F424271

General Info

Members Datasets Scaffolds Average Seq Length
367 239 734 119

Family's Representative Sequence

Representative Sequence 3300005440|Ga0070705_100444683|Ga0070705_1004446832
Length 134
Sequence MEKLRAVEREGLKTDIPAFAPGDTVRVMVRVREGEKERLQAFEGICIARRGGGINETFTVRKISAGVGVERIFPLHAPSIAEIGLMRKGRVRRAKLYFLRRLAGKAARIREKRGAGPGISVPSTGEPEQPPPQT

Samples

Sample ID Description Type Environment
1 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
2 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
63 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
84 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
85 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
123 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
126 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
127 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
128 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
129 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
130 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
131 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
132 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
136 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
137 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
138 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
139 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
140 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
141 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
142 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
143 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
144 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
145 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
146 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
147 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
148 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
149 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
152 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
153 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
154 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
155 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
156 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
157 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
158 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
159 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
160 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
161 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
162 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
163 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
164 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
165 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
166 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
167 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
168 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
169 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
170 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
171 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
172 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
173 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
174 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
175 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
176 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
177 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
178 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
179 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
180 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
181 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
182 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
183 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
184 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
185 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
186 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
187 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
188 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
189 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
190 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
191 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
192 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
193 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
194 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
195 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
196 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
197 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
198 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
199 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
200 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
201 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
202 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
203 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
204 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
205 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
206 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
207 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
218 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
219 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
220 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
221 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
222 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
223 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
224 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
225 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
226 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
227 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
228 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
229 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
230 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
231 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
232 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
233 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
234 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
235 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
236 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
237 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
238 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.28
Metatranscriptomes 2.72
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.45
Rhizosphere 95.91
Stem 0
Stem Tuber 0
Unclassified 9.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070705_100444683 3300005440 Bacteria 971
2 Ga0058862_12634324 3300004803 Bacteria 623
3 Ga0065712_10560859 3300005290 Bacteria 603
4 Ga0070670_100212629 3300005331 Bacteria 1681
5 Ga0070677_10029433 3300005333 Bacteria 2083
6 Ga0068869_100045316 3300005334 Bacteria 3166
7 Ga0070689_100189182 3300005340 Bacteria 1675
8 Ga0070689_101036652 3300005340 Bacteria 731
9 Ga0070668_100700749 3300005347 Bacteria 893
10 Ga0070675_100000496 3300005354 Bacteria 26949
11 Ga0070673_100055996 3300005364 Bacteria 3109
12 Ga0070673_100069005 3300005364 Bacteria 2832
13 Ga0070667_100041928 3300005367 Bacteria 3839
14 Ga0070667_100513658 3300005367 Bacteria 1099
15 Ga0070703_10042231 3300005406 Unclassified 1425
16 Ga0070703_10125808 3300005406 Bacteria 935
17 Ga0070709_10004858 3300005434 Bacteria 7266
18 Ga0070709_10007482 3300005434 Bacteria 5988
19 Ga0070709_10027780 3300005434 Bacteria 3368
20 Ga0070709_10151633 3300005434 Bacteria 1602
21 Ga0070709_10353010 3300005434 Bacteria 1087
22 Ga0070709_10932706 3300005434 Bacteria 688
23 Ga0070714_100018168 3300005435 Bacteria 5706
24 Ga0070714_100199064 3300005435 Bacteria 1832
25 Ga0070714_100211837 3300005435 Bacteria 1776
26 Ga0070713_100148372 3300005436 Bacteria 2084
27 Ga0070713_100201000 3300005436 Bacteria 1800
28 Ga0070713_100482483 3300005436 Bacteria 1168
29 Ga0070710_11493046 3300005437 Unclassified 508
30 Ga0070701_10045435 3300005438 Bacteria 2253
31 Ga0070711_100000635 3300005439 Bacteria 18322
32 Ga0070711_100043880 3300005439 Bacteria 3031
33 Ga0070711_100175291 3300005439 Bacteria 1637
34 Ga0070711_100295155 3300005439 Bacteria 1287
35 Ga0070705_100001775 3300005440 Bacteria 11176
36 Ga0070705_100049012 3300005440 Bacteria 2450
37 Ga0070694_100001732 3300005444 Bacteria 12865
38 Ga0070694_100003854 3300005444 Bacteria 8960
39 Ga0070694_100051319 3300005444 Bacteria 2784
40 Ga0070694_101604771 3300005444 Bacteria 552
41 Ga0070708_100002809 3300005445 Bacteria 13522
