metagRoot

F424194

General Info

Members	Datasets	Scaffolds	Average Seq Length
366	262	348	160

Family's Representative Sequence

Representative Sequence	iso_pu_bacteria\|2883821847\|2883824064
Length	182
Sequence	QDLLEQDQLAQDQLDRASREGGAMRRAACPGSYDPPTRGHLDIIARTARQFDQVQVLVGNNRSKTGLFTPPERVELLAEACADLPGVEVQLFDGLLVDYCREHSIDCVVKGIRVAADFDYEMQMAQMNHRMTGIETVFMPAAAQWAYVSSSLVRDIARFGGEFDQFVTPEIAARTRQKLTKD

Samples

	Sample ID	Description	Type	Environment
1	2565956761	Rhodococcus qingshengii BKS 20-40	Isolate	Rhizosphere
2	2738541308	Rhodococcus sp. OK551	Isolate	Unclassified
3	2738543005	Rhodococcus sp. OK519	Isolate	Unclassified
4	2738543011	Rhodococcus sp. OK611	Isolate	Unclassified
5	2738543034	Rhodococcus sp. OK269	Isolate	Unclassified
6	2744054611	Aldersonia kunmingensis DSM 45001	Isolate	Rhizosphere
7	2816332119	Kribbella amoyensis DSM 24683	Isolate	Rhizosphere
8	2837268691	Jiangella endophytica KE2-3	Isolate	Rhizosphere
9	2883821847	Microlunatus elymi KUDC0627	Isolate	Rhizosphere
10	2889300758	Rhodococcus sp. PvR099	Isolate	Rhizosphere
11	2904535858	Rhodococcus erythropolis 2017	Isolate	Unclassified
12	2922554459	Rhodococcus sp. 66b	Isolate	Unclassified
13	2928142448	Prescottella equi DPS 2018	Isolate	Unclassified
14	2939743619	Rhodococcus sp. PvR044	Isolate	Rhizosphere
15	2956939328	Lolliginicoccus suaedae LNNU 331112	Isolate	Rhizosphere
16	2997451912	Streptomyces piniterrae jys28	Isolate	Rhizosphere
17	3001119090	Lolliginicoccus lacisalsi G463	Isolate	Rhizosphere
18	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
19	3300002067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1	Metagenome	Rhizosphere
20	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
21	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
22	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
23	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
24	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
25	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
26	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
27	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
28	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
29	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
30	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
31	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
32	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
33	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
34	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
35	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
36	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
37	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
38	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
39	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
40	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
41	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
42	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
43	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
44	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
45	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
46	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
47	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
48	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
49	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
50	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
51	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
52	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
53	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
54	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
55	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
56	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
57	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
58	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
59	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
60	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
61	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
62	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
63	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
64	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
65	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
66	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
67	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
68	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
69	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
70	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
71	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
72	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
73	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
74	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
75	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
76	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
77	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
78	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
