Ga0265331_1000003413 264
34 3300031344 Ga0265316_10001333 Ga0265316_1000133320 264
35 3300031711 Ga0265314_10000883 Ga0265314_1000088324 264
36 3300039447 Ga0436361_0619996 Ga0436361_0619996_463_1302 264
37 3300006028 Ga0070717_10171021 Ga0070717_101710211 265
38 3300025928 Ga0207700_10070600 Ga0207700_100706002 265
39 3300044684 Ga0466966_0278675 Ga0466966_0278675_21_857 265
40 3300044719 Ga0466971_0003554 Ga0466971_0003554_82_918 265
41 3300045049 Ga0466959_0028114 Ga0466959_0028114_245_1081 265
42 3300061719 Ga0466962_0088684 Ga0466962_0088684_635_1471 265
43 3300038443 Ga0395901_0230895 Ga0395901_0230895_71_907 266
44 3300005445 Ga0070708_100353029 Ga0070708_1003530292 269
45 3300025922 Ga0207646_10240795 Ga0207646_102407952 269
46 3300005445 Ga0070708_100073162 Ga0070708_1000731623 270
47 3300031344 Ga0265316_10013489 Ga0265316_100134892 270
48 3300005293 Ga0065715_10258630 Ga0065715_102586302 271
49 3300038443 Ga0395901_0228801 Ga0395901_0228801_721_1554 271
50 3300038705 Ga0237819_04032 Ga0237819_04032_1339_2175 271
51 3300049570 Ga0501033_0248528 Ga0501033_0248528_47_886 272
52 3300049571 Ga0501034_0005190 Ga0501034_0005190_9396_10235 272
53 3300049573 Ga0501037_0128510 Ga0501037_0128510_817_1656 272
54 3300049579 Ga0501043_0125329 Ga0501043_0125329_90_929 272
55 3300049586 Ga0501070_0152089 Ga0501070_0152089_289_1128 272
56 3300049823 Ga0501044_0018143 Ga0501044_0018143_984_1823 272
57 3300025921 Ga0207652_10436680 Ga0207652_104366801 273
58 iso_pu_bacteria 2913939268 2913942199 273
59 3300005445 Ga0070708_100000932 Ga0070708_10000093214 274
60 3300005467 Ga0070706_100001716 Ga0070706_10000171620 274
61 3300005518 Ga0070699_100088665 Ga0070699_1000886654 274
62 3300005536 Ga0070697_100000739 Ga0070697_1000007393 274
63 3300045051 Ga0451576_0419618 Ga0451576_0419618_177_1001 274
64 iso_pu_bacteria 2617270889 2617913507 274
65 iso_pu_bacteria 2831426010 2831433101 274
66 iso_pu_bacteria 2848694841 2848698396 274
67 iso_pu_bacteria 2849660919 2849661557 274
68 iso_pu_bacteria 2886627955 2886630133 274
69 iso_pu_bacteria 2886627955 2886634407 274
70 iso_pu_bacteria 2913912277 2913915378 274
71 iso_pu_bacteria 642555144 642602143 274
72 3300006028 Ga0070717_10280524 Ga0070717_102805242 275
73 3300007265 Ga0099794_10014729 Ga0099794_100147293 275
74 3300007265 Ga0099794_10111012 Ga0099794_101110122 275
75 3300025921 Ga0207652_10195192 Ga0207652_101951921 275
76 3300025929 Ga0207664_10053564 Ga0207664_100535643 275
77 3300027671 Ga0209588_1005673 Ga0209588_10056733 275
78 3300047471 Ga0495684_0087961 Ga0495684_0087961_1014_1841 275
79 3300005327 Ga0070658_10505478 Ga0070658_105054781 277
80 3300005329 Ga0070683_100086273 Ga0070683_1000862732 277
81 3300005564 Ga0070664_100023284 Ga0070664_1000232848 277
82 3300013104 Ga0157370_10011298 Ga0157370_100112984 277
83 3300025944 Ga0207661_10188458 Ga0207661_101884582 277
84 3300037853 Ga0436364_0833529 Ga0436364_0833529_608_1441 277
85 3300046529 Ga0495652_0357544 Ga0495652_0357544_180_1016 277
86 2162886011 MRS1b_contig_2134205 MRS1b_0282.00002030 278