42 Ga0070708_100065366 3300005445 Bacteria 3262
43 Ga0070662_100101282 3300005457 Bacteria 2180
44 Ga0070681_10631242 3300005458 Unclassified 986
45 Ga0068867_100427369 3300005459 Bacteria 1123
46 Ga0068867_101439023 3300005459 Bacteria 640
47 Ga0070685_10171484 3300005466 Bacteria 1391
48 Ga0070706_100008445 3300005467 Bacteria 9592
49 Ga0070707_100104951 3300005468 Bacteria 2740
50 Ga0070707_100263080 3300005468 Bacteria 1678
51 Ga0070707_100628154 3300005468 Bacteria 1037
52 Ga0070698_100026068 3300005471 Bacteria 6088
53 Ga0070698_100046716 3300005471 Unclassified 4427
54 Ga0070699_100022573 3300005518 Bacteria 5424
55 Ga0070699_100077611 3300005518 Bacteria 2892
56 Ga0070699_100252160 3300005518 Unclassified 1577
57 Ga0070699_100327807 3300005518 Bacteria 1377
58 Ga0070699_100561133 3300005518 Bacteria 1040
59 Ga0070679_100129854 3300005530 Bacteria 2501
60 Ga0070697_100001292 3300005536 Bacteria 18856
61 Ga0070697_100031076 3300005536 Bacteria 4293
62 Ga0070697_100060776 3300005536 Bacteria 3080
63 Ga0070686_100012107 3300005544 Bacteria 4908
64 Ga0070686_100476097 3300005544 Bacteria 965
65 Ga0070695_100004735 3300005545 Bacteria 8009
66 Ga0070695_100007147 3300005545 Bacteria 6619
67 Ga0070695_100060156 3300005545 Bacteria 2461
68 Ga0070695_100078902 3300005545 Bacteria 2172
69 Ga0070695_100181642 3300005545 Unclassified 1491
70 Ga0070696_100004661 3300005546 Bacteria 9160
71 Ga0070696_100012996 3300005546 Bacteria 5586
72 Ga0070696_100037690 3300005546 Bacteria 3335
73 Ga0070693_100000103 3300005547 Bacteria 37686
74 Ga0070665_100104655 3300005548 Bacteria 2832
75 Ga0070704_100001246 3300005549 Bacteria 13412
76 Ga0070704_100005550 3300005549 Bacteria 7353
77 Ga0070704_100019141 3300005549 Bacteria 4395
78 Ga0070704_100589889 3300005549 Bacteria 975
79 Ga0070664_100513341 3300005564 Bacteria 1105
80 Ga0068854_100710884 3300005578 Bacteria 868
81 Ga0068856_101092117 3300005614 Bacteria 815
82 Ga0070702_100637580 3300005615 Bacteria 804
83 Ga0068859_100077832 3300005617 Bacteria 3357
84 Ga0068859_100778090 3300005617 Bacteria 1045
85 Ga0068859_102585881 3300005617 Bacteria 558
86 Ga0068864_100043529 3300005618 Bacteria 3844
87 Ga0068864_100696832 3300005618 Bacteria 992
88 Ga0068866_10073736 3300005718 Bacteria 1812
89 Ga0068866_10762433 3300005718 Bacteria 669
90 Ga0068861_102623380 3300005719 Bacteria 508
91 Ga0068870_10432524 3300005840 Bacteria 863
92 Ga0068863_100042977 3300005841 Bacteria 4292
93 Ga0068863_100136923 3300005841 Bacteria 2340
94 Ga0068860_100003198 3300005843 Bacteria 16910
95 Ga0068860_101155483 3300005843 Bacteria 794
96 Ga0068862_102383199 3300005844 Bacteria 541
97 Ga0070717_10251518 3300006028 Unclassified 1561
98 Ga0070715_10208749 3300006163 Unclassified 997
99 Ga0070716_100178934 3300006173 Bacteria 1390
100 Ga0070716_100507733 3300006173 Unclassified 891
101 Ga0097621_100843578 3300006237 Bacteria 851
102 Ga0075428_100784480 3300006844 Bacteria 1013
103 Ga0075428_101478224 3300006844 Bacteria 712
104 Ga0075430_101222957 3300006846 Bacteria 618
105 Ga0075431_100414501 3300006847 Bacteria 1347
106 Ga0075431_100437189 3300006847 Bacteria 1306
107 Ga0075434_100503189 3300006871 Bacteria 1232
108 Ga0075434_101010556 3300006871 Bacteria 845
109 Ga0075429_100027159 3300006880 Bacteria 4969
110 Ga0068865_100271415 3300006881 Bacteria 1347
111 Ga0075436_100002254 3300006914 Bacteria 13316
112 Ga0075436_100059890 3300006914 Bacteria 2630
113 Ga0075436_100110555 3300006914 Bacteria 1918
114 Ga0097620_100077829 3300006931 Bacteria 3357
115 Ga0097620_100778068 3300006931 Bacteria 1045
116 Ga0097620_102585779 3300006931 Bacteria 558
117 Ga0075435_100048215 3300007076 Bacteria 3422
118 Ga0099794_10009645 3300007265 Bacteria 4070
119 Ga0099794_10027443 3300007265 Bacteria 2639
120 Ga0099794_10035662 3300007265 Bacteria 2348
121 Ga0099794_10071350 3300007265 Bacteria 1701
122 Ga0099794_10187741 3300007265 Bacteria 1056
123 Ga0099794_10374745 3300007265 Bacteria 742
124 Ga0099795_10246539 3300007788 Unclassified 769
125 Ga0099795_10328367 3300007788 Unclassified 679
126 Ga0111539_10715479 3300009094 Bacteria 1166
127 Ga0105245_10397005 3300009098 Unclassified 1377
128 Ga0105247_11792498 3300009101 Bacteria 510
129 Ga0114129_10001609 3300009147 Bacteria 30680
130 Ga0114129_11106034 3300009147 Bacteria 992
