F424332

General Info

Members Datasets Scaffolds Average Seq Length
367 188 734 417

Family's Representative Sequence

Representative Sequence 3300009553|Ga0105249_10003969|Ga0105249_100039698
Length 483
Sequence LAPRSPDAYRRRPGPGVGDRRAGRRAVESENSLRDPAQGAMMPVVPSDPMAAPVRSVERTYLVLTLLTTLASSFIWGINTIFLLDAGLNNAEAFAANAFFTLGQVIFEVPTGVVADTRGRQFSYVLGAATLLLSTLLYLVMWQVHAPLIGWAIASILLGLGFTFFSGATEAWLVDALAATDDTGDLERIFGRAQTVGGVAMLIGTVSGGVIAQATNLGVPYLIRAAMLGVTMVVAIRFMHDLGFTPQRNVSPVAAVRNVVRGSIDGGFRNPPVRWLMLAAPFSAGAGIFVFYAAQPYLLELYGDRTAYGIAGLAAAIVAGVQIVGGLTVTRVRRLFGRRTSALLIGGALNVVLLVLLGLTHAFVVAXXXXAAWSFVFAVVGPLRQAFINGIIPSEQRATVLSFDSLMASAGGVVAQPALGRVADVNGYGPAYLVSAVISAFALPFVVLARREHASSDPIERDGDEEPPVVDRGGEPAPADTSA