79	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
80	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
81	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
82	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
83	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
84	3300009993	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG	Metagenome	Rhizosphere
85	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
86	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
87	3300012510	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610	Metagenome	Rhizosphere
88	3300012513	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510	Metagenome	Rhizosphere
89	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
90	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
91	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
92	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
93	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
94	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
95	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
96	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
97	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
98	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
99	3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
100	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
101	3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300027671	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
143	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300030733	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2	Metagenome	Rhizosphere
146	3300030736	Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6	Metagenome	Rhizosphere
147	3300030742	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9	Metagenome	Rhizosphere
148	3300030744	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7	Metagenome	Rhizosphere
149	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
150	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
151	3300031691	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA	Metagenome	Rhizosphere
152	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
153	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
154	3300031733	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1	Metagenome	Rhizosphere
155	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
156	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
157	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
158	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
159	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
160	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
161	3300032133	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA	Metagenome	Rhizosphere
162	3300032137	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC	Metagenome	Rhizosphere
163	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
164	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
165	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
166	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
167	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
168	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
169	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
170	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
171	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
172	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
173	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
174	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
175	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
176	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
177	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
178	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
179	3300041406	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284	Metagenome	Rhizosphere
180	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
181	3300041443	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG	Metagenome	Rhizoplane
182	3300041498	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG	Metagenome	Unclassified
183	3300042005	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216	Metagenome	Rhizosphere
184	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
185	3300042012	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213	Metagenome	Rhizosphere
186	3300042014	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275	Metagenome	Rhizosphere
187	3300042146	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979	Metagenome	Rhizosphere
188	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
189	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
190	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
191	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
192	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
193	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
194	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
