F424236

General Info

Members Datasets Scaffolds Average Seq Length
367 199 734 322

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10345672|Ga0070658_103456721
Length 369
Sequence MPATVPHVFRAEQALGLAYLTNDSILCYLLTMPMNKAENLWVALAAMLLALALAGGATAASHSTNLSLVAYSTPKTVLGKIVQAWQKTPDGRGVSVNQSYGASTDQARAVASGLEADLVFLSTGDDVNLLVDAGLVNANWNRQSYDGIAADTVVVFAVRNGNPKHIKSWADLIKPGVQVLTPNPFSSGSAKWNILAAYGAERRLGKTDKQATAYVKSLFQHVVAQDSSGRNATNTFLAGKGDVLITYESEAINSRLNGQDIQYVIPRQSMLIELPIAVTKNASDAGKANQLIRYVKGDTAQNLFAQYGFRPVVKSVLAKYGKQYPARPGIFKVDDKMIGGWRNADRVWFDPNKGRMVQIERAIGGPSSG

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
26 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
27 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
31 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
35 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
41 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
42 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
53 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
76 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
77 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
78 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
79 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
80 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
81 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
82 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
83 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
84 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
85 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
86 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
87 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
88 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
89 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
90 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
91 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
92 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
93 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
94 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
95 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
96 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
97 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
98 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
99 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
100 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
101 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
102 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
103 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
104 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
105 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
106 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
107 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
108 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
109 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
110 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
111 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
112 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
113 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
114 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
115 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
116 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
117 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
118 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
119 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
120 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
121 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
122 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
123 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
124 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
125 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
126 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
127 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
128 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
129 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
130 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
131 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
132 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
133 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
134 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
135 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
136 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
137 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
138 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
139 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
140 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
141 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