Samples

Sample ID Description Type Environment
1 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
98 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
100 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
101 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
102 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
103 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
104 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
105 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
106 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
107 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
108 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
109 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
110 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
111 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
112 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
113 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
114 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
115 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
116 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
117 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
118 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
119 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
120 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
121 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
122 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
123 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
124 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
125 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
126 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
127 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
128 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
129 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
130 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
131 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
132 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
133 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
134 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
135 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
136 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
137 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
138 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
139 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
140 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
155 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
156 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
157 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
158 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
159 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
160 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
161 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
162 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
163 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
164 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
165 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
166 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
167 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
168 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
169 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
170 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
171 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
174 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
175 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
176 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
177 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
178 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
179 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
180 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
181 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
182 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
183 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
184 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
185 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
186 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
187 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
188 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.27
Nodule 0
Rhizoplane 4.09
Rhizosphere 95.1
Stem 0
Stem Tuber 0
Unclassified 3.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105249_10003969 3300009553 Bacteria 12764
2 rootH1_10019480 3300003323 Bacteria 5184
3 Ga0070690_100063716 3300005330 Bacteria 2380
4 Ga0070670_100294887 3300005331 Bacteria 1418
5 Ga0068869_100108194 3300005334 Bacteria 2112
6 Ga0068868_100138285 3300005338 Bacteria 1998
7 Ga0070689_100092903 3300005340 Bacteria 2381
8 Ga0070687_100024617 3300005343 Bacteria 2877
9 Ga0070692_10105752 3300005345 Bacteria 1549
10 Ga0070669_100104936 3300005353 Bacteria 2137
11 Ga0070675_100120998 3300005354 Bacteria 2224
12 Ga0070671_100115715 3300005355 Bacteria 2254