195	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
196	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
197	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
198	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
199	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
200	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
201	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
202	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
203	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
204	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
205	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
206	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
207	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
208	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
209	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
210	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
211	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
212	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
213	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
214	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
215	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
216	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
217	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
218	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
219	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
220	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
221	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
222	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
223	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
224	3300047447	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere	Metagenome	Rhizosphere
225	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
226	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
227	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
228	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
229	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
230	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
231	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
232	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
233	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
234	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
235	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
236	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
237	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
238	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
239	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
240	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
241	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
242	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
243	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
244	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
245	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
246	3300049851	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought	Metagenome	Rhizosphere
247	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
248	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
249	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
250	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
251	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
252	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
253	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
254	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
255	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
256	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
257	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
258	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
259	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
260	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
261	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
262	8056054917	Glycomyces luteolus NEAU-A15	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	94.81
Metatranscriptomes	0.27
Isolates	4.92

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	6.56
Nodule	0
Rhizoplane	7.1
Rhizosphere	82.51
Stem	0
Stem Tuber	0
Unclassified	3.83

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24740J21852_10040523	3300001979	Bacteria	1411
2	JGI24735J21928_10133308	3300002067	Bacteria	716
3	JGI24735J21928_10158410	3300002067	Bacteria	654
4	rootH2_10048598	3300003320	Bacteria	2341
5	Ga0070658_10158275	3300005327	Bacteria	1899
6	Ga0070658_10203087	3300005327	Bacteria	1673
7	Ga0070683_100092017	3300005329	Bacteria	2848
8	Ga0070683_100818383	3300005329	Bacteria	893
9	Ga0070670_100522799	3300005331	Bacteria	1057
10	Ga0068869_100160576	3300005334	Unclassified	1749
11	Ga0070682_100058046	3300005337	Bacteria	2439
12	Ga0070660_100023944	3300005339	Bacteria	4528
13	Ga0070660_100270131	3300005339	Bacteria	1390
14	Ga0070660_100381381	3300005339	Bacteria	1164