142 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
143 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
144 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
145 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
146 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
147 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
148 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
149 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
150 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
151 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
152 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
153 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
154 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
155 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
156 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
157 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
158 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
159 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
160 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
161 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
162 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
163 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
164 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
165 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
166 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
167 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
168 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
169 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
170 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
181 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
182 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
183 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
184 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
185 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
186 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
187 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
188 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
189 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
191 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
192 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
193 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
194 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
195 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
196 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
197 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
198 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
199 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.64
Metatranscriptomes 1.36
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.63
Nodule 0
Rhizoplane 10.35
Rhizosphere 87.19
Stem 0
Stem Tuber 0
Unclassified 0.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10345672 3300005327 Bacteria 1273
2 Ga0070658_10011680 3300005327 Bacteria 7044
3 Ga0070658_10048305 3300005327 Bacteria 3445
4 Ga0070658_10193048 3300005327 Bacteria 1717
5 Ga0070658_10448758 3300005327 Bacteria 1111
6 Ga0070683_100013305 3300005329 Bacteria 7173
7 Ga0070683_100016402 3300005329 Bacteria 6534
8 Ga0070683_100076564 3300005329 Bacteria 3127
9 Ga0070683_100078128 3300005329 Bacteria 3095
10 Ga0070683_100176795 3300005329 Bacteria 2026
11 Ga0070683_100304833 3300005329 Unclassified 1515
12 Ga0070680_100005608 3300005336 Bacteria 9506
13 Ga0070680_100257210 3300005336 Bacteria 1477
14 Ga0070682_100044561 3300005337 Bacteria 2747
15 Ga0068868_100049912 3300005338 Bacteria 3285
16 Ga0070660_100001494 3300005339 Bacteria 16003
17 Ga0070660_100006207 3300005339 Bacteria 8272
18 Ga0070660_100009678 3300005339 Bacteria 6789
19 Ga0070660_100096134 3300005339 Bacteria 2342
20 Ga0070661_100007123 3300005344 Bacteria 7712
21 Ga0070661_100061511 3300005344 Bacteria 2756
22 Ga0070661_100070385 3300005344 Bacteria 2573
23 Ga0070661_100204251 3300005344 Bacteria 1511
24 Ga0070661_100262455 3300005344 Bacteria 1336
25 Ga0070671_100048405 3300005355 Bacteria 3535
26 Ga0070671_100266981 3300005355 Bacteria 1454
27 Ga0070673_100151453 3300005364 Bacteria 1964
28 Ga0070667_100009403 3300005367 Bacteria 8109
29 Ga0070694_100150877 3300005444 Bacteria 1697
30 Ga0070681_10002766 3300005458 Bacteria 16191
31 Ga0070681_10008977 3300005458 Bacteria 9830
32 Ga0070681_10018486 3300005458 Bacteria 6966
33 Ga0070681_10036725 3300005458 Bacteria 4920
34 Ga0070681_10093318 3300005458 Bacteria 2959
35 Ga0070681_10097539 3300005458 Bacteria 2886
36 Ga0070681_10113301 3300005458 Bacteria 2651
37 Ga0070681_10177220 3300005458 Bacteria 2054
38 Ga0070681_10245694 3300005458 Bacteria 1702