87 3300003320 rootH2_10060361 rootH2_100603613 278
88 3300005290 Ga0065712_10090419 Ga0065712_100904193 278
89 3300005293 Ga0065715_10133730 Ga0065715_101337302 278
90 3300005293 Ga0065715_10200326 Ga0065715_102003262 278
91 3300005328 Ga0070676_10015069 Ga0070676_100150692 278
92 3300005329 Ga0070683_100183594 Ga0070683_1001835941 278
93 3300005335 Ga0070666_10055277 Ga0070666_100552772 278
94 3300005337 Ga0070682_100020565 Ga0070682_1000205651 278
95 3300005338 Ga0068868_100013662 Ga0068868_1000136623 278
96 3300005338 Ga0068868_100112442 Ga0068868_1001124422 278
97 3300005339 Ga0070660_100027548 Ga0070660_1000275485 278
98 3300005340 Ga0070689_100046668 Ga0070689_1000466683 278
99 3300005341 Ga0070691_10028477 Ga0070691_100284772 278
100 3300005344 Ga0070661_100021395 Ga0070661_1000213953 278
101 3300005344 Ga0070661_100146856 Ga0070661_1001468562 278
102 3300005347 Ga0070668_100009924 Ga0070668_1000099244 278
103 3300005355 Ga0070671_100147722 Ga0070671_1001477223 278
104 3300005364 Ga0070673_100450428 Ga0070673_1004504281 278
105 3300005366 Ga0070659_100008550 Ga0070659_1000085504 278
106 3300005366 Ga0070659_100054951 Ga0070659_1000549513 278
107 3300005367 Ga0070667_100007050 Ga0070667_1000070507 278
108 3300005367 Ga0070667_100063024 Ga0070667_1000630244 278
109 3300005434 Ga0070709_10202754 Ga0070709_102027542 278
110 3300005437 Ga0070710_10183320 Ga0070710_101833201 278
111 3300005439 Ga0070711_100004405 Ga0070711_1000044058 278
112 3300005439 Ga0070711_100043221 Ga0070711_1000432213 278
113 3300005440 Ga0070705_100017510 Ga0070705_1000175103 278
114 3300005444 Ga0070694_100146856 Ga0070694_1001468562 278
115 3300005445 Ga0070708_100004601 Ga0070708_1000046013 278
116 3300005455 Ga0070663_100020796 Ga0070663_1000207963 278
117 3300005457 Ga0070662_100005192 Ga0070662_1000051922 278
118 3300005459 Ga0068867_100011467 Ga0068867_1000114673 278
119 3300005467 Ga0070706_100043486 Ga0070706_1000434865 278
120 3300005467 Ga0070706_100137027 Ga0070706_1001370273 278
121 3300005468 Ga0070707_100003339 Ga0070707_1000033396 278
122 3300005468 Ga0070707_100077288 Ga0070707_1000772882 278
123 3300005471 Ga0070698_100000941 Ga0070698_10000094113 278
124 3300005530 Ga0070679_100123785 Ga0070679_1001237852 278
125 3300005535 Ga0070684_100017001 Ga0070684_1000170013 278
126 3300005536 Ga0070697_100026037 Ga0070697_1000260372 278
127 3300005536 Ga0070697_100048098 Ga0070697_1000480982 278
128 3300005539 Ga0068853_100013101 Ga0068853_1000131015 278
129 3300005539 Ga0068853_100096163 Ga0068853_1000961632 278
130 3300005548 Ga0070665_100106732 Ga0070665_1001067323 278
131 3300005548 Ga0070665_100349188 Ga0070665_1003491882 278
132 3300005563 Ga0068855_100016229 Ga0068855_1000162296 278
133 3300005564 Ga0070664_100169046 Ga0070664_1001690463 278
134 3300005577 Ga0068857_100022628 Ga0068857_1000226286 278
135 3300005578 Ga0068854_100344847 Ga0068854_1003448472 278
136 3300005614 Ga0068856_100011231 Ga0068856_1000112315 278
137 3300005614 Ga0068856_100026960 Ga0068856_1000269602 278
138 3300005616 Ga0068852_100179605 Ga0068852_1001796053 278