15	Ga0070687_100787039	3300005343	Bacteria	673
16	Ga0070692_10076463	3300005345	Bacteria	1794
17	Ga0070674_100417516	3300005356	Bacteria	1100
18	Ga0070659_100337742	3300005366	Bacteria	1261
19	Ga0070659_100896941	3300005366	Bacteria	775
20	Ga0070667_100179430	3300005367	Bacteria	1872
21	Ga0070713_100001538	3300005436	Bacteria	14728
22	Ga0070710_10015598	3300005437	Bacteria	3850
23	Ga0070711_100252446	3300005439	Bacteria	1384
24	Ga0070705_100773892	3300005440	Bacteria	761
25	Ga0070700_100019855	3300005441	Bacteria	3883
26	Ga0070708_100054605	3300005445	Bacteria	3548
27	Ga0070708_100191820	3300005445	Bacteria	1911
28	Ga0070708_100583379	3300005445	Bacteria	1054
29	Ga0070708_101636825	3300005445	Bacteria	599
30	Ga0070678_100087504	3300005456	Bacteria	2379
31	Ga0070681_10170646	3300005458	Bacteria	2097
32	Ga0070706_100245510	3300005467	Bacteria	1672
33	Ga0070707_100073087	3300005468	Bacteria	3306
34	Ga0070707_100079264	3300005468	Bacteria	3169
35	Ga0070707_100164539	3300005468	Bacteria	2162
36	Ga0070698_100229406	3300005471	Bacteria	1790
37	Ga0070679_100026806	3300005530	Bacteria	5667
38	Ga0070684_100077723	3300005535	Bacteria	2931
39	Ga0070696_100048243	3300005546	Bacteria	2956
40	Ga0070696_100462878	3300005546	Bacteria	1003
41	Ga0070693_100011905	3300005547	Bacteria	4390
42	Ga0070693_100062003	3300005547	Bacteria	2176
43	Ga0070665_100469233	3300005548	Bacteria	1269
44	Ga0070665_101132366	3300005548	Bacteria	794
45	Ga0068855_100096432	3300005563	Bacteria	3407
46	Ga0070664_100168033	3300005564	Bacteria	1944
47	Ga0068857_100120503	3300005577	Bacteria	2362
48	Ga0068854_100043668	3300005578	Bacteria	3178
49	Ga0070702_100154100	3300005615	Archaea	1478
50	Ga0070702_100349662	3300005615	Bacteria	1041
51	Ga0070702_100408053	3300005615	Bacteria	974
52	Ga0068852_100176358	3300005616	Bacteria	2007
53	Ga0068864_100101785	3300005618	Bacteria	2549
54	Ga0068864_100505784	3300005618	Bacteria	1163
55	Ga0068861_101849614	3300005719	Bacteria	600
56	Ga0068860_100030097	3300005843	Bacteria	5222
57	Ga0081538_10000004	3300005981	Bacteria	194737
58	Ga0070717_10099640	3300006028	Bacteria	2466
59	Ga0075365_10069368	3300006038	Bacteria	2369
60	Ga0075368_10000414	3300006042	Bacteria	12548
61	Ga0075363_100005204	3300006048	Bacteria	5761
62	Ga0075363_100074990	3300006048	Bacteria	1843
63	Ga0075363_100168494	3300006048	Bacteria	1242
64	Ga0075364_10137579	3300006051	Bacteria	1642
65	Ga0070712_100095567	3300006175	Bacteria	2187
66	Ga0075367_10024051	3300006178	Bacteria	3434
67	Ga0075367_10115516	3300006178	Bacteria	1650
68	Ga0097621_100142693	3300006237	Bacteria	2048
69	Ga0075370_10020104	3300006353	Bacteria	3645
70	Ga0075370_10080919	3300006353	Bacteria	1867
71	Ga0075370_10643018	3300006353	Bacteria	644
72	Ga0068871_100419602	3300006358	Bacteria	1195
73	Ga0075428_100000535	3300006844	Bacteria	38719
74	Ga0075430_100000880	3300006846	Bacteria	23584
75	Ga0075431_100075996	3300006847	Bacteria	3466
76	Ga0075434_100676801	3300006871	Bacteria	1050
77	Ga0075429_100001129	3300006880	Bacteria	21525
78	Ga0068865_100184399	3300006881	Bacteria	1609
79	Ga0068865_100203939	3300006881	Bacteria	1537
80	Ga0068865_100514952	3300006881	Bacteria	1000
81	Ga0075436_100190990	3300006914	Bacteria	1449
82	Ga0099794_10007424	3300007265	Bacteria	4505
83	Ga0105245_10015497	3300009098	Bacteria	6646
84	Ga0105245_10135632	3300009098	Bacteria	2313
85	Ga0105245_10174710	3300009098	Bacteria	2048
86	Ga0105245_10250707	3300009098	Bacteria	1720
87	Ga0105245_11037160	3300009098	Archaea	865
88	Ga0114129_10210397	3300009147	Bacteria	2629
89	Ga0105243_10003587	3300009148	Bacteria	12523
90	Ga0105243_10049574	3300009148	Bacteria	3313
91	Ga0105243_10322331	3300009148	Bacteria	1409
92	Ga0105243_10728626	3300009148	Bacteria	970
93	Ga0105241_10659884	3300009174	Bacteria	951
94	Ga0105242_10114205	3300009176	Bacteria	2307
95	Ga0105242_10272485	3300009176	Archaea	1534
96	Ga0105242_11234661	3300009176	Bacteria	768
97	Ga0105248_10537053	3300009177	Bacteria	1319
98	Ga0105237_10170445	3300009545	Bacteria	2176
99	Ga0105237_11836765	3300009545	Bacteria	614
100	Ga0105238_11243450	3300009551	Bacteria	770
101	Ga0105028_108551	3300009993	Bacteria	1070
102	Ga0105239_10031014	3300010375	Bacteria	5881
103	Ga0105239_10993590	3300010375	Bacteria	965
104	Ga0105246_10000453	3300011119	Bacteria	22003
105	Ga0105246_10392238	3300011119	Bacteria	1150
106	Ga0157316_1007694	3300012510	Bacteria	922
107	Ga0157326_1079324	3300012513	Bacteria	534
108	Ga0157369_10230627	3300013105	Bacteria	1936
109	Ga0157374_10590596	3300013296	Bacteria	1120
110	Ga0157378_10857796	3300013297	Bacteria	937
111	Ga0163162_10203780	3300013306	Bacteria	2107
112	Ga0163162_10476506	3300013306	Archaea	1379
113	Ga0157372_10137229	3300013307	Bacteria	2817
114	Ga0157375_10162533	3300013308	Bacteria	2376
115	Ga0157375_10169621	3300013308	Bacteria	2329
116	Ga0157375_10291879	3300013308	Bacteria	1794
117	Ga0163163_10309356	3300014325	Bacteria	1633
118	Ga0163163_10986929	3300014325	Unclassified	905
119	Ga0163163_11719571	3300014325	Bacteria	688