39 Ga0070706_100367456 3300005467 Bacteria 1340
40 Ga0070679_100067414 3300005530 Bacteria 3569
41 Ga0070679_100071260 3300005530 Bacteria 3466
42 Ga0070679_100091889 3300005530 Bacteria 3022
43 Ga0070679_100125002 3300005530 Bacteria 2555
44 Ga0070679_100182062 3300005530 Bacteria 2073
45 Ga0070684_100001226 3300005535 Bacteria 18422
46 Ga0070684_100007665 3300005535 Bacteria 8417
47 Ga0070684_100066014 3300005535 Bacteria 3177
48 Ga0070684_100138850 3300005535 Bacteria 2197
49 Ga0070684_100219213 3300005535 Bacteria 1736
50 Ga0070684_100557738 3300005535 Bacteria 1063
51 Ga0068853_100483252 3300005539 Bacteria 1168
52 Ga0068855_100018060 3300005563 Bacteria 8475
53 Ga0068855_100066747 3300005563 Bacteria 4194
54 Ga0068855_100077474 3300005563 Bacteria 3857
55 Ga0068855_100095300 3300005563 Bacteria 3430
56 Ga0068855_100104301 3300005563 Bacteria 3261
57 Ga0068855_100164240 3300005563 Bacteria 2518
58 Ga0068855_100165777 3300005563 Bacteria 2505
59 Ga0068857_100008743 3300005577 Bacteria 8770
60 Ga0068857_100196581 3300005577 Bacteria 1838
61 Ga0068857_100494835 3300005577 Bacteria 1147
62 Ga0068854_100286931 3300005578 Unclassified 1327
63 Ga0068856_100204617 3300005614 Bacteria 1988
64 Ga0068852_100251952 3300005616 Bacteria 1692
65 Ga0068859_100474433 3300005617 Bacteria 1347
66 Ga0068870_10013357 3300005840 Bacteria 3858
67 Ga0081455_10062629 3300005937 Bacteria 3125
68 Ga0081455_10079832 3300005937 Bacteria 2685
69 Ga0075365_10048765 3300006038 Bacteria 2788
70 Ga0075363_100047596 3300006048 Bacteria 2278
71 Ga0075364_10023272 3300006051 Bacteria 3921
72 Ga0070712_100004608 3300006175 Bacteria 8519
73 Ga0075428_100230712 3300006844 Bacteria 1998
74 Ga0075434_100107091 3300006871 Bacteria 2805
75 Ga0097620_100474425 3300006931 Bacteria 1347
76 Ga0105240_10063740 3300009093 Bacteria 4583
77 Ga0105240_10182264 3300009093 Bacteria 2477
78 Ga0105240_10396039 3300009093 Bacteria 1556
79 Ga0105245_10302101 3300009098 Bacteria 1571
80 Ga0105241_10124917 3300009174 Bacteria 2077
81 Ga0105241_10228331 3300009174 Bacteria 1568
82 Ga0105242_10150465 3300009176 Bacteria 2029
83 Ga0105248_10428813 3300009177 Bacteria 1489
84 Ga0105237_10013298 3300009545 Bacteria 8632
85 Ga0105237_10120946 3300009545 Bacteria 2613
86 Ga0105238_10043857 3300009551 Bacteria 4524
87 Ga0105239_10062537 3300010375 Bacteria 4085
88 Ga0105246_10130229 3300011119 Bacteria 1878
89 Ga0157373_10034827 3300013100 Bacteria 3616
90 Ga0157373_10266869 3300013100 Bacteria 1212
91 Ga0157371_10135382 3300013102 Bacteria 1754
92 Ga0157370_10032977 3300013104 Bacteria 5051
93 Ga0157370_10083076 3300013104 Bacteria 3012
94 Ga0157370_10097940 3300013104 Bacteria 2751
95 Ga0157370_10148517 3300013104 Bacteria 2182
96 Ga0157370_10467203 3300013104 Bacteria 1159
97 Ga0157369_10000705 3300013105 Bacteria 43131
98 Ga0157369_10004218 3300013105 Bacteria 17021
99 Ga0157369_10014817 3300013105 Bacteria 8798
100 Ga0157369_10045038 3300013105 Bacteria 4800
101 Ga0157369_10097484 3300013105 Bacteria 3136
102 Ga0157369_10224333 3300013105 Bacteria 1966
103 Ga0157369_10430669 3300013105 Bacteria 1367
104 Ga0157374_10132688 3300013296 Bacteria 2411
105 Ga0157378_10401810 3300013297 Bacteria 1350
106 Ga0157372_10018459 3300013307 Bacteria 7497
107 Ga0157372_10128442 3300013307 Bacteria 2915
108 Ga0157372_10198316 3300013307 Bacteria 2325
109 Ga0157375_10253113 3300013308 Bacteria 1922
110 Ga0157375_10652253 3300013308 Bacteria 1209
111 Ga0206356_11552814 3300020070 Bacteria 1653
112 Ga0206354_10787991 3300020081 Bacteria 2016
113 Ga0206354_11498782 3300020081 Bacteria 2600
114 Ga0206353_10754471 3300020082 Bacteria 3570
115 Ga0206353_11982343 3300020082 Bacteria 4144
116 Ga0213871_10002463 3300021441 Bacteria 3410
117 Ga0207688_10045600 3300025901 Bacteria 2446
118 Ga0207643_10023261 3300025908 Bacteria 3417
119 Ga0207705_10020815 3300025909 Bacteria 4681
120 Ga0207705_10048129 3300025909 Bacteria 3066
121 Ga0207684_10142790 3300025910 Bacteria 2059
122 Ga0207707_10011148 3300025912 Bacteria 7820
123 Ga0207707_10072261 3300025912 Bacteria 3007
124 Ga0207707_10113993 3300025912 Bacteria 2362
125 Ga0207707_10123175 3300025912 Bacteria 2267
126 Ga0207707_10175506 3300025912 Bacteria 1872
127 Ga0207707_10219176 3300025912 Bacteria 1656
128 Ga0207695_10339558 3300025913 Bacteria 1390
129 Ga0207695_10437888 3300025913 Bacteria 1191
130 Ga0207671_10032977 3300025914 Bacteria 3855
131 Ga0207671_10102957 3300025914 Bacteria 2164
132 Ga0207693_10011588 3300025915 Bacteria 7133
133 Ga0207663_10083636 3300025916 Bacteria 2097
134 Ga0207657_10001335 3300025919 Bacteria 26208
135 Ga0207657_10003370 3300025919 Bacteria 17079
136 Ga0207657_10018289 3300025919 Bacteria 6700
137 Ga0207657_10026178 3300025919 Bacteria 5365
138 Ga0207657_10173812 3300025919 Bacteria 1744
139 Ga0207649_10007027 3300025920 Bacteria 6115