13 Ga0070673_100223491 3300005364 Unclassified 1631
14 Ga0070688_100194340 3300005365 Bacteria 1415
15 Ga0070659_100033884 3300005366 Bacteria 3970
16 Ga0070659_100074869 3300005366 Bacteria 2698
17 Ga0070701_10010541 3300005438 Bacteria 4090
18 Ga0070705_100004850 3300005440 Bacteria 6545
19 Ga0070705_100091296 3300005440 Bacteria 1898
20 Ga0070700_100002175 3300005441 Bacteria 9953
21 Ga0070694_100033760 3300005444 Unclassified 3370
22 Ga0070694_100127129 3300005444 Bacteria 1836
23 Ga0070708_100000063 3300005445 Bacteria 69658
24 Ga0070708_100001617 3300005445 Bacteria 17276
25 Ga0070708_100012061 3300005445 Bacteria 7044
26 Ga0070708_100020862 3300005445 Bacteria 5531
27 Ga0070708_100050655 3300005445 Bacteria 3678
28 Ga0070708_100199157 3300005445 Bacteria 1874
29 Ga0070708_100200970 3300005445 Bacteria 1866
30 Ga0070662_100012981 3300005457 Bacteria 5535
31 Ga0070662_100111186 3300005457 Bacteria 2087
32 Ga0068867_100002755 3300005459 Bacteria 12383
33 Ga0070685_10116728 3300005466 Bacteria 1652
34 Ga0070706_100001443 3300005467 Bacteria 25010
35 Ga0070706_100193181 3300005467 Bacteria 1902
36 Ga0070707_100002316 3300005468 Bacteria 18189
37 Ga0070707_100002785 3300005468 Bacteria 16649
38 Ga0070707_100006789 3300005468 Bacteria 10595
39 Ga0070707_100018079 3300005468 Bacteria 6632
40 Ga0070707_100043951 3300005468 Bacteria 4276
41 Ga0070707_100120523 3300005468 Bacteria 2547
42 Ga0070698_100000304 3300005471 Bacteria 50155
43 Ga0070698_100042034 3300005471 Bacteria 4689
44 Ga0070698_100167528 3300005471 Unclassified 2139
45 Ga0070699_100000081 3300005518 Bacteria 92126
46 Ga0070699_100006638 3300005518 Bacteria 10062
47 Ga0070699_100018581 3300005518 Bacteria 5971
48 Ga0070699_100030087 3300005518 Bacteria 4685
49 Ga0070699_100103264 3300005518 Bacteria 2500
50 Ga0070684_100203685 3300005535 Bacteria 1803
51 Ga0070697_100018820 3300005536 Bacteria 5449
52 Ga0068853_100013839 3300005539 Bacteria 6594
53 Ga0070686_100058531 3300005544 Bacteria 2479
54 Ga0070695_100033671 3300005545 Bacteria 3207
55 Ga0070696_100001761 3300005546 Bacteria 14205
56 Ga0070696_100005656 3300005546 Bacteria 8353
57 Ga0070696_100008248 3300005546 Bacteria 6973
58 Ga0070696_100018668 3300005546 Bacteria 4690
59 Ga0070704_100037946 3300005549 Bacteria 3296
60 Ga0068855_100209086 3300005563 Bacteria 2194
61 Ga0070664_100049967 3300005564 Bacteria 3537
62 Ga0068857_100099579 3300005577 Bacteria 2608
63 Ga0070702_100073282 3300005615 Bacteria 2028
64 Ga0068852_100135724 3300005616 Bacteria 2271
65 Ga0068864_100277273 3300005618 Bacteria 1564
66 Ga0068861_100074796 3300005719 Bacteria 2635
67 Ga0068870_10042911 3300005840 Bacteria 2357
68 Ga0068863_100162561 3300005841 Bacteria 2140
69 Ga0068860_100061310 3300005843 Bacteria 3574
70 Ga0068862_100078032 3300005844 Bacteria 2869
71 Ga0081538_10029206 3300005981 Bacteria 3774
72 Ga0081539_10002698 3300005985 Bacteria 24088
73 Ga0097621_100176560 3300006237 Bacteria 1844
74 Ga0075428_100100245 3300006844 Unclassified 3158
75 Ga0075431_100090530 3300006847 Bacteria 3158
76 Ga0075433_10051203 3300006852 Bacteria 3595
77 Ga0068865_100082460 3300006881 Bacteria 2312
78 Ga0075435_100060561 3300007076 Bacteria 3069
79 Ga0105240_10070778 3300009093 Unclassified 4314
80 Ga0111539_10000022 3300009094 Bacteria 240838
81 Ga0111539_10035475 3300009094 Bacteria 6038
82 Ga0111539_10092744 3300009094 Bacteria 3548
83 Ga0105245_10108257 3300009098 Bacteria 2581
84 Ga0105245_10133918 3300009098 Bacteria 2327
85 Ga0114129_10039285 3300009147 Bacteria 6673
86 Ga0114129_10088092 3300009147 Bacteria 4304
87 Ga0114129_10117935 3300009147 Bacteria 3656
88 Ga0114129_10134328 3300009147 Bacteria 3396
89 Ga0114129_10261257 3300009147 Bacteria 2320
90 Ga0114129_10383756 3300009147 Bacteria 1855
91 Ga0105243_10067681 3300009148 Bacteria 2876
92 Ga0105242_10071840 3300009176 Bacteria 2873
93 Ga0105238_10075584 3300009551 Bacteria 3360
94 Ga0105249_10095904 3300009553 Bacteria 2782
95 Ga0105249_10186845 3300009553 Bacteria 2020
96 Ga0105239_10128977 3300010375 Bacteria 2812
97 Ga0157369_10084808 3300013105 Unclassified 3385
98 Ga0157378_10124942 3300013297 Bacteria 2376
99 Ga0163162_10157742 3300013306 Bacteria 2390
100 Ga0163162_10318725 3300013306 Bacteria 1687
101 Ga0157375_10190595 3300013308 Bacteria 2205
102 Ga0157375_10207154 3300013308 Bacteria 2118
103 Ga0157380_10041143 3300014326 Bacteria 3605
104 Ga0157380_10275251 3300014326 Bacteria 1537
105 Ga0157377_10029372 3300014745 Bacteria 2967
106 Ga0157379_10008846 3300014968 Bacteria 8782
107 Ga0157379_10194270 3300014968 Bacteria 1834
108 Ga0157376_10132797 3300014969 Bacteria 2224
109 Ga0207688_10004734 3300025901 Bacteria 7413
110 Ga0207643_10043526 3300025908 Bacteria 2534
111 Ga0207643_10053306 3300025908 Bacteria 2298
112 Ga0207684_10001793 3300025910 Bacteria 22526
113 Ga0207684_10045681 3300025910 Bacteria 3714
114 Ga0207662_10016162 3300025918 Bacteria 4209
115 Ga0207657_10085446 3300025919 Bacteria 2643
116 Ga0207646_10002772 3300025922 Bacteria 20467
117 Ga0207646_10003440 3300025922 Bacteria 17873
118 Ga0207646_10012416 3300025922 Bacteria 8187