131 Ga0114129_11246181 3300009147 Bacteria 924
132 Ga0105241_10986014 3300009174 Unclassified 787
133 Ga0105242_11538008 3300009176 Bacteria 697
134 Ga0105248_10066260 3300009177 Bacteria 4055
135 Ga0105248_11474764 3300009177 Bacteria 770
136 Ga0105237_10416946 3300009545 Bacteria 1348
137 Ga0099796_10434733 3300010159 Bacteria 581
138 Ga0105239_10184758 3300010375 Bacteria 2333
139 Ga0157374_11986751 3300013296 Bacteria 608
140 Ga0157378_10000125 3300013297 Bacteria 74562
141 Ga0157378_11889773 3300013297 Bacteria 646
142 Ga0163162_10001617 3300013306 Bacteria 21071
143 Ga0157375_10523145 3300013308 Bacteria 1349
144 Ga0157375_11055074 3300013308 Bacteria 950
145 Ga0157375_12124545 3300013308 Bacteria 668
146 Ga0163163_10002326 3300014325 Bacteria 16061
147 Ga0163163_11061745 3300014325 Bacteria 873
148 Ga0157380_11463065 3300014326 Bacteria 735
149 Ga0157377_10021813 3300014745 Bacteria 3374
150 Ga0157379_10381434 3300014968 Bacteria 1293
151 Ga0206356_11496176 3300020070 Bacteria 527
152 Ga0224570_108179 3300022730 Unclassified 648
153 Ga0224572_1015889 3300024225 Bacteria 1443
154 Ga0207653_10002450 3300025885 Bacteria 5898
155 Ga0207653_10158106 3300025885 Bacteria 837
156 Ga0207682_10018040 3300025893 Bacteria 2756
157 Ga0207642_10242770 3300025899 Bacteria 1018
158 Ga0207699_10013130 3300025906 Bacteria 4229
159 Ga0207699_10024853 3300025906 Bacteria 3281
160 Ga0207699_10198092 3300025906 Bacteria 1359
161 Ga0207699_10886766 3300025906 Bacteria 658
162 Ga0207684_10009470 3300025910 Bacteria 8600
163 Ga0207707_10548144 3300025912 Unclassified 983
164 Ga0207671_10227520 3300025914 Bacteria 1462
165 Ga0207671_10738164 3300025914 Bacteria 782
166 Ga0207663_10598155 3300025916 Bacteria 866
167 Ga0207662_10444467 3300025918 Bacteria 886
168 Ga0207657_10333223 3300025919 Bacteria 1198
169 Ga0207652_10104868 3300025921 Bacteria 2501
170 Ga0207646_10079328 3300025922 Bacteria 2935
171 Ga0207646_10456690 3300025922 Bacteria 1152
172 Ga0207646_10738042 3300025922 Bacteria 879
173 Ga0207646_11065363 3300025922 Bacteria 712
174 Ga0207681_11433283 3300025923 Bacteria 579
175 Ga0207650_10071995 3300025925 Bacteria 2601
176 Ga0207659_10000167 3300025926 Bacteria 39314
177 Ga0207700_10010401 3300025928 Bacteria 5869
178 Ga0207700_10433762 3300025928 Bacteria 1156
179 Ga0207664_10086690 3300025929 Bacteria 2558
180 Ga0207664_10180780 3300025929 Bacteria 1810
181 Ga0207664_10841846 3300025929 Unclassified 825
182 Ga0207706_10293283 3300025933 Bacteria 1418
183 Ga0207670_11432714 3300025936 Bacteria 587
184 Ga0207669_10615558 3300025937 Bacteria 884
185 Ga0207704_11780529 3300025938 Bacteria 530
186 Ga0207665_10278390 3300025939 Unclassified 1244
187 Ga0207665_10398140 3300025939 Bacteria 1048
188 Ga0207665_10515476 3300025939 Bacteria 925
189 Ga0207665_10661912 3300025939 Bacteria 819
190 Ga0207689_10087342 3300025942 Bacteria 2562
191 Ga0207651_10128692 3300025960 Bacteria 1934
192 Ga0207668_10604375 3300025972 Bacteria 956
193 Ga0207658_10249943 3300025986 Bacteria 1506
194 Ga0207658_10321930 3300025986 Bacteria 1339
195 Ga0207708_10609306 3300026075 Bacteria 926
196 Ga0207641_10246097 3300026088 Bacteria 1668
197 Ga0207648_10370310 3300026089 Bacteria 1294
198 Ga0207676_10044265 3300026095 Bacteria 3433
199 Ga0207676_10485079 3300026095 Bacteria 1171
200 Ga0207676_12225748 3300026095 Bacteria 546
201 Ga0207674_11856675 3300026116 Bacteria 569
202 Ga0207675_100519367 3300026118 Bacteria 1187
203 Ga0209179_1004967 3300027512 Bacteria 2048
204 Ga0209588_1001419 3300027671 Bacteria 6256
205 Ga0209588_1018872 3300027671 Bacteria 2148
206 Ga0209588_1049574 3300027671 Bacteria 1359
207 Ga0209588_1144385 3300027671 Unclassified 756
208 Ga0209588_1182769 3300027671 Unclassified 658
209 Ga0265354_1000256 3300028016 Bacteria 9623
210 Ga0268265_11277251 3300028380 Bacteria 734
211 Ga0268264_10009879 3300028381 Bacteria 7900
212 Ga0265338_10480383 3300028800 Bacteria 877
213 Ga0265770_1001821 3300030878 Unclassified 2903
214 Ga0265765_1000907 3300030879 Unclassified 2594
215 Ga0265316_10256332 3300031344 Bacteria 1283
216 Ga0307508_10004466 3300031616 Bacteria 13661
217 Ga0316575_10477508 3300031665 Bacteria 540
218 Ga0316576_10016707 3300031727 Bacteria 4967
219 Ga0316576_10048656 3300031727 Bacteria 3076