140 Ga0207649_10029054 3300025920 Bacteria 3262
141 Ga0207649_10110457 3300025920 Bacteria 1836
142 Ga0207652_10142903 3300025921 Bacteria 2140
143 Ga0207694_10058139 3300025924 Bacteria 3008
144 Ga0207650_10262721 3300025925 Bacteria 1401
145 Ga0207661_10001520 3300025944 Bacteria 15738
146 Ga0207661_10017303 3300025944 Bacteria 5330
147 Ga0207679_10532210 3300025945 Bacteria 1052
148 Ga0207667_10031916 3300025949 Bacteria 5681
149 Ga0207667_10086013 3300025949 Bacteria 3254
150 Ga0207667_10159518 3300025949 Bacteria 2320
151 Ga0207667_10159990 3300025949 Bacteria 2317
152 Ga0207667_10201179 3300025949 Bacteria 2043
153 Ga0207667_10374877 3300025949 Bacteria 1450
154 Ga0207651_10311373 3300025960 Bacteria 1313
155 Ga0207658_10007589 3300025986 Bacteria 7390
156 Ga0207678_10068016 3300026067 Bacteria 3057
157 Ga0207674_10033061 3300026116 Bacteria 5418
158 Ga0207674_10053531 3300026116 Bacteria 4113
159 Ga0207674_10351914 3300026116 Bacteria 1424
160 Ga0207683_10056548 3300026121 Bacteria 3442
161 Ga0265318_10014556 3300028577 Bacteria 3299
162 Ga0265322_10030005 3300028654 Bacteria 1553
163 Ga0265338_10014914 3300028800 Bacteria 8593
164 Ga0265338_10036102 3300028800 Bacteria 4737
165 Ga0265338_10086051 3300028800 Bacteria 2618
166 Ga0265324_10006618 3300029957 Bacteria 4799
167 Ga0265320_10050959 3300031240 Bacteria 2010
168 Ga0265325_10061296 3300031241 Bacteria 1908
169 Ga0265331_10055325 3300031250 Bacteria 1887
170 Ga0265327_10011417 3300031251 Bacteria 6115
171 Ga0265327_10030647 3300031251 Bacteria 3036
172 Ga0265316_10013819 3300031344 Bacteria 7149
173 Ga0265316_10103394 3300031344 Bacteria 2163
174 Ga0265313_10032479 3300031595 Bacteria 2664
175 Ga0265314_10008232 3300031711 Bacteria 8954
176 Ga0265342_10017023 3300031712 Bacteria 4735
177 Ga0307414_10146334 3300032004 Bacteria 1857
178 Ga0373926_0024100 3300035083 Bacteria 2117
179 Ga0373944_0003006 3300035089 Bacteria 4333
180 Ga0373936_0019736 3300035113 Bacteria 2613
181 Ga0373943_0000090 3300035170 Bacteria 33196
182 Ga0373943_0009647 3300035170 Bacteria 4325
183 Ga0373946_0018723 3300035171 Bacteria 2661
184 Ga0373924_0018259 3300035410 Bacteria 2700
185 Ga0373935_0251571 3300035692 Bacteria 1237
186 Ga0373933_0180458 3300035724 Bacteria 1346
187 Ga0373947_0000266 3300035725 Bacteria 29609
188 Ga0373947_0002409 3300035725 Bacteria 11298
189 Ga0373937_0542583 3300036401 Bacteria 1104
190 Ga0373925_0001866 3300037068 Bacteria 17533
191 Ga0373925_0041308 3300037068 Bacteria 3418
192 Ga0395900_0181716 3300037418 Bacteria 2137
193 Ga0395898_0014016 3300037466 Bacteria 8238
194 Ga0395898_0035123 3300037466 Bacteria 4989
195 Ga0395898_0090491 3300037466 Bacteria 2945
196 Ga0395905_0087320 3300037471 Bacteria 2924
197 Ga0395905_0181359 3300037471 Bacteria 1977
198 Ga0436364_1104074 3300037853 Bacteria 1089
199 Ga0395901_0007670 3300038443 Bacteria 10886
200 Ga0395901_0047817 3300038443 Bacteria 4442
201 Ga0395901_0090572 3300038443 Bacteria 3201
202 Ga0436360_0840221 3300039438 Bacteria 3966
203 Ga0436360_0894130 3300039438 Bacteria 3670
204 Ga0436363_0007242 3300039450 Bacteria 1529
205 Ga0436362_0616036 3300039453 Bacteria 3922
206 Ga0451791_0855959 3300041451 Bacteria 1652
207 Ga0451853_2410251 3300041512 Bacteria 1583
208 Ga0466969_0005491 3300044656 Bacteria 6743
209 Ga0466966_0014258 3300044684 Bacteria 5263
210 Ga0466966_0025747 3300044684 Bacteria 3843
211 Ga0466961_0020879 3300044693 Bacteria 4213
212 Ga0466961_0021493 3300044693 Bacteria 4152
213 Ga0466961_0150760 3300044693 Bacteria 1452
214 Ga0466963_0000247 3300044694 Bacteria 23573
215 Ga0466963_0023532 3300044694 Bacteria 3913
216 Ga0466963_0037973 3300044694 Bacteria 3148
217 Ga0466963_0091940 3300044694 Bacteria 2067
218 Ga0466964_0039531 3300044706 Bacteria 1901
219 Ga0466964_0059910 3300044706 Bacteria 1582
220 Ga0466971_0000265 3300044719 Bacteria 20105
221 Ga0466971_0001643 3300044719 Bacteria 9442
222 Ga0466971_0088941 3300044719 Bacteria 1413
223 Ga0466957_0000348 3300044842 Bacteria 22620
224 Ga0466957_0101745 3300044842 Bacteria 1812
225 Ga0466957_0151533 3300044842 Bacteria 1500
226 Ga0466960_0063316 3300044901 Bacteria 1820
227 Ga0466960_0108735 3300044901 Bacteria 1438
228 Ga0466959_0026653 3300045049 Bacteria 4284
229 Ga0466959_0042192 3300045049 Bacteria 3365
230 Ga0466959_0145437 3300045049 Bacteria 1673
231 Ga0466959_0157998 3300045049 Bacteria 1595
232 Ga0466958_0003549 3300045836 Bacteria 8114
233 Ga0466958_0105039 3300045836 Bacteria 1759
234 Ga0466958_0168491 3300045836 Bacteria 1386
235 Ga0466967_0001788 3300045976 Bacteria 12878
236 Ga0466967_0023061 3300045976 Bacteria 5094
237 Ga0466967_0023550 3300045976 Bacteria 5049
238 Ga0466967_0041299 3300045976 Bacteria 3976
239 Ga0466967_0044040 3300045976 Bacteria 3868