120	Ga0182008_10194562	3300014497	Bacteria	1030
121	Ga0157377_10326058	3300014745	Bacteria	1022
122	Ga0157379_10031343	3300014968	Bacteria	4736
123	Ga0206353_10460254	3300020082	Bacteria	2326
124	Ga0213875_10070627	3300021388	Bacteria	1630
125	Ga0207653_10087418	3300025885	Bacteria	1088
126	Ga0207692_10014113	3300025898	Bacteria	3484
127	Ga0207642_10272414	3300025899	Bacteria	970
128	Ga0207688_10043736	3300025901	Bacteria	2495
129	Ga0207688_10697488	3300025901	Archaea	642
130	Ga0207647_10177007	3300025904	Bacteria	1241
131	Ga0207645_10098986	3300025907	Archaea	1880
132	Ga0207705_10002794	3300025909	Bacteria	13351
133	Ga0207705_10034509	3300025909	Bacteria	3617
134	Ga0207705_10151311	3300025909	Bacteria	1739
135	Ga0207684_10155903	3300025910	Bacteria	1965
136	Ga0207684_10280360	3300025910	Bacteria	1437
137	Ga0207707_10140348	3300025912	Bacteria	2113
138	Ga0207671_10302396	3300025914	Bacteria	1264
139	Ga0207693_10116336	3300025915	Bacteria	2099
140	Ga0207662_10771920	3300025918	Bacteria	676
141	Ga0207657_10176415	3300025919	Bacteria	1729
142	Ga0207657_10235211	3300025919	Bacteria	1464
143	Ga0207652_10072756	3300025921	Bacteria	2990
144	Ga0207646_10069038	3300025922	Bacteria	3156
145	Ga0207646_10199898	3300025922	Bacteria	1805
146	Ga0207646_10444592	3300025922	Bacteria	1170
147	Ga0207694_10474204	3300025924	Bacteria	1046
148	Ga0207687_10067797	3300025927	Bacteria	2539
149	Ga0207687_10124107	3300025927	Bacteria	1936
150	Ga0207687_10219625	3300025927	Bacteria	1496
151	Ga0207700_10003053	3300025928	Bacteria	9659
152	Ga0207664_10016978	3300025929	Bacteria	5324
153	Ga0207690_10233398	3300025932	Bacteria	1414
154	Ga0207690_10253776	3300025932	Bacteria	1360
155	Ga0207706_10135198	3300025933	Bacteria	2169
156	Ga0207686_10497710	3300025934	Archaea	945
157	Ga0207686_10754556	3300025934	Bacteria	777
158	Ga0207686_11150801	3300025934	Bacteria	634
159	Ga0207709_10399888	3300025935	Bacteria	1050
160	Ga0207670_10134815	3300025936	Bacteria	1814
161	Ga0207704_10108808	3300025938	Bacteria	1868
162	Ga0207704_10142404	3300025938	Bacteria	1679
163	Ga0207691_10127752	3300025940	Bacteria	2248
164	Ga0207711_10986962	3300025941	Bacteria	781
165	Ga0207661_10285282	3300025944	Bacteria	1476
166	Ga0207667_10079293	3300025949	Bacteria	3403
167	Ga0207640_10872569	3300025981	Archaea	784
168	Ga0207658_10099150	3300025986	Bacteria	2278
169	Ga0207639_10263099	3300026041	Bacteria	1509
170	Ga0207678_10763565	3300026067	Bacteria	853
171	Ga0207708_10018870	3300026075	Bacteria	5194
172	Ga0207702_10345766	3300026078	Bacteria	1422
173	Ga0207676_10042895	3300026095	Bacteria	3480
174	Ga0207676_10699015	3300026095	Bacteria	982
175	Ga0207674_10048798	3300026116	Bacteria	4331
176	Ga0207675_100046034	3300026118	Bacteria	4076
177	Ga0207675_101844458	3300026118	Bacteria	623
178	Ga0207683_10072308	3300026121	Bacteria	3050
179	Ga0207698_10440261	3300026142	Bacteria	1255
180	Ga0207698_11052186	3300026142	Bacteria	826
181	Ga0209588_1052453	3300027671	Bacteria	1319
182	Ga0209813_10000714	3300027866	Bacteria	7606
183	Ga0268266_10993076	3300028379	Bacteria	812
184	Ga0268264_10145716	3300028381	Bacteria	2117
185	Ga0314311_1223351	3300030733	Bacteria	696
186	Ga0316180_1175829	3300030736	Bacteria	821
187	Ga0316183_1157413	3300030742	Bacteria	1452
188	Ga0316181_1182988	3300030744	Bacteria	2152
189	Ga0307513_10000007	3300031456	Bacteria	451043
190	Ga0307408_100122964	3300031548	Bacteria	2013
191	Ga0316579_10149112	3300031691	Bacteria	1128
192	Ga0316576_10011718	3300031727	Bacteria	5761
193	Ga0307405_10166516	3300031731	Bacteria	1567
194	Ga0316577_10149202	3300031733	Bacteria	1318
195	Ga0307410_10582046	3300031852	Bacteria	931
196	Ga0307412_10143666	3300031911	Bacteria	1751
197	Ga0307409_100013874	3300031995	Bacteria	5210
198	Ga0307409_100026676	3300031995	Bacteria	4079
199	Ga0307414_10065650	3300032004	Bacteria	2590
200	Ga0307411_10394182	3300032005	Bacteria	1143
201	Ga0307411_10642643	3300032005	Bacteria	917
202	Ga0307415_100028882	3300032126	Bacteria	3536
203	Ga0316583_10131547	3300032133	Bacteria	872
204	Ga0316585_10049323	3300032137	Bacteria	1350
205	Ga0373926_0000224	3300035083	Bacteria	13414
206	Ga0373944_0000307	3300035089	Bacteria	10931
207	Ga0373936_0009113	3300035113	Bacteria	3742
208	Ga0373945_0000124	3300035116	Bacteria	19016
209	Ga0373943_0539337	3300035170	Bacteria	684
210	Ga0373955_0069870	3300035172	Bacteria	1961
211	Ga0316574_0078414	3300035398	Bacteria	2094
212	Ga0316574_0271645	3300035398	Bacteria	1081
213	Ga0373924_0000742	3300035410	Bacteria	10163
214	Ga0373931_0033931	3300035691	Bacteria	2646
215	Ga0373935_0000672	3300035692	Bacteria	18047
216	Ga0373927_0005074	3300035695	Bacteria	9109
217	Ga0373947_0000008	3300035725	Bacteria	182094
218	Ga0316582_0206046	3300036647	Bacteria	1343
219	Ga0316584_0000861	3300036712	Bacteria	17220
220	Ga0316584_0241915	3300036712	Bacteria	1320
221	Ga0373925_1374378	3300037068	Bacteria	579
222	Ga0436364_0418507	3300037853	Bacteria	4561
223	Ga0436364_0673393	3300037853	Bacteria	10689