139 3300005616 Ga0068852_100534908 Ga0068852_1005349082 278
140 3300005617 Ga0068859_100079744 Ga0068859_1000797443 278
141 3300005618 Ga0068864_100047773 Ga0068864_1000477733 278
142 3300005719 Ga0068861_100186659 Ga0068861_1001866592 278
143 3300005834 Ga0068851_10045181 Ga0068851_100451811 278
144 3300005841 Ga0068863_100556601 Ga0068863_1005566011 278
145 3300005843 Ga0068860_100002912 Ga0068860_10000291210 278
146 3300005843 Ga0068860_100010483 Ga0068860_1000104834 278
147 3300005843 Ga0068860_100307155 Ga0068860_1003071552 278
148 3300005844 Ga0068862_100024412 Ga0068862_1000244123 278
149 3300006173 Ga0070716_100160935 Ga0070716_1001609352 278
150 3300006175 Ga0070712_100000167 Ga0070712_10000016713 278
151 3300006237 Ga0097621_100008525 Ga0097621_1000085253 278
152 3300006237 Ga0097621_100018537 Ga0097621_1000185372 278
153 3300006237 Ga0097621_100316214 Ga0097621_1003162142 278
154 3300006358 Ga0068871_100003384 Ga0068871_1000033846 278
155 3300006358 Ga0068871_100007853 Ga0068871_1000078533 278
156 3300006852 Ga0075433_10016444 Ga0075433_100164444 278
157 3300006871 Ga0075434_100000063 Ga0075434_10000006360 278
158 3300006871 Ga0075434_100030297 Ga0075434_1000302974 278
159 3300006914 Ga0075436_100027532 Ga0075436_1000275325 278
160 3300006931 Ga0097620_100079747 Ga0097620_1000797472 278
161 3300007076 Ga0075435_100001228 Ga0075435_10000122812 278
162 3300009093 Ga0105240_10043898 Ga0105240_100438983 278
163 3300009093 Ga0105240_10044179 Ga0105240_100441794 278
164 3300009093 Ga0105240_10055130 Ga0105240_100551302 278
165 3300009093 Ga0105240_10070830 Ga0105240_100708305 278
166 3300009094 Ga0111539_10017480 Ga0111539_100174806 278
167 3300009098 Ga0105245_10003427 Ga0105245_100034278 278
168 3300009098 Ga0105245_10396342 Ga0105245_103963422 278
169 3300009098 Ga0105245_10403191 Ga0105245_104031912 278
170 3300009101 Ga0105247_10019234 Ga0105247_100192342 278
171 3300009147 Ga0114129_10086409 Ga0114129_100864092 278
172 3300009147 Ga0114129_10242904 Ga0114129_102429042 278
173 3300009147 Ga0114129_10379840 Ga0114129_103798401 278
174 3300009174 Ga0105241_10002566 Ga0105241_100025665 278
175 3300009174 Ga0105241_10006823 Ga0105241_100068234 278
176 3300009176 Ga0105242_10025178 Ga0105242_100251783 278
177 3300009176 Ga0105242_10211559 Ga0105242_102115592 278
178 3300009177 Ga0105248_10006914 Ga0105248_100069145 278
179 3300009177 Ga0105248_10018486 Ga0105248_100184869 278
180 3300009177 Ga0105248_10155391 Ga0105248_101553912 278
181 3300009177 Ga0105248_10236419 Ga0105248_102364192 278
182 3300009177 Ga0105248_10316986 Ga0105248_103169863 278
183 3300009545 Ga0105237_10149998 Ga0105237_101499982 278
184 3300009545 Ga0105237_10242347 Ga0105237_102423472 278
185 3300009551 Ga0105238_10054468 Ga0105238_100544683 278
186 3300009551 Ga0105238_10058134 Ga0105238_100581343 278
187 3300009551 Ga0105238_10459367 Ga0105238_104593672 278
188 3300009553 Ga0105249_10020982 Ga0105249_100209826 278
189 3300009553 Ga0105249_10950254 Ga0105249_109502541 278
190 3300010375 Ga0105239_10000468 Ga0105239_1000046819 278