240 Ga0466967_0081706 3300045976 Bacteria 2919
241 Ga0466967_0103034 3300045976 Bacteria 2611
242 Ga0466967_0148532 3300045976 Bacteria 2188
243 Ga0466967_0170827 3300045976 Bacteria 2045
244 Ga0466967_0175338 3300045976 Bacteria 2020
245 Ga0466967_0704294 3300045976 Bacteria 1000
246 Ga0495592_0021259 3300046454 Bacteria 4934
247 Ga0495629_0002088 3300046459 Bacteria 15500
248 Ga0495641_0002960 3300046461 Bacteria 13075
249 Ga0495653_0021922 3300046463 Bacteria 5171
250 Ga0495653_0032140 3300046463 Bacteria 4170
251 Ga0495580_0207043 3300046472 Bacteria 1350
252 Ga0495582_0000205 3300046473 Bacteria 32805
253 Ga0495605_0034327 3300046474 Bacteria 2569
254 Ga0495639_0000856 3300046475 Bacteria 13796
255 Ga0495662_0034959 3300046476 Bacteria 2425
256 Ga0495664_0073098 3300046477 Bacteria 2050
257 Ga0495664_0083125 3300046477 Bacteria 1921
258 Ga0495608_0008031 3300046511 Bacteria 7416
259 Ga0495618_0032825 3300046514 Bacteria 3253
260 Ga0495618_0068806 3300046514 Bacteria 2251
261 Ga0495630_0023266 3300046517 Bacteria 4580
262 Ga0495630_0146866 3300046517 Bacteria 1793
263 Ga0495652_0033056 3300046529 Bacteria 4519
264 Ga0495652_0114950 3300046529 Bacteria 2158
265 Ga0495665_0054459 3300046531 Bacteria 2113
266 Ga0495645_0026487 3300046543 Bacteria 4209
267 Ga0495667_0059502 3300046559 Bacteria 2507
268 Ga0495667_0105833 3300046559 Bacteria 1818
269 Ga0495634_0038744 3300046642 Bacteria 3248
270 Ga0495634_0125635 3300046642 Bacteria 1639
271 Ga0495635_0069715 3300046663 Bacteria 2410
272 Ga0495635_0229749 3300046663 Bacteria 1253
273 Ga0495657_0011665 3300046675 Bacteria 6558
274 Ga0495623_0012460 3300046679 Bacteria 5501
275 Ga0495646_0131703 3300046680 Bacteria 1407
276 Ga0495647_0002559 3300046681 Bacteria 5763
277 Ga0495658_0054994 3300046683 Bacteria 2266
278 Ga0495624_0009874 3300046690 Bacteria 6602
279 Ga0495600_0032075 3300046809 Bacteria 3408
280 Ga0495600_0083093 3300046809 Bacteria 2090
281 Ga0495581_0036438 3300047315 Bacteria 2846
282 Ga0495604_0053063 3300047317 Bacteria 3136
283 Ga0495604_0069366 3300047317 Bacteria 2672
284 Ga0495604_0122043 3300047317 Bacteria 1885
285 Ga0495674_0014480 3300047319 Bacteria 7382
286 Ga0495674_0034205 3300047319 Bacteria 4596
287 Ga0495676_0080037 3300047321 Bacteria 2482
288 Ga0495680_0007917 3300047322 Bacteria 9691
289 Ga0495675_0011510 3300047444 Bacteria 5555
290 Ga0495684_0010019 3300047471 Bacteria 7327
291 Ga0495614_0070637 3300048089 Bacteria 1505
292 Ga0496100_0008880 3300048903 Bacteria 5623
293 Ga0496100_0015706 3300048903 Bacteria 4425
294 Ga0496101_0004149 3300048904 Bacteria 9076
295 Ga0496101_0008537 3300048904 Bacteria 6696
296 Ga0496101_0008544 3300048904 Bacteria 6691
297 Ga0496101_0155842 3300048904 Bacteria 1749
298 Ga0496102_0001674 3300048905 Bacteria 19466
299 Ga0496102_0070033 3300048905 Bacteria 3220
300 Ga0496102_0426201 3300048905 Bacteria 1246
301 Ga0496103_0022358 3300048906 Bacteria 3808
302 Ga0496103_0209559 3300048906 Bacteria 1253
303 Ga0496103_0267694 3300048906 Bacteria 1099
304 Ga0496104_0013525 3300048907 Bacteria 7353
305 Ga0496104_0040049 3300048907 Bacteria 4391
306 Ga0496104_0211891 3300048907 Bacteria 1849
307 Ga0496104_0289175 3300048907 Unclassified 1551
308 Ga0496105_0001400 3300048908 Bacteria 16942
309 Ga0496106_0003750 3300048909 Bacteria 11334
310 Ga0496107_0114409 3300048910 Bacteria 1985
311 Ga0496107_0128290 3300048910 Bacteria 1871
312 Ga0496107_0134222 3300048910 Bacteria 1828
313 Ga0496108_0025607 3300048911 Bacteria 4863
314 Ga0496109_0001613 3300048912 Bacteria 18839
315 Ga0496109_0005699 3300048912 Bacteria 10426
316 Ga0496110_0002365 3300048913 Bacteria 14122
317 Ga0496110_0024457 3300048913 Bacteria 5147
318 Ga0496110_0178504 3300048913 Bacteria 1928
319 Ga0496111_0001742 3300048914 Bacteria 12740
320 Ga0496111_0308911 3300048914 Bacteria 1172
321 Ga0496112_0030491 3300048915 Bacteria 5220
322 Ga0496113_0034013 3300048916 Bacteria 3716
323 Ga0496113_0166172 3300048916 Bacteria 1746
324 Ga0496114_0002146 3300048917 Bacteria 14999
325 Ga0496114_0072910 3300048917 Bacteria 2889
326 Ga0496115_0029908 3300048918 Bacteria 4282
327 Ga0496115_0075861 3300048918 Bacteria 2732
328 Ga0496115_0125349 3300048918 Bacteria 2115
329 Ga0501031_0005404 3300049568 Bacteria 8318
330 Ga0501031_0062179 3300049568 Bacteria 2433
331 Ga0501036_0125213 3300049572 Bacteria 2170
332 Ga0501036_0444041 3300049572 Bacteria 1081
333 Ga0501038_0360191 3300049574 Bacteria 1131
334 Ga0501038_0367911 3300049574 Bacteria 1117
335 Ga0501039_0028797 3300049575 Bacteria 4277
336 Ga0501039_0163508 3300049575 Bacteria 1750
337 Ga0501040_0078854 3300049576 Bacteria 2279
338 Ga0501041_0147058 3300049577 Bacteria 1470
339 Ga0501042_0019043 3300049578 Bacteria 4763
340 Ga0501046_0184342 3300049580 Bacteria 1559
341 Ga0501047_0006013 3300049581 Bacteria 11408