220 Ga0316578_10392291 3300031728 Bacteria 823
221 Ga0307410_11833121 3300031852 Bacteria 539
222 Ga0316580_10065605 3300032139 Unclassified 1113
223 Ga0316592_1016527 3300033524 Unclassified 1543
224 Ga0316588_1005562 3300033528 Bacteria 2463
225 Ga0316596_1177106 3300033541 Unclassified 589
226 Ga0316212_1000575 3300033547 Bacteria 4571
227 Ga0373926_0002742 3300035083 Bacteria 5612
228 Ga0373944_0094998 3300035089 Bacteria 1001
229 Ga0373936_0159072 3300035113 Bacteria 983
230 Ga0373936_0477916 3300035113 Bacteria 578
231 Ga0373956_0354843 3300035119 Unclassified 699
232 Ga0373943_0003762 3300035170 Bacteria 6893
233 Ga0373946_0003892 3300035171 Bacteria 5307
234 Ga0373946_0005443 3300035171 Bacteria 4590
235 Ga0373955_0047283 3300035172 Bacteria 2329
236 Ga0373955_0332792 3300035172 Unclassified 918
237 Ga0373955_0752123 3300035172 Unclassified 599
238 Ga0373961_0004248 3300035241 Bacteria 3473
239 Ga0316574_0195024 3300035398 Bacteria 1302
240 Ga0373924_0007005 3300035410 Bacteria 4059
241 Ga0373931_0742641 3300035691 Bacteria 651
242 Ga0373935_0203981 3300035692 Bacteria 1367
243 Ga0373927_0003147 3300035695 Bacteria 11918
244 Ga0373927_0393646 3300035695 Bacteria 914
245 Ga0373947_0019001 3300035725 Unclassified 3960
246 Ga0373947_0022531 3300035725 Bacteria 3654
247 Ga0373947_0797355 3300035725 Bacteria 645
248 Ga0373937_0634864 3300036401 Unclassified 1013
249 Ga0373937_0955869 3300036401 Bacteria 806
250 Ga0316582_0125515 3300036647 Unclassified 1720
251 Ga0316584_0699521 3300036712 Bacteria 695
252 Ga0373925_0003026 3300037068 Bacteria 13227
253 Ga0373925_0944115 3300037068 Bacteria 711
254 Ga0395898_1924965 3300037466 Bacteria 511
255 Ga0316581_0141200 3300037588 Bacteria 742
256 Ga0316581_0154461 3300037588 Bacteria 707
257 Ga0436365_0588638 3300039437 Unclassified 588
258 Ga0436365_0687517 3300039437 Bacteria 2002
259 Ga0436362_0334662 3300039453 Bacteria 1026
260 Ga0451805_063316 3300041461 Unclassified 530
261 Ga0451807_1817762 3300041486 Bacteria 3634
262 Ga0451849_0128432 3300041505 Bacteria 1341
263 Ga0451853_1227995 3300041512 Bacteria 1330
264 Ga0439463_170201 3300042016 Bacteria 565
265 Ga0439446_0292040 3300042156 Bacteria 571
266 Ga0466963_0268461 3300044694 Bacteria 1199
267 Ga0453684_0000036 3300044712 Bacteria 711481
268 Ga0453684_0057261 3300044712 Bacteria 5046
269 Ga0466960_0108891 3300044901 Bacteria 1437
270 Ga0495592_0169356 3300046454 Bacteria 1497
271 Ga0495641_0024097 3300046461 Bacteria 3009
272 Ga0495580_0066143 3300046472 Unclassified 2531
273 Ga0495580_0068760 3300046472 Bacteria 2476
274 Ga0495580_0129011 3300046472 Bacteria 1754
275 Ga0495580_0345329 3300046472 Bacteria 1009
276 Ga0495580_0906422 3300046472 Bacteria 566
277 Ga0495582_0091178 3300046473 Bacteria 1699
278 Ga0495639_0018024 3300046475 Bacteria 3070
279 Ga0495662_0091253 3300046476 Bacteria 1485
280 Ga0495664_0001840 3300046477 Bacteria 11274
281 Ga0495594_0004042 3300046499 Bacteria 7544
282 Ga0495618_0134553 3300046514 Bacteria 1581
283 Ga0495628_0100000 3300046516 Bacteria 2239
284 Ga0495628_0701342 3300046516 Bacteria 715
285 Ga0495628_1120624 3300046516 Bacteria 537
286 Ga0495630_0003216 3300046517 Bacteria 11366
287 Ga0495630_0006010 3300046517 Bacteria 8588
288 Ga0495630_0260389 3300046517 Unclassified 1325
289 Ga0495630_0592015 3300046517 Bacteria 850
290 Ga0495666_0002207 3300046526 Bacteria 9711
291 Ga0495666_0050043 3300046526 Bacteria 2009
292 Ga0495666_0383897 3300046526 Bacteria 632
293 Ga0495665_0225499 3300046531 Bacteria 968
294 Ga0495640_0193868 3300046533 Bacteria 1290
295 Ga0495586_0003816 3300046535 Bacteria 8074
296 Ga0495587_0004849 3300046536 Bacteria 8827
297 Ga0495598_0037112 3300046537 Bacteria 1404
298 Ga0495621_0465998 3300046539 Bacteria 542
299 Ga0495645_0006704 3300046543 Bacteria 8001
300 Ga0495634_0004582 3300046642 Bacteria 10796
301 Ga0495657_0675749 3300046675 Bacteria 594
302 Ga0495599_0365814 3300046678 Bacteria 863
303 Ga0495647_0009733 3300046681 Bacteria 3262
304 Ga0495658_0004506 3300046683 Bacteria 6851
305 Ga0495613_0026377 3300046689 Bacteria 4329
306 Ga0495624_0380169 3300046690 Bacteria 848
307 Ga0495670_0438943 3300046691 Bacteria 707
308 Ga0495600_0161225 3300046809 Bacteria 1449
309 Ga0495604_0587217 3300047317 Bacteria 715