191 3300010375 Ga0105239_10063784 Ga0105239_100637844 278
192 3300010375 Ga0105239_10218945 Ga0105239_102189452 278
193 3300010375 Ga0105239_10249093 Ga0105239_102490933 278
194 3300013100 Ga0157373_10338145 Ga0157373_103381452 278
195 3300013102 Ga0157371_10026459 Ga0157371_100264594 278
196 3300013102 Ga0157371_10136652 Ga0157371_101366522 278
197 3300013105 Ga0157369_10027935 Ga0157369_100279353 278
198 3300013296 Ga0157374_10027754 Ga0157374_100277542 278
199 3300013296 Ga0157374_10043278 Ga0157374_100432782 278
200 3300013297 Ga0157378_10000399 Ga0157378_100003998 278
201 3300013297 Ga0157378_10005707 Ga0157378_100057071 278
202 3300013297 Ga0157378_10022978 Ga0157378_100229783 278
203 3300013297 Ga0157378_10089861 Ga0157378_100898613 278
204 3300013306 Ga0163162_10002812 Ga0163162_1000281210 278
205 3300013306 Ga0163162_10019485 Ga0163162_100194853 278
206 3300013306 Ga0163162_10126002 Ga0163162_101260023 278
207 3300013306 Ga0163162_10150112 Ga0163162_101501123 278
208 3300013307 Ga0157372_10005712 Ga0157372_100057122 278
209 3300013307 Ga0157372_10031591 Ga0157372_100315912 278
210 3300013307 Ga0157372_10049021 Ga0157372_100490214 278
211 3300013307 Ga0157372_10470824 Ga0157372_104708242 278
212 3300013308 Ga0157375_10038024 Ga0157375_100380243 278
213 3300014325 Ga0163163_10068683 Ga0163163_100686833 278
214 3300014325 Ga0163163_10560143 Ga0163163_105601432 278
215 3300014968 Ga0157379_10006256 Ga0157379_100062563 278
216 3300014969 Ga0157376_10012198 Ga0157376_100121985 278
217 3300015261 Ga0182006_1011999 Ga0182006_10119994 278
218 3300021377 Ga0213874_10039836 Ga0213874_100398361 278
219 3300024227 Ga0228598_1001020 Ga0228598_10010206 278
220 3300025321 Ga0207656_10090405 Ga0207656_100904051 278
221 3300025899 Ga0207642_10034796 Ga0207642_100347962 278
222 3300025903 Ga0207680_10006123 Ga0207680_100061235 278
223 3300025903 Ga0207680_10064585 Ga0207680_100645852 278
224 3300025904 Ga0207647_10019913 Ga0207647_100199133 278
225 3300025904 Ga0207647_10079010 Ga0207647_100790102 278
226 3300025906 Ga0207699_10156920 Ga0207699_101569201 278
227 3300025906 Ga0207699_10160481 Ga0207699_101604812 278
228 3300025910 Ga0207684_10002108 Ga0207684_1000210813 278
229 3300025910 Ga0207684_10023034 Ga0207684_100230345 278
230 3300025910 Ga0207684_10135339 Ga0207684_101353392 278
231 3300025911 Ga0207654_10008450 Ga0207654_100084505 278
232 3300025913 Ga0207695_10059626 Ga0207695_100596263 278
233 3300025913 Ga0207695_10077686 Ga0207695_100776864 278
234 3300025913 Ga0207695_10328228 Ga0207695_103282282 278
235 3300025914 Ga0207671_10149398 Ga0207671_101493981 278
236 3300025915 Ga0207693_10000467 Ga0207693_1000046723 278
237 3300025916 Ga0207663_10036270 Ga0207663_100362702 278
238 3300025916 Ga0207663_10124916 Ga0207663_101249162 278
239 3300025917 Ga0207660_10024406 Ga0207660_100244062 278
240 3300025919 Ga0207657_10002394 Ga0207657_1000239410 278
241 3300025919 Ga0207657_10004552 Ga0207657_100045527 278
242 3300025920 Ga0207649_10021612 Ga0207649_100216122 278
243 3300025921 Ga0207652_10123248 Ga0207652_101232483 278