119 Ga0207646_10056851 3300025922 Bacteria 3496
120 Ga0207650_10022916 3300025925 Bacteria 4424
121 Ga0207650_10234559 3300025925 Bacteria 1481
122 Ga0207706_10008080 3300025933 Bacteria 9710
123 Ga0207706_10147916 3300025933 Bacteria 2066
124 Ga0207706_10163795 3300025933 Unclassified 1954
125 Ga0207670_10030479 3300025936 Bacteria 3446
126 Ga0207691_10017601 3300025940 Bacteria 6773
127 Ga0207711_10279715 3300025941 Bacteria 1536
128 Ga0207689_10094358 3300025942 Bacteria 2457
129 Ga0207679_10055919 3300025945 Bacteria 2911
130 Ga0207679_10229867 3300025945 Bacteria 1565
131 Ga0207712_10040687 3300025961 Bacteria 3192
132 Ga0207677_10045671 3300026023 Bacteria 2926
133 Ga0207639_10002375 3300026041 Bacteria 12652
134 Ga0207708_10001488 3300026075 Bacteria 17483
135 Ga0207641_10150114 3300026088 Bacteria 2110
136 Ga0207675_100078197 3300026118 Bacteria 3099
137 Ga0207675_100288715 3300026118 Bacteria 1595
138 Ga0207683_10154977 3300026121 Bacteria 2069
139 Ga0207698_10099302 3300026142 Bacteria 2408
140 Ga0209984_1001969 3300027424 Bacteria 2266
141 Ga0209970_1001341 3300027614 Bacteria 4308
142 Ga0209971_1009181 3300027682 Bacteria 2344
143 Ga0209966_1013992 3300027695 Bacteria 1493
144 Ga0209998_10000084 3300027717 Bacteria 36963
145 Ga0209998_10008657 3300027717 Bacteria 2109
146 Ga0209974_10001251 3300027876 Bacteria 9109
147 Ga0209974_10003062 3300027876 Bacteria 6052
148 Ga0207428_10000030 3300027907 Bacteria 240846
149 Ga0207428_10034787 3300027907 Bacteria 4124
150 Ga0268264_10147921 3300028381 Bacteria 2102
151 Ga0265337_1023820 3300028556 Bacteria 1879
152 Ga0307511_10093424 3300030521 Unclassified 2022
153 Ga0265313_10010581 3300031595 Bacteria 5813
154 Ga0316576_10001603 3300031727 Bacteria 12346
155 Ga0316576_10079655 3300031727 Bacteria 2428
156 Ga0316578_10028606 3300031728 Bacteria 3158
157 Ga0307405_10024141 3300031731 Bacteria 3468
158 Ga0307413_10016150 3300031824 Bacteria 3847
159 Ga0307410_10150118 3300031852 Bacteria 1734
160 Ga0307406_10012721 3300031901 Unclassified 4802
161 Ga0307407_10001468 3300031903 Bacteria 8566
162 Ga0307407_10015075 3300031903 Bacteria 3806
163 Ga0307412_10016374 3300031911 Bacteria 4416
164 Ga0307409_100002613 3300031995 Bacteria 9470
165 Ga0307409_100008872 3300031995 Bacteria 6136
166 Ga0307409_100029225 3300031995 Bacteria 3941
167 Ga0307409_100063359 3300031995 Bacteria 2899
168 Ga0307416_100005778 3300032002 Bacteria 7663
169 Ga0307416_100140636 3300032002 Bacteria 2193
170 Ga0307414_10242226 3300032004 Bacteria 1494
171 Ga0307415_100129173 3300032126 Bacteria 1909
172 Ga0373954_0113383 3300035118 Bacteria 1312
173 Ga0373946_0002359 3300035171 Bacteria 6677
174 Ga0373947_0038176 3300035725 Bacteria 2852
175 Ga0316584_0029690 3300036712 Bacteria 4037
176 Ga0450923_000130 3300042125 Bacteria 6481
177 Ga0439434_0001816 3300042435 Bacteria 6206
178 Ga0451577_0129202 3300042876 Bacteria 2266
179 Ga0453683_0037001 3300044673 Bacteria 3071
180 Ga0451576_0044479 3300045051 Bacteria 4681
181 Ga0495603_0026873 3300046455 Bacteria 3476
182 Ga0495629_0000003 3300046459 Bacteria 529162
183 Ga0495629_0017646 3300046459 Bacteria 5116
184 Ga0495594_0113298 3300046499 Bacteria 1530
185 Ga0495586_0032988 3300046535 Bacteria 2778
186 Ga0495635_0011139 3300046663 Bacteria 6304
187 Ga0495680_0014404 3300047322 Bacteria 6848
188 Ga0496100_0075102 3300048903 Bacteria 2266
189 Ga0496101_0031181 3300048904 Bacteria 3745
190 Ga0496101_0214240 3300048904 Bacteria 1493
191 Ga0496101_0242224 3300048904 Bacteria 1404
192 Ga0496104_0059615 3300048907 Bacteria 3613
193 Ga0496107_0033735 3300048910 Bacteria 3664
194 Ga0496108_0008835 3300048911 Bacteria 8165
195 Ga0496108_0018237 3300048911 Bacteria 5746
196 Ga0496109_0000842 3300048912 Bacteria 25648
197 Ga0496110_0000414 3300048913 Bacteria 29042
198 Ga0496111_0000134 3300048914 Bacteria 32642
199 Ga0496112_0014848 3300048915 Bacteria 7244
200 Ga0496113_0007697 3300048916 Bacteria 6951
201 Ga0496113_0089062 3300048916 Bacteria 2375
202 Ga0496114_0118433 3300048917 Bacteria 2275
203 Ga0501031_0001065 3300049568 Bacteria 16649
204 Ga0501031_0002090 3300049568 Bacteria 12586
205 Ga0501031_0135677 3300049568 Bacteria 1608
206 Ga0501031_0253659 3300049568 Bacteria 1143
207 Ga0501032_0006842 3300049569 Bacteria 8366
208 Ga0501033_0008852 3300049570 Bacteria 7775
209 Ga0501033_0216195 3300049570 Bacteria 1366
210 Ga0501034_0075535 3300049571 Bacteria 3377
211 Ga0501034_0133319 3300049571 Bacteria 2467
212 Ga0501036_0002361 3300049572 Bacteria 14765
213 Ga0501036_0084111 3300049572 Bacteria 2690
214 Ga0501036_0175660 3300049572 Bacteria 1803
215 Ga0501037_0029357 3300049573 Bacteria 4063
216 Ga0501038_0002958 3300049574 Bacteria 15844
217 Ga0501038_0156812 3300049574 Bacteria 1853
218 Ga0501038_0226780 3300049574 Bacteria 1489
219 Ga0501039_0005685 3300049575 Bacteria 9445
220 Ga0501039_0009396 3300049575 Bacteria 7453
221 Ga0501039_0023147 3300049575 Bacteria 4767
222 Ga0501039_0041798 3300049575 Bacteria 3542
223 Ga0501040_0006943 3300049576 Bacteria 7332
224 Ga0501040_0019312 3300049576 Bacteria 4533