224	Ga0439439_0005951	3300041406	Bacteria	2808
225	Ga0439466_0028592	3300041411	Bacteria	1924
226	Ga0451789_0825545	3300041443	Archaea	554
227	Ga0451841_1455482	3300041498	Bacteria	594
228	Ga0439448_0212785	3300042005	Bacteria	679
229	Ga0439449_0004592	3300042007	Bacteria	5337
230	Ga0439455_0143502	3300042012	Bacteria	677
231	Ga0439457_001110	3300042014	Bacteria	8118
232	Ga0450907_004513	3300042146	Bacteria	2396
233	Ga0450907_021865	3300042146	Bacteria	1076
234	Ga0466972_0054495	3300044658	Bacteria	1924
235	Ga0466972_0457881	3300044658	Bacteria	599
236	Ga0466965_0043377	3300044683	Bacteria	2220
237	Ga0466961_0290675	3300044693	Bacteria	999
238	Ga0466963_0061228	3300044694	Bacteria	2516
239	Ga0466963_0211130	3300044694	Bacteria	1358
240	Ga0466970_0125307	3300044765	Bacteria	1408
241	Ga0466957_0447448	3300044842	Bacteria	890
242	Ga0466960_0003570	3300044901	Bacteria	5999
243	Ga0466960_0027878	3300044901	Bacteria	2581
244	Ga0466960_0470332	3300044901	Bacteria	733
245	Ga0466967_0101116	3300045976	Bacteria	2634
246	Ga0495603_0003127	3300046455	Bacteria	9843
247	Ga0495603_0113934	3300046455	Bacteria	1577
248	Ga0495603_0262916	3300046455	Bacteria	993
249	Ga0495603_0627642	3300046455	Bacteria	615
250	Ga0495629_0194792	3300046459	Bacteria	1402
251	Ga0495641_0149534	3300046461	Bacteria	1043
252	Ga0495653_0119088	3300046463	Bacteria	1885
253	Ga0495653_0151986	3300046463	Bacteria	1616
254	Ga0495653_0185706	3300046463	Bacteria	1423
255	Ga0495580_0058585	3300046472	Bacteria	2709
256	Ga0495580_0164418	3300046472	Bacteria	1535
257	Ga0495639_0066932	3300046475	Unclassified	1654
258	Ga0495662_0000204	3300046476	Bacteria	24542
259	Ga0495584_0338259	3300046491	Bacteria	764
260	Ga0495594_0139156	3300046499	Bacteria	1376
261	Ga0495607_0294378	3300046501	Bacteria	766
262	Ga0495630_1010419	3300046517	Bacteria	632
263	Ga0495642_0284413	3300046528	Bacteria	724
264	Ga0495665_0042080	3300046531	Bacteria	2432
265	Ga0495665_0151303	3300046531	Bacteria	1211
266	Ga0495665_0198025	3300046531	Bacteria	1041
267	Ga0495640_0003778	3300046533	Bacteria	12148
268	Ga0495640_0639198	3300046533	Bacteria	641
269	Ga0495586_0007659	3300046535	Bacteria	5756
270	Ga0495586_0755576	3300046535	Bacteria	561
271	Ga0495645_0503887	3300046543	Bacteria	756
272	Ga0495656_0407368	3300046615	Bacteria	712
273	Ga0495668_0000573	3300046616	Bacteria	45058
274	Ga0495634_0161754	3300046642	Bacteria	1411
275	Ga0495588_0015148	3300046674	Bacteria	3704
276	Ga0495588_0027476	3300046674	Bacteria	2844
277	Ga0495588_0074539	3300046674	Bacteria	1767
278	Ga0495623_0091822	3300046679	Bacteria	1862
279	Ga0495623_0691698	3300046679	Bacteria	523
280	Ga0495658_0346730	3300046683	Bacteria	943
281	Ga0495613_0191710	3300046689	Bacteria	1444
282	Ga0495589_0258365	3300046794	Bacteria	813
283	Ga0495581_0019417	3300047315	Bacteria	3945
284	Ga0495581_0021188	3300047315	Bacteria	3770
285	Ga0495604_0004121	3300047317	Bacteria	11547
286	Ga0495636_0283622	3300047318	Bacteria	772
287	Ga0495676_0022579	3300047321	Bacteria	5472
288	Ga0495676_0242190	3300047321	Bacteria	1234
289	Ga0495685_009876	3300047447	Bacteria	3195
290	Ga0496100_0731119	3300048903	Bacteria	773
291	Ga0496101_0397433	3300048904	Bacteria	1085
292	Ga0496102_0022312	3300048905	Bacteria	5609
293	Ga0496102_0273635	3300048905	Bacteria	1592
294	Ga0496102_0753746	3300048905	Unclassified	896
295	Ga0496103_0032978	3300048906	Bacteria	3163
296	Ga0496103_0995274	3300048906	Bacteria	522
297	Ga0496106_0081901	3300048909	Bacteria	2480
298	Ga0496106_0601280	3300048909	Bacteria	881
299	Ga0496107_0688836	3300048910	Bacteria	752
300	Ga0496108_0025318	3300048911	Bacteria	4890
301	Ga0496108_0043277	3300048911	Bacteria	3762
302	Ga0496108_0133969	3300048911	Bacteria	2130
303	Ga0496108_0228956	3300048911	Bacteria	1616
304	Ga0496109_0083925	3300048912	Bacteria	2938
305	Ga0496109_0099643	3300048912	Bacteria	2695
306	Ga0496109_0495683	3300048912	Bacteria	1153
307	Ga0496110_0000703	3300048913	Bacteria	23096
308	Ga0496110_0040683	3300048913	Bacteria	4052
309	Ga0496110_0130352	3300048913	Bacteria	2270
310	Ga0496111_0070099	3300048914	Bacteria	2549
311	Ga0496111_0306002	3300048914	Bacteria	1178
312	Ga0496113_0106189	3300048916	Bacteria	2181
313	Ga0496113_0426842	3300048916	Bacteria	1065
314	Ga0496114_0655241	3300048917	Bacteria	923
315	Ga0496125_0017077	3300048928	Bacteria	6934
316	Ga0501031_0214252	3300049568	Bacteria	1255
317	Ga0501041_0144217	3300049577	Bacteria	1486
318	Ga0501042_0140850	3300049578	Bacteria	1739
319	Ga0501067_0491574	3300049583	Bacteria	686
320	Ga0501069_0333393	3300049585	Bacteria	893
321	Ga0501076_0029802	3300049592	Bacteria	4246
322	Ga0501044_0146310	3300049823	Bacteria	2348
323	Ga0501045_0275960	3300049824	Bacteria	1251
324	Ga0501045_0323448	3300049824	Bacteria	1148
325	Ga0501212_003164	3300049851	Bacteria	2045
326	nmdc:mga03683_64616_c1	3300050489	Bacteria	1553
327	nmdc:mga03n38_187950_c1	3300050490	Bacteria	1062
328	nmdc:mga03n38_441223_c1	3300050490	Bacteria	723
329	nmdc:mga00v17_14226_c1	3300050491	Bacteria	4437