310 Ga0495636_0225175 3300047318 Bacteria 862
311 Ga0495674_0001937 3300047319 Bacteria 20419
312 Ga0495676_0310654 3300047321 Bacteria 1061
313 Ga0495676_0892976 3300047321 Bacteria 570
314 Ga0495680_0036113 3300047322 Bacteria 3972
315 Ga0495684_0205266 3300047471 Bacteria 1451
316 Ga0495684_0270006 3300047471 Bacteria 1231
317 Ga0496102_0005141 3300048905 Bacteria 11098
318 Ga0496103_0143466 3300048906 Bacteria 1528
319 Ga0496104_0839748 3300048907 Bacteria 824
320 Ga0496104_1085287 3300048907 Bacteria 704
321 Ga0496106_0137715 3300048909 Bacteria 1918
322 Ga0496107_0338637 3300048910 Bacteria 1119
323 Ga0496112_0586423 3300048915 Bacteria 1047
324 Ga0501032_0080545 3300049569 Bacteria 2167
325 Ga0501033_0083063 3300049570 Bacteria 2348
326 Ga0501034_0162522 3300049571 Bacteria 2203
327 Ga0501036_1356824 3300049572 Bacteria 577
328 Ga0501037_0042510 3300049573 Bacteria 3339
329 Ga0501040_0515907 3300049576 Bacteria 862
330 Ga0501040_1357715 3300049576 Bacteria 516
331 Ga0501041_0345401 3300049577 Bacteria 940
332 Ga0501043_0010753 3300049579 Bacteria 7167
333 Ga0501046_0100957 3300049580 Bacteria 2214
334 Ga0501047_0019296 3300049581 Bacteria 6541
335 Ga0501068_0294229 3300049584 Bacteria 1039
336 Ga0501071_0655643 3300049587 Bacteria 808
337 Ga0501072_0134813 3300049588 Bacteria 1969
338 Ga0501072_1142482 3300049588 Bacteria 606
339 Ga0501075_0173764 3300049591 Bacteria 1644
340 Ga0501076_0102185 3300049592 Bacteria 2311
341 Ga0501079_0563993 3300049741 Bacteria 896
342 Ga0501080_0273729 3300049742 Bacteria 1536
343 Ga0501080_0878574 3300049742 Bacteria 782
344 Ga0501081_0145768 3300049743 Bacteria 1699
345 Ga0501081_0321939 3300049743 Bacteria 1137
346 Ga0501081_1127068 3300049743 Bacteria 594
347 Ga0501083_0000592 3300049744 Bacteria 23282
348 Ga0501035_0281538 3300049822 Bacteria 1405
349 nmdc:mga05p37_13779_c2 3300050507 Bacteria 1350
350 nmdc:mga05p37_677103_c1 3300050507 Bacteria 1150
351 nmdc:mga09592_313907_c1 3300050508 Bacteria 1358
352 nmdc:mga06r32_1194776_c1 3300050510 Bacteria 707
353 nmdc:mga06r32_995461_c1 3300050510 Bacteria 791
354 nmdc:mga08y16_546996_c1 3300050511 Bacteria 1172
355 nmdc:mga0n895_968692_c1 3300050512 Bacteria 833
356 nmdc:mga0rr50_30544_c1 3300050513 Bacteria 3816
357 nmdc:mga08x19_266_c1 3300050514 Bacteria 39583
358 nmdc:mga08x19_68643_c1 3300050514 Bacteria 2307
359 nmdc:mga08x19_752345_c1 3300050514 Bacteria 692
360 nmdc:mga0a205_466271_c1 3300050515 Bacteria 1122
361 nmdc:mga0a205_512192_c1 3300050515 Bacteria 1057
362 Ga0495601_0132745 3300053077 Bacteria 1622
363 Ga0495619_0227500 3300053085 Bacteria 1292
364 Ga0495619_0257546 3300053085 Bacteria 1209
365 Ga0501084_0146819 3300054114 Bacteria 1987
366 Ga0587066_173988 3300059490 Bacteria 550
367 Ga0587091_043419 3300059511 Bacteria 896
368 Ga0070705_100444683
369 Ga0058862_12634324
370 Ga0065712_10560859
371 Ga0070670_100212629
372 Ga0070677_10029433
373 Ga0068869_100045316
374 Ga0070689_100189182
375 Ga0070689_101036652
376 Ga0070668_100700749
377 Ga0070675_100000496
378 Ga0070673_100055996
379 Ga0070673_100069005
380 Ga0070667_100041928
381 Ga0070667_100513658
382 Ga0070703_10042231
383 Ga0070703_10125808
384 Ga0070709_10004858
385 Ga0070709_10007482
386 Ga0070709_10027780
387 Ga0070709_10151633
388 Ga0070709_10353010
389 Ga0070709_10932706
390 Ga0070714_100018168
391 Ga0070714_100199064
392 Ga0070714_100211837
393 Ga0070713_100148372
394 Ga0070713_100201000
395 Ga0070713_100482483
396 Ga0070710_11493046
397 Ga0070701_10045435
398 Ga0070711_100000635
399 Ga0070711_100043880
400 Ga0070711_100175291
401 Ga0070711_100295155
402 Ga0070705_100001775
403 Ga0070705_100049012
404 Ga0070694_100001732
405 Ga0070694_100003854
406 Ga0070694_100051319
407 Ga0070694_101604771
408 Ga0070708_100002809
409 Ga0070708_100065366
410 Ga0070662_100101282
411 Ga0070681_10631242
412 Ga0068867_100427369
413 Ga0068867_101439023
414 Ga0070685_10171484
415 Ga0070706_100008445
416 Ga0070707_100104951
417 Ga0070707_100263080
418 Ga0070707_100628154
419 Ga0070698_100026068
420 Ga0070698_100046716
421 Ga0070699_100022573
422 Ga0070699_100077611
423 Ga0070699_100252160
424 Ga0070699_100327807
425 Ga0070699_100561133
426 Ga0070679_100129854
427 Ga0070697_100001292
428 Ga0070697_100031076
429 Ga0070697_100060776
430 Ga0070686_100012107
431 Ga0070686_100476097