225 Ga0501040_0019703 3300049576 Bacteria 4489
226 Ga0501040_0052602 3300049576 Bacteria 2788
227 Ga0501040_0091439 3300049576 Bacteria 2115
228 Ga0501040_0151501 3300049576 Bacteria 1636
229 Ga0501041_0004942 3300049577 Bacteria 7751
230 Ga0501041_0056344 3300049577 Bacteria 2401
231 Ga0501041_0076402 3300049577 Bacteria 2061
232 Ga0501041_0100767 3300049577 Unclassified 1788
233 Ga0501041_0120241 3300049577 Bacteria 1632
234 Ga0501042_0000813 3300049578 Bacteria 17230
235 Ga0501042_0001366 3300049578 Bacteria 14319
236 Ga0501042_0006760 3300049578 Bacteria 7475
237 Ga0501042_0022522 3300049578 Bacteria 4401
238 Ga0501042_0084009 3300049578 Bacteria 2282
239 Ga0501043_0132355 3300049579 Bacteria 1954
240 Ga0501043_0136029 3300049579 Bacteria 1925
241 Ga0501046_0010831 3300049580 Bacteria 7817
242 Ga0501046_0012831 3300049580 Bacteria 7127
243 Ga0501046_0081507 3300049580 Bacteria 2499
244 Ga0501048_0002422 3300049582 Bacteria 14235
245 Ga0501048_0040662 3300049582 Bacteria 3331
246 Ga0501048_0047496 3300049582 Bacteria 3063
247 Ga0501048_0088393 3300049582 Bacteria 2186
248 Ga0501048_0105053 3300049582 Bacteria 1993
249 Ga0501048_0133518 3300049582 Bacteria 1754
250 Ga0501067_0121336 3300049583 Bacteria 1454
251 Ga0501068_0028914 3300049584 Bacteria 3281
252 Ga0501068_0116784 3300049584 Bacteria 1662
253 Ga0501068_0154425 3300049584 Bacteria 1444
254 Ga0501069_0017659 3300049585 Bacteria 3844
255 Ga0501069_0017765 3300049585 Bacteria 3834
256 Ga0501069_0063374 3300049585 Bacteria 2065
257 Ga0501070_0018944 3300049586 Bacteria 5773
258 Ga0501070_0053942 3300049586 Bacteria 3334
259 Ga0501070_0077754 3300049586 Bacteria 2746
260 Ga0501071_0003045 3300049587 Bacteria 10378
261 Ga0501071_0009590 3300049587 Bacteria 6457
262 Ga0501071_0115946 3300049587 Bacteria 1982
263 Ga0501072_0003408 3300049588 Bacteria 11971
264 Ga0501072_0018191 3300049588 Bacteria 5406
265 Ga0501072_0037007 3300049588 Bacteria 3828
266 Ga0501072_0070134 3300049588 Bacteria 2767
267 Ga0501072_0081385 3300049588 Bacteria 2567
268 Ga0501072_0190517 3300049588 Bacteria 1635
269 Ga0501072_0192071 3300049588 Bacteria 1628
270 Ga0501073_0027532 3300049589 Bacteria 4065
271 Ga0501073_0068621 3300049589 Unclassified 2471
272 Ga0501074_0004869 3300049590 Bacteria 9632
273 Ga0501074_0011436 3300049590 Bacteria 6455
274 Ga0501074_0141657 3300049590 Unclassified 1720
275 Ga0501075_0001222 3300049591 Bacteria 16655
276 Ga0501075_0024504 3300049591 Bacteria 4426
277 Ga0501075_0051756 3300049591 Bacteria 3088
278 Ga0501075_0058500 3300049591 Bacteria 2903
279 Ga0501075_0074034 3300049591 Bacteria 2576
280 Ga0501075_0120785 3300049591 Bacteria 1994
281 Ga0501075_0173261 3300049591 Bacteria 1647
282 Ga0501076_0005669 3300049592 Bacteria 9002
283 Ga0501076_0017563 3300049592 Bacteria 5439
284 Ga0501076_0033640 3300049592 Bacteria 4003
285 Ga0501076_0060723 3300049592 Unclassified 3008
286 Ga0501076_0099757 3300049592 Bacteria 2340
287 Ga0501076_0151970 3300049592 Bacteria 1883
288 Ga0501076_0208826 3300049592 Bacteria 1595
289 Ga0501077_0009148 3300049593 Bacteria 6152
290 Ga0501077_0011124 3300049593 Bacteria 5614
291 Ga0501250_001669 3300049680 Bacteria 1888
292 Ga0501079_0002216 3300049741 Bacteria 14012
293 Ga0501079_0005047 3300049741 Bacteria 9799
294 Ga0501079_0005153 3300049741 Bacteria 9716
295 Ga0501079_0008766 3300049741 Bacteria 7665
296 Ga0501079_0038970 3300049741 Bacteria 3665
297 Ga0501079_0050055 3300049741 Bacteria 3225
298 Ga0501079_0112559 3300049741 Bacteria 2115
299 Ga0501080_0005843 3300049742 Bacteria 11009
300 Ga0501080_0017059 3300049742 Bacteria 6706
301 Ga0501080_0041944 3300049742 Bacteria 4263
302 Ga0501080_0066427 3300049742 Bacteria 3354
303 Ga0501080_0086135 3300049742 Bacteria 2919
304 Ga0501080_0190100 3300049742 Bacteria 1887
305 Ga0501081_0002096 3300049743 Bacteria 12457
306 Ga0501081_0004129 3300049743 Bacteria 9305
307 Ga0501081_0012734 3300049743 Bacteria 5533
308 Ga0501081_0044144 3300049743 Bacteria 3059
309 Ga0501081_0087665 3300049743 Bacteria 2186
310 Ga0501081_0142597 3300049743 Bacteria 1717
311 Ga0501083_0062901 3300049744 Bacteria 2476
312 Ga0501083_0064315 3300049744 Bacteria 2445
313 Ga0501083_0165908 3300049744 Bacteria 1444
314 Ga0501268_003664 3300049765 Bacteria 2117
315 Ga0501035_0031636 3300049822 Bacteria 4819
316 Ga0501044_0098303 3300049823 Bacteria 2947
317 Ga0501045_0008991 3300049824 Bacteria 6976
318 Ga0501045_0011945 3300049824 Bacteria 6105
319 Ga0501045_0032421 3300049824 Bacteria 3786
320 Ga0501045_0044162 3300049824 Bacteria 3246
321 Ga0501045_0081827 3300049824 Bacteria 2381
322 Ga0501045_0160662 3300049824 Unclassified 1672
323 nmdc:mga05p37_17983_c1 3300050507 Bacteria 8536
324 nmdc:mga05p37_185546_c1 3300050507 Bacteria 2529
325 nmdc:mga05p37_50563_c1 3300050507 Bacteria 5111
326 nmdc:mga05p37_59266_c1 3300050507 Bacteria 4714
327 nmdc:mga09592_16521_c1 3300050508 Bacteria 6038
328 nmdc:mga0qj67_113846_c1 3300050509 Bacteria 2185
329 nmdc:mga06r32_136475_c1 3300050510 Bacteria 2427
330 nmdc:mga08y16_114851_c1 3300050511 Bacteria 2803
331 nmdc:mga08y16_24_c1 3300050511 Bacteria 240846