244 3300025922 Ga0207646_10004471 Ga0207646_100044714 278
245 3300025924 Ga0207694_10029380 Ga0207694_100293803 278
246 3300025927 Ga0207687_10008053 Ga0207687_100080534 278
247 3300025927 Ga0207687_10119480 Ga0207687_101194802 278
248 3300025932 Ga0207690_10086486 Ga0207690_100864863 278
249 3300025933 Ga0207706_10000973 Ga0207706_100009739 278
250 3300025933 Ga0207706_10038786 Ga0207706_100387863 278
251 3300025934 Ga0207686_10070412 Ga0207686_100704123 278
252 3300025934 Ga0207686_10203333 Ga0207686_102033332 278
253 3300025936 Ga0207670_10253347 Ga0207670_102533472 278
254 3300025938 Ga0207704_10076375 Ga0207704_100763752 278
255 3300025939 Ga0207665_10011885 Ga0207665_100118853 278
256 3300025939 Ga0207665_10101435 Ga0207665_101014352 278
257 3300025941 Ga0207711_10014317 Ga0207711_100143173 278
258 3300025941 Ga0207711_10107284 Ga0207711_101072842 278
259 3300025941 Ga0207711_10285678 Ga0207711_102856781 278
260 3300025944 Ga0207661_10016360 Ga0207661_100163603 278
261 3300025944 Ga0207661_10189342 Ga0207661_101893421 278
262 3300025945 Ga0207679_10654833 Ga0207679_106548331 278
263 3300025949 Ga0207667_10014547 Ga0207667_100145475 278
264 3300025961 Ga0207712_10003681 Ga0207712_100036813 278
265 3300025972 Ga0207668_10022548 Ga0207668_100225483 278
266 3300025981 Ga0207640_10005830 Ga0207640_100058303 278
267 3300025986 Ga0207658_10068066 Ga0207658_100680661 278
268 3300025986 Ga0207658_10074100 Ga0207658_100741002 278
269 3300025986 Ga0207658_10160628 Ga0207658_101606282 278
270 3300026023 Ga0207677_10070157 Ga0207677_100701572 278
271 3300026035 Ga0207703_10227887 Ga0207703_102278872 278
272 3300026067 Ga0207678_10002113 Ga0207678_100021136 278
273 3300026067 Ga0207678_10300352 Ga0207678_103003522 278
274 3300026075 Ga0207708_10156258 Ga0207708_101562582 278
275 3300026078 Ga0207702_10006145 Ga0207702_100061455 278
276 3300026078 Ga0207702_10220218 Ga0207702_102202182 278
277 3300026089 Ga0207648_10050734 Ga0207648_100507341 278
278 3300026116 Ga0207674_10040757 Ga0207674_100407575 278
279 3300026116 Ga0207674_10141061 Ga0207674_101410611 278
280 3300026142 Ga0207698_10022003 Ga0207698_100220032 278
281 3300027671 Ga0209588_1007590 Ga0209588_10075902 278
282 3300027907 Ga0207428_10059270 Ga0207428_100592702 278
283 3300028379 Ga0268266_10029264 Ga0268266_100292643 278
284 3300028379 Ga0268266_10132703 Ga0268266_101327032 278
285 3300028380 Ga0268265_10110583 Ga0268265_101105831 278
286 3300028381 Ga0268264_10042139 Ga0268264_100421393 278
287 3300028381 Ga0268264_10185582 Ga0268264_101855823 278
288 3300028381 Ga0268264_10279111 Ga0268264_102791111 278
289 3300028563 Ga0265319_1067854 Ga0265319_10678542 278
290 3300028800 Ga0265338_10020998 Ga0265338_100209987 278
291 3300028800 Ga0265338_10110333 Ga0265338_101103333 278
292 3300030760 Ga0265762_1000130 Ga0265762_10001308 278
293 3300031090 Ga0265760_10008865 Ga0265760_100088653 278
294 3300031235 Ga0265330_10054052 Ga0265330_100540522 278
295 3300031241 Ga0265325_10007497 Ga0265325_100074972 278
296 3300031241 Ga0265325_10009784 Ga0265325_100097845 278