342 Ga0501047_0132709 3300049581 Bacteria 2370
343 Ga0501048_0146280 3300049582 Bacteria 1671
344 Ga0501069_0032870 3300049585 Bacteria 2856
345 Ga0501071_0008391 3300049587 Bacteria 6826
346 Ga0501072_0171797 3300049588 Bacteria 1730
347 Ga0501075_0007066 3300049591 Bacteria 7756
348 Ga0501076_0017977 3300049592 Bacteria 5379
349 Ga0501076_0123848 3300049592 Bacteria 2094
350 Ga0501077_0205041 3300049593 Bacteria 1253
351 Ga0501080_0026083 3300049742 Bacteria 5429
352 Ga0501081_0039900 3300049743 Bacteria 3214
353 Ga0501081_0245552 3300049743 Bacteria 1306
354 Ga0501083_0082464 3300049744 Bacteria 2131
355 Ga0501044_0284894 3300049823 Bacteria 1585
356 Ga0501045_0052350 3300049824 Bacteria 2980
357 nmdc:mga03n38_27877_c1 3300050490 Bacteria 2347
358 nmdc:mga00v17_122051_c1 3300050491 Bacteria 1660
359 nmdc:mga0yw44_13327_c1 3300050492 Bacteria 4325
360 nmdc:mga0rr50_103706_c1 3300050513 Bacteria 2239
361 Ga0495601_0085372 3300053077 Bacteria 2028
362 Ga0495595_0006454 3300053084 Bacteria 4785
363 Ga0495619_0038770 3300053085 Bacteria 3108
364 Ga0495619_0152623 3300053085 Bacteria 1593
365 Ga0501084_0054268 3300054114 Bacteria 3352
366 Ga0466962_0001498 3300061719 Bacteria 10900
367 Ga0466962_0032938 3300061719 Bacteria 2479
368 Ga0070658_10345672
369 Ga0070658_10011680
370 Ga0070658_10048305
371 Ga0070658_10193048
372 Ga0070658_10448758
373 Ga0070683_100013305
374 Ga0070683_100016402
375 Ga0070683_100076564
376 Ga0070683_100078128
377 Ga0070683_100176795
378 Ga0070683_100304833
379 Ga0070680_100005608
380 Ga0070680_100257210
381 Ga0070682_100044561
382 Ga0068868_100049912
383 Ga0070660_100001494
384 Ga0070660_100006207
385 Ga0070660_100009678
386 Ga0070660_100096134
387 Ga0070661_100007123
388 Ga0070661_100061511
389 Ga0070661_100070385
390 Ga0070661_100204251
391 Ga0070661_100262455
392 Ga0070671_100048405
393 Ga0070671_100266981
394 Ga0070673_100151453
395 Ga0070667_100009403
396 Ga0070694_100150877
397 Ga0070681_10002766
398 Ga0070681_10008977
399 Ga0070681_10018486
400 Ga0070681_10036725
401 Ga0070681_10093318
402 Ga0070681_10097539
403 Ga0070681_10113301
404 Ga0070681_10177220
405 Ga0070681_10245694
406 Ga0070706_100367456
407 Ga0070679_100067414
408 Ga0070679_100071260
409 Ga0070679_100091889
410 Ga0070679_100125002
411 Ga0070679_100182062
412 Ga0070684_100001226
413 Ga0070684_100007665
414 Ga0070684_100066014
415 Ga0070684_100138850
416 Ga0070684_100219213
417 Ga0070684_100557738
418 Ga0068853_100483252
419 Ga0068855_100018060
420 Ga0068855_100066747
421 Ga0068855_100077474
422 Ga0068855_100095300
423 Ga0068855_100104301
424 Ga0068855_100164240
425 Ga0068855_100165777
426 Ga0068857_100008743
427 Ga0068857_100196581
428 Ga0068857_100494835
429 Ga0068854_100286931
430 Ga0068856_100204617
431 Ga0068852_100251952
432 Ga0068859_100474433
433 Ga0068870_10013357
434 Ga0081455_10062629
435 Ga0081455_10079832
436 Ga0075365_10048765
437 Ga0075363_100047596
438 Ga0075364_10023272
439 Ga0070712_100004608
440 Ga0075428_100230712
441 Ga0075434_100107091
442 Ga0097620_100474425
443 Ga0105240_10063740
444 Ga0105240_10182264
445 Ga0105240_10396039
446 Ga0105245_10302101
447 Ga0105241_10124917
448 Ga0105241_10228331
449 Ga0105242_10150465
450 Ga0105248_10428813
451 Ga0105237_10013298
452 Ga0105237_10120946
453 Ga0105238_10043857
454 Ga0105239_10062537
455 Ga0105246_10130229
456 Ga0157373_10034827
457 Ga0157373_10266869
458 Ga0157371_10135382
459 Ga0157370_10032977
460 Ga0157370_10083076
461 Ga0157370_10097940
462 Ga0157370_10148517
463 Ga0157370_10467203
464 Ga0157369_10000705
465 Ga0157369_10004218
466 Ga0157369_10014817
467 Ga0157369_10045038
468 Ga0157369_10097484
469 Ga0157369_10224333
470 Ga0157369_10430669
471 Ga0157374_10132688
472 Ga0157378_10401810
473 Ga0157372_10018459
474 Ga0157372_10128442
475 Ga0157372_10198316
476 Ga0157375_10253113
477 Ga0157375_10652253
478 Ga0206356_11552814
479 Ga0206354_10787991
480 Ga0206354_11498782
481 Ga0206353_10754471
482 Ga0206353_11982343
483 Ga0213871_10002463
484 Ga0207688_10045600
485 Ga0207643_10023261
486 Ga0207705_10020815
487 Ga0207705_10048129
488 Ga0207684_10142790
489 Ga0207707_10011148
490 Ga0207707_10072261
491 Ga0207707_10113993
492 Ga0207707_10123175
493 Ga0207707_10175506
494 Ga0207707_10219176
495 Ga0207695_10339558
496 Ga0207695_10437888
497 Ga0207671_10032977
498 Ga0207671_10102957
499 Ga0207693_10011588
500 Ga0207663_10083636
501 Ga0207657_10001335
502 Ga0207657_10003370
503 Ga0207657_10018289
504 Ga0207657_10026178
505 Ga0207657_10173812
506 Ga0207649_10007027
507 Ga0207649_10029054
508 Ga0207649_10110457
509 Ga0207652_10142903
510 Ga0207694_10058139
511 Ga0207650_10262721
512 Ga0207661_10001520
513 Ga0207661_10017303
514 Ga0207679_10532210
515 Ga0207667_10031916
516 Ga0207667_10086013
517 Ga0207667_10159518
518 Ga0207667_10159990
519 Ga0207667_10201179