332 nmdc:mga0n895_120779_c1 3300050512 Bacteria 2641
333 nmdc:mga0n895_217387_c1 3300050512 Bacteria 1940
334 nmdc:mga0n895_36711_c1 3300050512 Bacteria 4734
335 nmdc:mga0n895_416760_c1 3300050512 Bacteria 1358
336 nmdc:mga0n895_77033_c1 3300050512 Bacteria 3316
337 nmdc:mga0rr50_41190_c1 3300050513 Bacteria 3363
338 nmdc:mga0a205_160984_c1 3300050515 Bacteria 2141
339 nmdc:mga0a205_296785_c1 3300050515 Bacteria 1489
340 nmdc:mga0a205_36698_c1 3300050515 Bacteria 4711
341 nmdc:mga0a205_67344_c1 3300050515 Bacteria 3459
342 Ga0500566_0007849 3300053094 Bacteria 6321
343 Ga0501084_0006249 3300054114 Bacteria 9795
344 Ga0501084_0013666 3300054114 Bacteria 6719
345 Ga0501084_0016211 3300054114 Bacteria 6187
346 Ga0501084_0024163 3300054114 Bacteria 5069
347 Ga0501084_0024663 3300054114 Bacteria 5019
348 Ga0501084_0077553 3300054114 Bacteria 2785
349 Ga0501084_0270676 3300054114 Bacteria 1434
350 Ga0590071_009749 3300059421 Bacteria 2253
351 Ga0590075_003979 3300059424 Bacteria 3499
352 Ga0590077_012800 3300059426 Bacteria 1741
353 Ga0501082_0010766 3300060353 Bacteria 7874
354 Ga0501082_0019884 3300060353 Bacteria 5788
355 Ga0501082_0031476 3300060353 Bacteria 4575
356 Ga0501082_0036046 3300060353 Bacteria 4262
357 Ga0501082_0142617 3300060353 Bacteria 2079
358 Ga0501082_0184337 3300060353 Bacteria 1816
359 Ga0530510_0004087 3300061734 Bacteria 10067
360 Ga0530510_0009275 3300061734 Bacteria 6904
361 Ga0530510_0015965 3300061734 Bacteria 5308
362 Ga0530510_0016420 3300061734 Bacteria 5240
363 Ga0530510_0053913 3300061734 Bacteria 2906
364 Ga0530510_0055778 3300061734 Bacteria 2854
365 Ga0530510_0057698 3300061734 Bacteria 2806
366 Ga0530510_0227962 3300061734 Bacteria 1385
367 Ga0530510_0292323 3300061734 Bacteria 1218
368 Ga0105249_10003969
369 rootH1_10019480
370 Ga0070690_100063716
371 Ga0070670_100294887
372 Ga0068869_100108194
373 Ga0068868_100138285
374 Ga0070689_100092903
375 Ga0070687_100024617
376 Ga0070692_10105752
377 Ga0070669_100104936
378 Ga0070675_100120998
379 Ga0070671_100115715
380 Ga0070673_100223491
381 Ga0070688_100194340
382 Ga0070659_100033884
383 Ga0070659_100074869
384 Ga0070701_10010541
385 Ga0070705_100004850
386 Ga0070705_100091296
387 Ga0070700_100002175
388 Ga0070694_100033760
389 Ga0070694_100127129
390 Ga0070708_100000063
391 Ga0070708_100001617
392 Ga0070708_100012061
393 Ga0070708_100020862
394 Ga0070708_100050655
395 Ga0070708_100199157
396 Ga0070708_100200970
397 Ga0070662_100012981
398 Ga0070662_100111186
399 Ga0068867_100002755
400 Ga0070685_10116728
401 Ga0070706_100001443
402 Ga0070706_100193181
403 Ga0070707_100002316
404 Ga0070707_100002785
405 Ga0070707_100006789
406 Ga0070707_100018079
407 Ga0070707_100043951
408 Ga0070707_100120523
409 Ga0070698_100000304
410 Ga0070698_100042034
411 Ga0070698_100167528
412 Ga0070699_100000081
413 Ga0070699_100006638
414 Ga0070699_100018581
415 Ga0070699_100030087
416 Ga0070699_100103264
417 Ga0070684_100203685
418 Ga0070697_100018820
419 Ga0068853_100013839
420 Ga0070686_100058531
421 Ga0070695_100033671
422 Ga0070696_100001761
423 Ga0070696_100005656
424 Ga0070696_100008248
425 Ga0070696_100018668
426 Ga0070704_100037946
427 Ga0068855_100209086
428 Ga0070664_100049967
429 Ga0068857_100099579
430 Ga0070702_100073282
431 Ga0068852_100135724
432 Ga0068864_100277273
433 Ga0068861_100074796
434 Ga0068870_10042911
435 Ga0068863_100162561
436 Ga0068860_100061310
437 Ga0068862_100078032
438 Ga0081538_10029206
439 Ga0081539_10002698
440 Ga0097621_100176560
441 Ga0075428_100100245
442 Ga0075431_100090530
443 Ga0075433_10051203
444 Ga0068865_100082460
445 Ga0075435_100060561
446 Ga0105240_10070778
447 Ga0111539_10000022
448 Ga0111539_10035475
449 Ga0111539_10092744
450 Ga0105245_10108257
451 Ga0105245_10133918
452 Ga0114129_10039285
453 Ga0114129_10088092
454 Ga0114129_10117935
455 Ga0114129_10134328
456 Ga0114129_10261257
457 Ga0114129_10383756
458 Ga0105243_10067681
459 Ga0105242_10071840
460 Ga0105238_10075584
461 Ga0105249_10095904
462 Ga0105249_10186845
463 Ga0105239_10128977
464 Ga0157369_10084808
465 Ga0157378_10124942
466 Ga0163162_10157742
467 Ga0163162_10318725
468 Ga0157375_10190595
469 Ga0157375_10207154
470 Ga0157380_10041143
471 Ga0157380_10275251
472 Ga0157377_10029372
473 Ga0157379_10008846
474 Ga0157379_10194270
475 Ga0157376_10132797
476 Ga0207688_10004734
477 Ga0207643_10043526
478 Ga0207643_10053306
479 Ga0207684_10001793
480 Ga0207684_10045681
481 Ga0207662_10016162
482 Ga0207657_10085446
483 Ga0207646_10002772
484 Ga0207646_10003440
485 Ga0207646_10012416
486 Ga0207646_10056851
487 Ga0207650_10022916
488 Ga0207650_10234559
489 Ga0207706_10008080
490 Ga0207706_10147916
491 Ga0207706_10163795
492 Ga0207670_10030479
493 Ga0207691_10017601
494 Ga0207711_10279715
495 Ga0207689_10094358
496 Ga0207679_10055919
497 Ga0207679_10229867
498 Ga0207712_10040687
499 Ga0207677_10045671
500 Ga0207639_10002375
501 Ga0207708_10001488
502 Ga0207641_10150114
503 Ga0207675_100078197
504 Ga0207675_100288715
505 Ga0207683_10154977
506 Ga0207698_10099302
507 Ga0209984_1001969
508 Ga0209970_1001341
509 Ga0209971_1009181