432 Ga0070695_100004735
433 Ga0070695_100007147
434 Ga0070695_100060156
435 Ga0070695_100078902
436 Ga0070695_100181642
437 Ga0070696_100004661
438 Ga0070696_100012996
439 Ga0070696_100037690
440 Ga0070693_100000103
441 Ga0070665_100104655
442 Ga0070704_100001246
443 Ga0070704_100005550
444 Ga0070704_100019141
445 Ga0070704_100589889
446 Ga0070664_100513341
447 Ga0068854_100710884
448 Ga0068856_101092117
449 Ga0070702_100637580
450 Ga0068859_100077832
451 Ga0068859_100778090
452 Ga0068859_102585881
453 Ga0068864_100043529
454 Ga0068864_100696832
455 Ga0068866_10073736
456 Ga0068866_10762433
457 Ga0068861_102623380
458 Ga0068870_10432524
459 Ga0068863_100042977
460 Ga0068863_100136923
461 Ga0068860_100003198
462 Ga0068860_101155483
463 Ga0068862_102383199
464 Ga0070717_10251518
465 Ga0070715_10208749
466 Ga0070716_100178934
467 Ga0070716_100507733
468 Ga0097621_100843578
469 Ga0075428_100784480
470 Ga0075428_101478224
471 Ga0075430_101222957
472 Ga0075431_100414501
473 Ga0075431_100437189
474 Ga0075434_100503189
475 Ga0075434_101010556
476 Ga0075429_100027159
477 Ga0068865_100271415
478 Ga0075436_100002254
479 Ga0075436_100059890
480 Ga0075436_100110555
481 Ga0097620_100077829
482 Ga0097620_100778068
483 Ga0097620_102585779
484 Ga0075435_100048215
485 Ga0099794_10009645
486 Ga0099794_10027443
487 Ga0099794_10035662
488 Ga0099794_10071350
489 Ga0099794_10187741
490 Ga0099794_10374745
491 Ga0099795_10246539
492 Ga0099795_10328367
493 Ga0111539_10715479
494 Ga0105245_10397005
495 Ga0105247_11792498
496 Ga0114129_10001609
497 Ga0114129_11106034
498 Ga0114129_11246181
499 Ga0105241_10986014
500 Ga0105242_11538008
501 Ga0105248_10066260
502 Ga0105248_11474764
503 Ga0105237_10416946
504 Ga0099796_10434733
505 Ga0105239_10184758
506 Ga0157374_11986751
507 Ga0157378_10000125
508 Ga0157378_11889773
509 Ga0163162_10001617
510 Ga0157375_10523145
511 Ga0157375_11055074
512 Ga0157375_12124545
513 Ga0163163_10002326
514 Ga0163163_11061745
515 Ga0157380_11463065
516 Ga0157377_10021813
517 Ga0157379_10381434
518 Ga0206356_11496176
519 Ga0224570_108179
520 Ga0224572_1015889
521 Ga0207653_10002450
522 Ga0207653_10158106
523 Ga0207682_10018040
524 Ga0207642_10242770
525 Ga0207699_10013130
526 Ga0207699_10024853
527 Ga0207699_10198092
528 Ga0207699_10886766
529 Ga0207684_10009470
530 Ga0207707_10548144
531 Ga0207671_10227520
532 Ga0207671_10738164
533 Ga0207663_10598155
534 Ga0207662_10444467
535 Ga0207657_10333223
536 Ga0207652_10104868
537 Ga0207646_10079328
538 Ga0207646_10456690
539 Ga0207646_10738042
540 Ga0207646_11065363
541 Ga0207681_11433283
542 Ga0207650_10071995
543 Ga0207659_10000167
544 Ga0207700_10010401
545 Ga0207700_10433762
546 Ga0207664_10086690
547 Ga0207664_10180780
548 Ga0207664_10841846
549 Ga0207706_10293283
550 Ga0207670_11432714
551 Ga0207669_10615558
552 Ga0207704_11780529
553 Ga0207665_10278390
554 Ga0207665_10398140
555 Ga0207665_10515476
556 Ga0207665_10661912
557 Ga0207689_10087342
558 Ga0207651_10128692
559 Ga0207668_10604375
560 Ga0207658_10249943
561 Ga0207658_10321930
562 Ga0207708_10609306
563 Ga0207641_10246097
564 Ga0207648_10370310
565 Ga0207676_10044265
566 Ga0207676_10485079
567 Ga0207676_12225748
568 Ga0207674_11856675
569 Ga0207675_100519367
570 Ga0209179_1004967
571 Ga0209588_1001419
572 Ga0209588_1018872
573 Ga0209588_1049574
574 Ga0209588_1144385
575 Ga0209588_1182769
576 Ga0265354_1000256
577 Ga0268265_11277251
578 Ga0268264_10009879
579 Ga0265338_10480383
580 Ga0265770_1001821
581 Ga0265765_1000907
582 Ga0265316_10256332
583 Ga0307508_10004466
584 Ga0316575_10477508
585 Ga0316576_10016707
586 Ga0316576_10048656
587 Ga0316578_10392291
588 Ga0307410_11833121
589 Ga0316580_10065605
590 Ga0316592_1016527
591 Ga0316588_1005562
592 Ga0316596_1177106
593 Ga0316212_1000575
594 Ga0373926_0002742
595 Ga0373944_0094998
596 Ga0373936_0159072
597 Ga0373936_0477916
598 Ga0373956_0354843
599 Ga0373943_0003762
600 Ga0373946_0003892
601 Ga0373946_0005443
602 Ga0373955_0047283
603 Ga0373955_0332792
604 Ga0373955_0752123
605 Ga0373961_0004248
606 Ga0316574_0195024
607 Ga0373924_0007005
608 Ga0373931_0742641
609 Ga0373935_0203981
610 Ga0373927_0003147
611 Ga0373927_0393646
612 Ga0373947_0019001
613 Ga0373947_0022531
614 Ga0373947_0797355
615 Ga0373937_0634864
616 Ga0373937_0955869