297 3300031241 Ga0265325_10016110 Ga0265325_100161103 278
298 3300031247 Ga0265340_10003511 Ga0265340_100035114 278
299 3300031249 Ga0265339_10032320 Ga0265339_100323203 278
300 3300031250 Ga0265331_10020932 Ga0265331_100209323 278
301 3300031251 Ga0265327_10023870 Ga0265327_100238705 278
302 3300031344 Ga0265316_10010122 Ga0265316_100101226 278
303 3300031344 Ga0265316_10028805 Ga0265316_100288056 278
304 3300031595 Ga0265313_10012652 Ga0265313_100126523 278
305 3300031711 Ga0265314_10048966 Ga0265314_100489662 278
306 3300031711 Ga0265314_10081863 Ga0265314_100818631 278
307 3300031712 Ga0265342_10079801 Ga0265342_100798012 278
308 3300035112 Ga0373932_0013239 Ga0373932_0013239_1108_1944 278
309 3300035207 Ga0373942_0046556 Ga0373942_0046556_349_1185 278
310 3300035242 Ga0373962_0007833 Ga0373962_0007833_344_1180 278
311 3300035691 Ga0373931_0122172 Ga0373931_0122172_350_1186 278
312 3300035692 Ga0373935_0273826 Ga0373935_0273826_91_930 278
313 3300035695 Ga0373927_0056773 Ga0373927_0056773_838_1674 278
314 3300036647 Ga0316582_0068748 Ga0316582_0068748_1015_1851 278
315 3300037068 Ga0373925_0020765 Ga0373925_0020765_2066_2902 278
316 3300039437 Ga0436365_1649783 Ga0436365_1649783_1262_2098 278
317 3300039437 Ga0436365_1865014 Ga0436365_1865014_747_1583 278
318 3300039438 Ga0436360_1141634 Ga0436360_1141634_907_1746 278
319 3300046459 Ga0495629_0025153 Ga0495629_0025153_39_875 278
320 3300046472 Ga0495580_0000249 Ga0495580_0000249_1916_2752 278
321 3300046472 Ga0495580_0017662 Ga0495580_0017662_197_1057 278
322 3300046472 Ga0495580_0071109 Ga0495580_0071109_178_1029 278
323 3300046472 Ga0495580_0212585 Ga0495580_0212585_378_1214 278
324 3300046473 Ga0495582_0012561 Ga0495582_0012561_2333_3169 278
325 3300046543 Ga0495645_0017215 Ga0495645_0017215_1580_2416 278
326 3300046559 Ga0495667_0321107 Ga0495667_0321107_126_962 278
327 3300047319 Ga0495674_0121246 Ga0495674_0121246_260_1096 278
328 3300048903 Ga0496100_0015179 Ga0496100_0015179_1206_2042 278
329 3300048903 Ga0496100_0373419 Ga0496100_0373419_106_942 278
330 3300048905 Ga0496102_0000641 Ga0496102_0000641_17877_18713 278
331 3300048905 Ga0496102_0169224 Ga0496102_0169224_1189_2025 278
332 3300048906 Ga0496103_0014547 Ga0496103_0014547_1787_2623 278
333 3300048906 Ga0496103_0171931 Ga0496103_0171931_523_1359 278
334 3300048907 Ga0496104_0016683 Ga0496104_0016683_615_1451 278
335 3300048907 Ga0496104_0055599 Ga0496104_0055599_1503_2339 278
336 3300048907 Ga0496104_0074825 Ga0496104_0074825_1410_2246 278
337 3300048909 Ga0496106_0048604 Ga0496106_0048604_432_1268 278
338 3300048909 Ga0496106_0053161 Ga0496106_0053161_269_1105 278
339 3300048910 Ga0496107_0033033 Ga0496107_0033033_826_1662 278
340 3300048910 Ga0496107_0142251 Ga0496107_0142251_636_1472 278
341 3300048910 Ga0496107_0160165 Ga0496107_0160165_433_1269 278
342 3300048911 Ga0496108_0046247 Ga0496108_0046247_1833_2669 278
343 3300048911 Ga0496108_0338393 Ga0496108_0338393_94_930 278
344 3300048913 Ga0496110_0011617 Ga0496110_0011617_5241_6077 278
345 3300048914 Ga0496111_0016848 Ga0496111_0016848_2717_3553 278