510 Ga0209966_1013992
511 Ga0209998_10000084
512 Ga0209998_10008657
513 Ga0209974_10001251
514 Ga0209974_10003062
515 Ga0207428_10000030
516 Ga0207428_10034787
517 Ga0268264_10147921
518 Ga0265337_1023820
519 Ga0307511_10093424
520 Ga0265313_10010581
521 Ga0316576_10001603
522 Ga0316576_10079655
523 Ga0316578_10028606
524 Ga0307405_10024141
525 Ga0307413_10016150
526 Ga0307410_10150118
527 Ga0307406_10012721
528 Ga0307407_10001468
529 Ga0307407_10015075
530 Ga0307412_10016374
531 Ga0307409_100002613
532 Ga0307409_100008872
533 Ga0307409_100029225
534 Ga0307409_100063359
535 Ga0307416_100005778
536 Ga0307416_100140636
537 Ga0307414_10242226
538 Ga0307415_100129173
539 Ga0373954_0113383
540 Ga0373946_0002359
541 Ga0373947_0038176
542 Ga0316584_0029690
543 Ga0450923_000130
544 Ga0439434_0001816
545 Ga0451577_0129202
546 Ga0453683_0037001
547 Ga0451576_0044479
548 Ga0495603_0026873
549 Ga0495629_0000003
550 Ga0495629_0017646
551 Ga0495594_0113298
552 Ga0495586_0032988
553 Ga0495635_0011139
554 Ga0495680_0014404
555 Ga0496100_0075102
556 Ga0496101_0031181
557 Ga0496101_0214240
558 Ga0496101_0242224
559 Ga0496104_0059615
560 Ga0496107_0033735
561 Ga0496108_0008835
562 Ga0496108_0018237
563 Ga0496109_0000842
564 Ga0496110_0000414
565 Ga0496111_0000134
566 Ga0496112_0014848
567 Ga0496113_0007697
568 Ga0496113_0089062
569 Ga0496114_0118433
570 Ga0501031_0001065
571 Ga0501031_0002090
572 Ga0501031_0135677
573 Ga0501031_0253659
574 Ga0501032_0006842
575 Ga0501033_0008852
576 Ga0501033_0216195
577 Ga0501034_0075535
578 Ga0501034_0133319
579 Ga0501036_0002361
580 Ga0501036_0084111
581 Ga0501036_0175660
582 Ga0501037_0029357
583 Ga0501038_0002958
584 Ga0501038_0156812
585 Ga0501038_0226780
586 Ga0501039_0005685
587 Ga0501039_0009396
588 Ga0501039_0023147
589 Ga0501039_0041798
590 Ga0501040_0006943
591 Ga0501040_0019312
592 Ga0501040_0019703
593 Ga0501040_0052602
594 Ga0501040_0091439
595 Ga0501040_0151501
596 Ga0501041_0004942
597 Ga0501041_0056344
598 Ga0501041_0076402
599 Ga0501041_0100767
600 Ga0501041_0120241
601 Ga0501042_0000813
602 Ga0501042_0001366
603 Ga0501042_0006760
604 Ga0501042_0022522
605 Ga0501042_0084009
606 Ga0501043_0132355
607 Ga0501043_0136029
608 Ga0501046_0010831
609 Ga0501046_0012831
610 Ga0501046_0081507
611 Ga0501048_0002422
612 Ga0501048_0040662
613 Ga0501048_0047496
614 Ga0501048_0088393
615 Ga0501048_0105053
616 Ga0501048_0133518
617 Ga0501067_0121336
618 Ga0501068_0028914
619 Ga0501068_0116784
620 Ga0501068_0154425
621 Ga0501069_0017659
622 Ga0501069_0017765
623 Ga0501069_0063374
624 Ga0501070_0018944
625 Ga0501070_0053942
626 Ga0501070_0077754
627 Ga0501071_0003045
628 Ga0501071_0009590
629 Ga0501071_0115946
630 Ga0501072_0003408
631 Ga0501072_0018191
632 Ga0501072_0037007
633 Ga0501072_0070134
634 Ga0501072_0081385
635 Ga0501072_0190517
636 Ga0501072_0192071
637 Ga0501073_0027532
638 Ga0501073_0068621
639 Ga0501074_0004869
640 Ga0501074_0011436
641 Ga0501074_0141657
642 Ga0501075_0001222
643 Ga0501075_0024504
644 Ga0501075_0051756
645 Ga0501075_0058500
646 Ga0501075_0074034
647 Ga0501075_0120785
648 Ga0501075_0173261
649 Ga0501076_0005669
650 Ga0501076_0017563
651 Ga0501076_0033640
652 Ga0501076_0060723
653 Ga0501076_0099757
654 Ga0501076_0151970
655 Ga0501076_0208826
656 Ga0501077_0009148
657 Ga0501077_0011124
658 Ga0501250_001669
659 Ga0501079_0002216
660 Ga0501079_0005047
661 Ga0501079_0005153
662 Ga0501079_0008766
663 Ga0501079_0038970
664 Ga0501079_0050055
665 Ga0501079_0112559
666 Ga0501080_0005843
667 Ga0501080_0017059
668 Ga0501080_0041944
669 Ga0501080_0066427
670 Ga0501080_0086135
671 Ga0501080_0190100
672 Ga0501081_0002096
673 Ga0501081_0004129
674 Ga0501081_0012734
675 Ga0501081_0044144
676 Ga0501081_0087665
677 Ga0501081_0142597
678 Ga0501083_0062901
679 Ga0501083_0064315
680 Ga0501083_0165908
681 Ga0501268_003664
682 Ga0501035_0031636
683 Ga0501044_0098303
684 Ga0501045_0008991
685 Ga0501045_0011945
686 Ga0501045_0032421
687 Ga0501045_0044162
688 Ga0501045_0081827
689 Ga0501045_0160662
690 nmdc:mga05p37_17983_c1
691 nmdc:mga05p37_185546_c1
692 nmdc:mga05p37_50563_c1
693 nmdc:mga05p37_59266_c1
694 nmdc:mga09592_16521_c1
695 nmdc:mga0qj67_113846_c1
696 nmdc:mga06r32_136475_c1
697 nmdc:mga08y16_114851_c1
698 nmdc:mga08y16_24_c1
699 nmdc:mga0n895_120779_c1
700 nmdc:mga0n895_217387_c1
701 nmdc:mga0n895_36711_c1
702 nmdc:mga0n895_416760_c1
703 nmdc:mga0n895_77033_c1
704 nmdc:mga0rr50_41190_c1
705 nmdc:mga0a205_160984_c1
706 nmdc:mga0a205_296785_c1
707 nmdc:mga0a205_36698_c1
708 nmdc:mga0a205_67344_c1
709 Ga0500566_0007849
710 Ga0501084_0006249
711 Ga0501084_0013666
712 Ga0501084_0016211
713 Ga0501084_0024163
714 Ga0501084_0024663
715 Ga0501084_0077553
716 Ga0501084_0270676
717 Ga0590071_009749
718 Ga0590075_003979
719 Ga0590077_012800
720 Ga0501082_0010766
721 Ga0501082_0019884
722 Ga0501082_0031476
723 Ga0501082_0036046
724 Ga0501082_0142617
725 Ga0501082_0184337
726 Ga0530510_0004087
727 Ga0530510_0009275
728 Ga0530510_0015965
729 Ga0530510_0016420
730 Ga0530510_0053913
731 Ga0530510_0055778
732 Ga0530510_0057698
733 Ga0530510_0227962
734 Ga0530510_0292323