520 Ga0207667_10374877
521 Ga0207651_10311373
522 Ga0207658_10007589
523 Ga0207678_10068016
524 Ga0207674_10033061
525 Ga0207674_10053531
526 Ga0207674_10351914
527 Ga0207683_10056548
528 Ga0265318_10014556
529 Ga0265322_10030005
530 Ga0265338_10014914
531 Ga0265338_10036102
532 Ga0265338_10086051
533 Ga0265324_10006618
534 Ga0265320_10050959
535 Ga0265325_10061296
536 Ga0265331_10055325
537 Ga0265327_10011417
538 Ga0265327_10030647
539 Ga0265316_10013819
540 Ga0265316_10103394
541 Ga0265313_10032479
542 Ga0265314_10008232
543 Ga0265342_10017023
544 Ga0307414_10146334
545 Ga0373926_0024100
546 Ga0373944_0003006
547 Ga0373936_0019736
548 Ga0373943_0000090
549 Ga0373943_0009647
550 Ga0373946_0018723
551 Ga0373924_0018259
552 Ga0373935_0251571
553 Ga0373933_0180458
554 Ga0373947_0000266
555 Ga0373947_0002409
556 Ga0373937_0542583
557 Ga0373925_0001866
558 Ga0373925_0041308
559 Ga0395900_0181716
560 Ga0395898_0014016
561 Ga0395898_0035123
562 Ga0395898_0090491
563 Ga0395905_0087320
564 Ga0395905_0181359
565 Ga0436364_1104074
566 Ga0395901_0007670
567 Ga0395901_0047817
568 Ga0395901_0090572
569 Ga0436360_0840221
570 Ga0436360_0894130
571 Ga0436363_0007242
572 Ga0436362_0616036
573 Ga0451791_0855959
574 Ga0451853_2410251
575 Ga0466969_0005491
576 Ga0466966_0014258
577 Ga0466966_0025747
578 Ga0466961_0020879
579 Ga0466961_0021493
580 Ga0466961_0150760
581 Ga0466963_0000247
582 Ga0466963_0023532
583 Ga0466963_0037973
584 Ga0466963_0091940
585 Ga0466964_0039531
586 Ga0466964_0059910
587 Ga0466971_0000265
588 Ga0466971_0001643
589 Ga0466971_0088941
590 Ga0466957_0000348
591 Ga0466957_0101745
592 Ga0466957_0151533
593 Ga0466960_0063316
594 Ga0466960_0108735
595 Ga0466959_0026653
596 Ga0466959_0042192
597 Ga0466959_0145437
598 Ga0466959_0157998
599 Ga0466958_0003549
600 Ga0466958_0105039
601 Ga0466958_0168491
602 Ga0466967_0001788
603 Ga0466967_0023061
604 Ga0466967_0023550
605 Ga0466967_0041299
606 Ga0466967_0044040
607 Ga0466967_0081706
608 Ga0466967_0103034
609 Ga0466967_0148532
610 Ga0466967_0170827
611 Ga0466967_0175338
612 Ga0466967_0704294
613 Ga0495592_0021259
614 Ga0495629_0002088
615 Ga0495641_0002960
616 Ga0495653_0021922
617 Ga0495653_0032140
618 Ga0495580_0207043
619 Ga0495582_0000205
620 Ga0495605_0034327
621 Ga0495639_0000856
622 Ga0495662_0034959
623 Ga0495664_0073098
624 Ga0495664_0083125
625 Ga0495608_0008031
626 Ga0495618_0032825
627 Ga0495618_0068806
628 Ga0495630_0023266
629 Ga0495630_0146866
630 Ga0495652_0033056
631 Ga0495652_0114950
632 Ga0495665_0054459
633 Ga0495645_0026487
634 Ga0495667_0059502
635 Ga0495667_0105833
636 Ga0495634_0038744
637 Ga0495634_0125635
638 Ga0495635_0069715
639 Ga0495635_0229749
640 Ga0495657_0011665
641 Ga0495623_0012460
642 Ga0495646_0131703
643 Ga0495647_0002559
644 Ga0495658_0054994
645 Ga0495624_0009874
646 Ga0495600_0032075
647 Ga0495600_0083093
648 Ga0495581_0036438
649 Ga0495604_0053063
650 Ga0495604_0069366
651 Ga0495604_0122043
652 Ga0495674_0014480
653 Ga0495674_0034205
654 Ga0495676_0080037
655 Ga0495680_0007917
656 Ga0495675_0011510
657 Ga0495684_0010019
658 Ga0495614_0070637
659 Ga0496100_0008880
660 Ga0496100_0015706
661 Ga0496101_0004149
662 Ga0496101_0008537
663 Ga0496101_0008544
664 Ga0496101_0155842
665 Ga0496102_0001674
666 Ga0496102_0070033
667 Ga0496102_0426201
668 Ga0496103_0022358
669 Ga0496103_0209559
670 Ga0496103_0267694
671 Ga0496104_0013525
672 Ga0496104_0040049
673 Ga0496104_0211891
674 Ga0496104_0289175
675 Ga0496105_0001400
676 Ga0496106_0003750
677 Ga0496107_0114409
678 Ga0496107_0128290
679 Ga0496107_0134222
680 Ga0496108_0025607
681 Ga0496109_0001613
682 Ga0496109_0005699
683 Ga0496110_0002365
684 Ga0496110_0024457
685 Ga0496110_0178504
686 Ga0496111_0001742
687 Ga0496111_0308911
688 Ga0496112_0030491
689 Ga0496113_0034013
690 Ga0496113_0166172
691 Ga0496114_0002146
692 Ga0496114_0072910
693 Ga0496115_0029908
694 Ga0496115_0075861
695 Ga0496115_0125349
696 Ga0501031_0005404
697 Ga0501031_0062179
698 Ga0501036_0125213
699 Ga0501036_0444041
700 Ga0501038_0360191
701 Ga0501038_0367911
702 Ga0501039_0028797
703 Ga0501039_0163508
704 Ga0501040_0078854
705 Ga0501041_0147058
706 Ga0501042_0019043
707 Ga0501046_0184342
708 Ga0501047_0006013
709 Ga0501047_0132709
710 Ga0501048_0146280
711 Ga0501069_0032870
712 Ga0501071_0008391
713 Ga0501072_0171797
714 Ga0501075_0007066
715 Ga0501076_0017977
716 Ga0501076_0123848
717 Ga0501077_0205041
718 Ga0501080_0026083
719 Ga0501081_0039900
720 Ga0501081_0245552
721 Ga0501083_0082464
722 Ga0501044_0284894
723 Ga0501045_0052350
724 nmdc:mga03n38_27877_c1
725 nmdc:mga00v17_122051_c1
726 nmdc:mga0yw44_13327_c1
727 nmdc:mga0rr50_103706_c1
728 Ga0495601_0085372
729 Ga0495595_0006454
730 Ga0495619_0038770
731 Ga0495619_0152623
732 Ga0501084_0054268
733 Ga0466962_0001498
734 Ga0466962_0032938