330	nmdc:mga00v17_271612_c1	3300050491	Bacteria	1100
331	nmdc:mga06z11_13455_c1	3300050494	Bacteria	3594
332	nmdc:mga06z11_15152_c1	3300050494	Bacteria	3434
333	nmdc:mga04h51_2152_c1	3300050495	Bacteria	4614
334	nmdc:mga07m45_161109_c1	3300050496	Bacteria	1302
335	nmdc:mga07m45_212469_c1	3300050496	Bacteria	1125
336	nmdc:mga07m45_27490_c1	3300050496	Bacteria	3134
337	nmdc:mga07m45_525726_c1	3300050496	Bacteria	685
338	nmdc:mga05p37_187944_c1	3300050507	Bacteria	2510
339	nmdc:mga05p37_238_c1	3300050507	Bacteria	56124
340	nmdc:mga09592_40005_c1	3300050508	Bacteria	3939
341	nmdc:mga0qj67_23695_c1	3300050509	Bacteria	4724
342	nmdc:mga06r32_351143_c1	3300050510	Bacteria	1459
343	nmdc:mga06r32_44933_c1	3300050510	Bacteria	4209
344	nmdc:mga0n895_454794_c1	3300050512	Bacteria	1292
345	nmdc:mga08x19_76189_c1	3300050514	Bacteria	2194
346	Ga0495595_0125104	3300053084	Bacteria	1254
347	Ga0501084_0206492	3300054114	Bacteria	1658
348	Ga0501082_0732269	3300060353	Bacteria	865

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300025940	Ga0207691_10127752	Ga0207691_101277524	137
2	3300014325	Ga0163163_10309356	Ga0163163_103093563	140
3	3300009545	Ga0105237_11836765	Ga0105237_118367651	146
4	3300031456	Ga0307513_10000007	Ga0307513_10000007149	146
5	3300035083	Ga0373926_0000224	Ga0373926_0000224_2295_2738	146
6	3300035398	Ga0316574_0078414	Ga0316574_0078414_471_929	146
7	3300035692	Ga0373935_0000672	Ga0373935_0000672_17155_17598	146
8	3300035725	Ga0373947_0000008	Ga0373947_0000008_152142_152585	146
9	3300036647	Ga0316582_0206046	Ga0316582_0206046_268_726	146
10	3300036712	Ga0316584_0000861	Ga0316584_0000861_8847_9305	146
11	3300037853	Ga0436364_0673393	Ga0436364_0673393_8812_9255	146
12	3300044901	Ga0466960_0003570	Ga0466960_0003570_4917_5369	146
13	3300048912	Ga0496109_0495683	Ga0496109_0495683_670_1125	146
14	3300050490	nmdc:mga03n38_187950_c1	nmdc:mga03n38_187950_c1_27_479	146
15	3300006914	Ga0075436_100190990	Ga0075436_1001909902	148
16	3300050514	nmdc:mga08x19_76189_c1	nmdc:mga08x19_76189_c1_1088_1564	148
17	iso_pu_bacteria	2816332119	2816428005	152
18	3300035398	Ga0316574_0271645	Ga0316574_0271645_327_794	154
19	3300036712	Ga0316584_0241915	Ga0316584_0241915_293_760	154
20	iso_pu_bacteria	2565956761	2566993103	154
21	iso_pu_bacteria	2738541308	2738889934	154
22	iso_pu_bacteria	2738543005	2739203241	154
23	iso_pu_bacteria	2738543011	2739238679	154
24	iso_pu_bacteria	2738543034	2739362223	154
25	iso_pu_bacteria	2744054611	2744953901	154
26	iso_pu_bacteria	2837268691	2837272894	154
27	iso_pu_bacteria	2889300758	2889300950	154
28	iso_pu_bacteria	2904535858	2904538903	154
29	iso_pu_bacteria	2922554459	2922556799	154
30	iso_pu_bacteria	2928142448	2928142534	154
31	iso_pu_bacteria	2939743619	2939744471	154
32	iso_pu_bacteria	2956939328	2956939420	154
33	iso_pu_bacteria	3001119090	3001122204	154
34	3300046533	Ga0495640_0639198	Ga0495640_0639198_70_540	155
35	3300048906	Ga0496103_0032978	Ga0496103_0032978_1841_2350	156
36	3300002067	JGI24735J21928_10158410	JGI24735J21928_101584102	157
37	3300005327	Ga0070658_10158275	Ga0070658_101582753	157
38	3300005329	Ga0070683_100092017	Ga0070683_1000920172	157
39	3300005331	Ga0070670_100522799	Ga0070670_1005227992	157
40	3300005337	Ga0070682_100058046	Ga0070682_1000580461	157
41	3300005339	Ga0070660_100023944	Ga0070660_1000239444	157
42	3300005339	Ga0070660_100381381	Ga0070660_1003813812	157
43	3300005343	Ga0070687_100787039	Ga0070687_1007870391	157
44	3300005345	Ga0070692_10076463	Ga0070692_100764632	157
45	3300005366	Ga0070659_100337742	Ga0070659_1003377422	157
46	3300005367	Ga0070667_100179430	Ga0070667_1001794301	157
47	3300005445	Ga0070708_100191820	Ga0070708_1001918202	157
48	3300005456	Ga0070678_100087504	Ga0070678_1000875043	157
49	3300005535	Ga0070684_100077723	Ga0070684_1000777233	157
50	3300005547	Ga0070693_100062003	Ga0070693_1000620033	157
51	3300005548	Ga0070665_101132366	Ga0070665_1011323661	157
52	3300005563	Ga0068855_100096432	Ga0068855_1000964326	157
53	3300005564	Ga0070664_100168033	Ga0070664_1001680331	157
54	3300005577	Ga0068857_100120503	Ga0068857_1001205033	157
55	3300005615	Ga0070702_100349662	Ga0070702_1003496621	157
56	3300005616	Ga0068852_100176358	Ga0068852_1001763583	157
57	3300005618	Ga0068864_100101785	Ga0068864_1001017854	157
58	3300005719	Ga0068861_101849614	Ga0068861_1018496141	157
59	3300005843	Ga0068860_100030097	Ga0068860_1000300971	157
60	3300005981	Ga0081538_10000004	Ga0081538_10000004147	157
61	3300006038	Ga0075365_10069368	Ga0075365_100693683	157
62	3300006237	Ga0097621_100142693	Ga0097621_1001426932	157
63	3300006358	Ga0068871_100419602	Ga0068871_1004196021	157
64	3300006871	Ga0075434_100676801	Ga0075434_1006768011	157
65	3300006881	Ga0068865_100203939	Ga0068865_1002039392	157
66	3300006881	Ga0068865_100514952	Ga0068865_1005149521	157
67	3300009098	Ga0105245_10174710	Ga0105245_101747103	157
68	3300009098	Ga0105245_10250707	Ga0105245_102507072	157
69	3300009148	Ga0105243_10322331	Ga0105243_103223312	157
70	3300009176	Ga0105242_11234661	Ga0105242_112346612	157