617 Ga0316582_0125515
618 Ga0316584_0699521
619 Ga0373925_0003026
620 Ga0373925_0944115
621 Ga0395898_1924965
622 Ga0316581_0141200
623 Ga0316581_0154461
624 Ga0436365_0588638
625 Ga0436365_0687517
626 Ga0436362_0334662
627 Ga0451805_063316
628 Ga0451807_1817762
629 Ga0451849_0128432
630 Ga0451853_1227995
631 Ga0439463_170201
632 Ga0439446_0292040
633 Ga0466963_0268461
634 Ga0453684_0000036
635 Ga0453684_0057261
636 Ga0466960_0108891
637 Ga0495592_0169356
638 Ga0495641_0024097
639 Ga0495580_0066143
640 Ga0495580_0068760
641 Ga0495580_0129011
642 Ga0495580_0345329
643 Ga0495580_0906422
644 Ga0495582_0091178
645 Ga0495639_0018024
646 Ga0495662_0091253
647 Ga0495664_0001840
648 Ga0495594_0004042
649 Ga0495618_0134553
650 Ga0495628_0100000
651 Ga0495628_0701342
652 Ga0495628_1120624
653 Ga0495630_0003216
654 Ga0495630_0006010
655 Ga0495630_0260389
656 Ga0495630_0592015
657 Ga0495666_0002207
658 Ga0495666_0050043
659 Ga0495666_0383897
660 Ga0495665_0225499
661 Ga0495640_0193868
662 Ga0495586_0003816
663 Ga0495587_0004849
664 Ga0495598_0037112
665 Ga0495621_0465998
666 Ga0495645_0006704
667 Ga0495634_0004582
668 Ga0495657_0675749
669 Ga0495599_0365814
670 Ga0495647_0009733
671 Ga0495658_0004506
672 Ga0495613_0026377
673 Ga0495624_0380169
674 Ga0495670_0438943
675 Ga0495600_0161225
676 Ga0495604_0587217
677 Ga0495636_0225175
678 Ga0495674_0001937
679 Ga0495676_0310654
680 Ga0495676_0892976
681 Ga0495680_0036113
682 Ga0495684_0205266
683 Ga0495684_0270006
684 Ga0496102_0005141
685 Ga0496103_0143466
686 Ga0496104_0839748
687 Ga0496104_1085287
688 Ga0496106_0137715
689 Ga0496107_0338637
690 Ga0496112_0586423
691 Ga0501032_0080545
692 Ga0501033_0083063
693 Ga0501034_0162522
694 Ga0501036_1356824
695 Ga0501037_0042510
696 Ga0501040_0515907
697 Ga0501040_1357715
698 Ga0501041_0345401
699 Ga0501043_0010753
700 Ga0501046_0100957
701 Ga0501047_0019296
702 Ga0501068_0294229
703 Ga0501071_0655643
704 Ga0501072_0134813
705 Ga0501072_1142482
706 Ga0501075_0173764
707 Ga0501076_0102185
708 Ga0501079_0563993
709 Ga0501080_0273729
710 Ga0501080_0878574
711 Ga0501081_0145768
712 Ga0501081_0321939
713 Ga0501081_1127068
714 Ga0501083_0000592
715 Ga0501035_0281538
716 nmdc:mga05p37_13779_c2
717 nmdc:mga05p37_677103_c1
718 nmdc:mga09592_313907_c1
719 nmdc:mga06r32_1194776_c1
720 nmdc:mga06r32_995461_c1
721 nmdc:mga08y16_546996_c1
722 nmdc:mga0n895_968692_c1
723 nmdc:mga0rr50_30544_c1
724 nmdc:mga08x19_266_c1
725 nmdc:mga08x19_68643_c1
726 nmdc:mga08x19_752345_c1
727 nmdc:mga0a205_466271_c1
728 nmdc:mga0a205_512192_c1
729 Ga0495601_0132745
730 Ga0495619_0227500
731 Ga0495619_0257546
732 Ga0501084_0146819
733 Ga0587066_173988
734 Ga0587091_043419

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01245

Ribosomal_L19

Ribosomal protein L19

2

112

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3j7y-assembly1.cif.gz_Q structure of the large ribosomal subunit from human mitochondria 0.8793 6 87
5aj4-assembly1.cif.gz_BT structure of the 55s mammalian mitoribosome. 0.8424 4 87
7nqh-assembly1.cif.gz_BT 55s mammalian mitochondrial ribosome with mtrf1a and p-site trnamet 0.8422 4 87
7nsh-assembly1.cif.gz_BT 39s mammalian mitochondrial large ribosomal subunit with mtrrf (post) and mtefg2 0.8421 4 87
7oia-assembly1.cif.gz_Q cryo-em structure of late human 39s mitoribosome assembly intermediates, state 3c 0.8406 4 87
ID Description Score Start End Superfamily
af_Q9TW27_328_406_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.8492 44 73 3.30.160.20
af_P9WKF7_3_423_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8402 41 72 3.50.50.60
2l33A00 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.7783 45 73 3.30.160.20
af_P9WHC9_4_113_2.30.30.790 Mainly Beta;Roll;SH3 type barrels.; 0.7704 5 109 2.30.30.790
af_C0P2I3_122_238_2.30.30.790 Mainly Beta;Roll;SH3 type barrels.; 0.7563 5 103 2.30.30.790
ID Description Score Start End GO Terms
AF-A0A662F966-F1-model_v4 deleted 0.9579 12 85
AF-A0A1Q7S5A4-F1-model_v4 50S ribosomal protein L19 0.9475 1 88 GO:0003735
GO:0006412
GO:0022625
AF-A0A662F966-F1-model_v4 deleted 0.9454 12 85
AF-A0A2V6KAW7-F1-model_v4 50S ribosomal protein L19 0.945 4 88 GO:0003735
GO:0006412
GO:0022625
AF-A0A1W6EGW6-F1-model_v4 Ribosomal protein L19 0.942 4 85 GO:0003735
GO:0005840
GO:0006412
GO:0009507
GO:1990904

Map