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13531

SBP_bac_11

Bacterial extracellular solute-binding protein

66

310

0.89

PF13343

SBP_bac_6

Bacterial extracellular solute-binding protein

141

328

0.81

PF13416

SBP_bac_8

Bacterial extracellular solute-binding protein

80

332

0.76

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

70

302

0.68

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ddn-assembly2.cif.gz_B the sulfate-binding protein subi from mycobacterium tuberculosis h37rv 0.9653 29 315
6ddn-assembly2.cif.gz_B the sulfate-binding protein subi from mycobacterium tuberculosis h37rv 0.9588 29 315
1sbp-assembly1.cif.gz_A 1.7 angstroms refined structure of sulfate-binding protein involved in active transport and novel mode of sulfate binding 0.9348 29 325
5um2-assembly1.cif.gz_A functional and structural characterization of a sulfate-binding protein (sbp) from xanthomonas citri 0.916 30 326
1sbp-assembly1.cif.gz_A 1.7 angstroms refined structure of sulfate-binding protein involved in active transport and novel mode of sulfate binding 0.8969 29 325
ID Description Score Start End Superfamily
af_P71744_144_341_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9661 118 315 3.40.190.10
6ddnB02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9617 118 235 3.40.190.10
af_P71744_144_341_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9566 118 315 3.40.190.10
af_Q2FVX4_42_108_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9478 31 97 3.40.190.10
af_P0AG78_114_326_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9331 118 323 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A7Y6CEN3-F1-model_v4 Sulfate ABC transporter substrate-binding protein 0.993 72 334 GO:0042597
GO:1902358
AF-A0A7Y6CEN3-F1-model_v4 Sulfate ABC transporter substrate-binding protein 0.9856 72 334 GO:0042597
GO:1902358
AF-A0A5C4J6M7-F1-model_v4 Sulfate ABC transporter substrate-binding protein 0.9783 30 330 GO:0042597
GO:1902358
AF-A0A4R4XS67-F1-model_v4 Sulfate ABC transporter substrate-binding protein 0.9771 30 330 GO:0042597
GO:1902358
AF-A0A1V3XN32-F1-model_v4 Sulfate ABC transporter, sulfate-binding family protein 0.9698 27 330 GO:0042597
GO:1902358

Map