346 3300048915 Ga0496112_0100618 Ga0496112_0100618_1798_2634 278
347 3300048917 Ga0496114_0069907 Ga0496114_0069907_38_874 278
348 3300048918 Ga0496115_0026250 Ga0496115_0026250_1582_2418 278
349 3300048929 Ga0496126_0237370 Ga0496126_0237370_608_1447 278
350 3300049581 Ga0501047_0323226 Ga0501047_0323226_434_1279 278
351 3300049586 Ga0501070_0008900 Ga0501070_0008900_6282_7127 278
352 3300049589 Ga0501073_0272437 Ga0501073_0272437_232_1077 278
353 3300049744 Ga0501083_0327013 Ga0501083_0327013_29_865 278
354 3300049822 Ga0501035_0056093 Ga0501035_0056093_1938_2783 278
355 3300049823 Ga0501044_0000385 Ga0501044_0000385_2228_3073 278
356 3300049823 Ga0501044_0002734 Ga0501044_0002734_18217_19062 278
357 3300049823 Ga0501044_0440161 Ga0501044_0440161_312_1157 278
358 3300050507 nmdc:mga05p37_402746_c1 nmdc:mga05p37_402746_c1_469_1305 278
359 3300050507 nmdc:mga05p37_432122_c1 nmdc:mga05p37_432122_c1_245_1081 278
360 3300050511 nmdc:mga08y16_10478_c1 nmdc:mga08y16_10478_c1_5578_6414 278
361 3300050512 nmdc:mga0n895_104478_c1 nmdc:mga0n895_104478_c1_1319_2155 278
362 3300050512 nmdc:mga0n895_5686_c1 nmdc:mga0n895_5686_c1_5476_6312 278
363 3300050513 nmdc:mga0rr50_233515_c1 nmdc:mga0rr50_233515_c1_605_1456 278
364 3300050513 nmdc:mga0rr50_793_c1 nmdc:mga0rr50_793_c1_4114_4950 278
365 3300050515 nmdc:mga0a205_6699_c1 nmdc:mga0a205_6699_c1_1555_2391 278
366 3300053148 Ga0500590_103774 Ga0500590_103774_126_962 278
367 3300053156 Ga0500622_0001188 Ga0500622_0001188_19787_20626 278

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01925

TauE

Sulfite exporter TauE/SafE

46

306

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6cb2-assembly1.cif.gz_A crystal structure of escherichia coli uppp 0.5426 7 273
6cb2-assembly1.cif.gz_A crystal structure of escherichia coli uppp 0.535 7 273
6fmt-assembly1.cif.gz_A imisx-ep of hg-baca soaking sad 0.5204 7 273
6fmt-assembly1.cif.gz_A imisx-ep of hg-baca soaking sad 0.5125 7 273
6t1z-assembly1.cif.gz_A lmrp from l. lactis, in an outward-open conformation, bound to hoechst 33342 0.4807 39 274
ID Description Score Start End Superfamily
af_Q54E81_92_279_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4394 43 277 1.20.1250.20
af_P9WG87_21_208_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4356 14 274 1.20.1250.20
af_Q2FXH1_4_180_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4337 11 275 1.20.1250.20
af_P0AEJ0_15_220_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4309 11 275 1.20.1250.20
af_Q54E81_92_279_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4263 43 277 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A3A5FKD8-F1-model_v4 deleted 0.9746 2 275
AF-A0A3A5FKD8-F1-model_v4 deleted 0.9574 2 275
AF-A0A3D4Y9B0-F1-model_v4 Probable membrane transporter protein 0.9474 98 278 GO:0005886
AF-A0A6I2GVA6-F1-model_v4 Probable membrane transporter protein 0.9424 1 275 GO:0005886
AF-A0A832R109-F1-model_v4 Probable membrane transporter protein 0.9394 5 274 GO:0005886

Feature Viewer

pLDDT pTM Quality
85.88 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map