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

282

479

0.85

PF07690

MFS_1

Major Facilitator Superfamily

61

382

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bc7-assembly1.cif.gz_A cryo-em structure of the proton coupled folate transporter at ph 6.0 bound to pemetrexed 0.818 11 404
4zyr-assembly2.cif.gz_B crystal structure of e. coli lactose permease g46w/g262w bound to p-nitrophenyl alpha-d-galactopyranoside (alpha-npg) 0.814 7 400
6t1z-assembly1.cif.gz_A lmrp from l. lactis, in an outward-open conformation, bound to hoechst 33342 0.8134 7 403
8dl8-assembly1.cif.gz_A cryo-em structure of human ferroportin/slc40 bound to co2+ in nanodisc 0.8067 8 406
8c03-assembly1.cif.gz_A structure of slc40/ferroportin in complex with vamifeport and synthetic nanobody sy12 in outward-facing conformation 0.801 8 404
ID Description Score Start End Superfamily
af_Q8IL62_16_233_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8926 5 189 1.20.1250.20
af_Q8GXH4_57_436_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8827 12 401 1.20.1250.20
af_Q4D047_16_187_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8814 14 188 1.20.1250.20
af_Q2FXH1_4_180_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8796 6 191 1.20.1250.20
af_Q8GXH4_57_436_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8783 12 401 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A353ZQL6-F1-model_v4 MFS transporter 0.9845 106 410 GO:0016020
GO:0022857
AF-A0A1G5Q812-F1-model_v4 Predicted arabinose efflux permease, MFS family 0.9699 56 421 GO:0016020
GO:0022857
AF-A0A7V9LG59-F1-model_v4 MFS transporter 0.9569 4 321 GO:0016020
GO:0022857
AF-A0A353ZQL6-F1-model_v4 MFS transporter 0.9506 106 410 GO:0016020
GO:0022857
AF-A0A2V8RNY6-F1-model_v4 Major facilitator superfamily (MFS) profile domain-containing protein 0.948 152 409 GO:0016020
GO:0022857

Map