71	3300009551	Ga0105238_11243450	Ga0105238_112434502	157
72	3300010375	Ga0105239_10031014	Ga0105239_100310141	157
73	3300010375	Ga0105239_10993590	Ga0105239_109935901	157
74	3300011119	Ga0105246_10000453	Ga0105246_1000045310	157
75	3300013105	Ga0157369_10230627	Ga0157369_102306273	157
76	3300013306	Ga0163162_10203780	Ga0163162_102037801	157
77	3300013307	Ga0157372_10137229	Ga0157372_101372293	157
78	3300013308	Ga0157375_10291879	Ga0157375_102918791	157
79	3300014325	Ga0163163_11719571	Ga0163163_117195711	157
80	3300014497	Ga0182008_10194562	Ga0182008_101945622	157
81	3300014745	Ga0157377_10326058	Ga0157377_103260581	157
82	3300014968	Ga0157379_10031343	Ga0157379_100313432	157
83	3300025899	Ga0207642_10272414	Ga0207642_102724141	157
84	3300025901	Ga0207688_10043736	Ga0207688_100437363	157
85	3300025909	Ga0207705_10034509	Ga0207705_100345092	157
86	3300025914	Ga0207671_10302396	Ga0207671_103023962	157
87	3300025918	Ga0207662_10771920	Ga0207662_107719201	157
88	3300025919	Ga0207657_10176415	Ga0207657_101764153	157
89	3300025924	Ga0207694_10474204	Ga0207694_104742042	157
90	3300025927	Ga0207687_10124107	Ga0207687_101241071	157
91	3300025932	Ga0207690_10233398	Ga0207690_102333981	157
92	3300025934	Ga0207686_10754556	Ga0207686_107545562	157
93	3300025934	Ga0207686_11150801	Ga0207686_111508011	157
94	3300025935	Ga0207709_10399888	Ga0207709_103998881	157
95	3300025936	Ga0207670_10134815	Ga0207670_101348153	157
96	3300025938	Ga0207704_10142404	Ga0207704_101424043	157
97	3300025944	Ga0207661_10285282	Ga0207661_102852821	157
98	3300025949	Ga0207667_10079293	Ga0207667_100792936	157
99	3300025986	Ga0207658_10099150	Ga0207658_100991503	157
100	3300026041	Ga0207639_10263099	Ga0207639_102630993	157
101	3300026078	Ga0207702_10345766	Ga0207702_103457661	157
102	3300026095	Ga0207676_10042895	Ga0207676_100428953	157
103	3300026116	Ga0207674_10048798	Ga0207674_100487985	157
104	3300026118	Ga0207675_101844458	Ga0207675_1018444581	157
105	3300026121	Ga0207683_10072308	Ga0207683_100723083	157
106	3300026142	Ga0207698_10440261	Ga0207698_104402612	157
107	3300028381	Ga0268264_10145716	Ga0268264_101457163	157
108	3300046615	Ga0495656_0407368	Ga0495656_0407368_123_596	157
109	3300048905	Ga0496102_0022312	Ga0496102_0022312_3319_3792	157
110	3300048906	Ga0496103_0995274	Ga0496103_0995274_26_499	157
111	3300048909	Ga0496106_0081901	Ga0496106_0081901_174_647	157
112	3300048911	Ga0496108_0133969	Ga0496108_0133969_1592_2065	157
113	3300048912	Ga0496109_0083925	Ga0496109_0083925_734_1207	157
114	3300048913	Ga0496110_0000703	Ga0496110_0000703_22012_22485	157
115	3300048914	Ga0496111_0070099	Ga0496111_0070099_1902_2375	157
116	3300048916	Ga0496113_0106189	Ga0496113_0106189_1674_2147	157
117	3300049585	Ga0501069_0333393	Ga0501069_0333393_250_723	157
118	3300050512	nmdc:mga0n895_454794_c1	nmdc:mga0n895_454794_c1_631_1104	157
119	3300001979	JGI24740J21852_10040523	JGI24740J21852_100405232	158
120	3300002067	JGI24735J21928_10133308	JGI24735J21928_101333082	158
121	3300003320	rootH2_10048598	rootH2_100485984	158
122	3300005327	Ga0070658_10203087	Ga0070658_102030871	158
123	3300005329	Ga0070683_100818383	Ga0070683_1008183831	158
124	3300005334	Ga0068869_100160576	Ga0068869_1001605763	158
125	3300005339	Ga0070660_100270131	Ga0070660_1002701311	158
126	3300005356	Ga0070674_100417516	Ga0070674_1004175162	158
127	3300005366	Ga0070659_100896941	Ga0070659_1008969411	158
128	3300005436	Ga0070713_100001538	Ga0070713_10000153814	158
129	3300005437	Ga0070710_10015598	Ga0070710_100155983	158
130	3300005439	Ga0070711_100252446	Ga0070711_1002524461	158
131	3300005440	Ga0070705_100773892	Ga0070705_1007738922	158
132	3300005441	Ga0070700_100019855	Ga0070700_1000198552	158
133	3300005445	Ga0070708_100054605	Ga0070708_1000546053	158
134	3300005445	Ga0070708_100583379	Ga0070708_1005833792	158
135	3300005445	Ga0070708_101636825	Ga0070708_1016368251	158
136	3300005458	Ga0070681_10170646	Ga0070681_101706462	158
137	3300005467	Ga0070706_100245510	Ga0070706_1002455103	158
138	3300005468	Ga0070707_100073087	Ga0070707_1000730874	158
139	3300005468	Ga0070707_100079264	Ga0070707_1000792642	158
140	3300005468	Ga0070707_100164539	Ga0070707_1001645392	158
141	3300005471	Ga0070698_100229406	Ga0070698_1002294063	158
142	3300005530	Ga0070679_100026806	Ga0070679_1000268063	158
143	3300005546	Ga0070696_100048243	Ga0070696_1000482435	158
144	3300005546	Ga0070696_100462878	Ga0070696_1004628782	158
145	3300005547	Ga0070693_100011905	Ga0070693_1000119053	158
146	3300005548	Ga0070665_100469233	Ga0070665_1004692332	158
147	3300005578	Ga0068854_100043668	Ga0068854_1000436683	158
148	3300005615	Ga0070702_100154100	Ga0070702_1001541002	158
149	3300005615	Ga0070702_100408053	Ga0070702_1004080532	158
150	3300005618	Ga0068864_100505784	Ga0068864_1005057842	158
151	3300006028	Ga0070717_10099640	Ga0070717_100996402	158
152	3300006042	Ga0075368_10000414	Ga0075368_100004146	158
153	3300006048	Ga0075363_100005204	Ga0075363_1000052042	158
154	3300006048	Ga0075363_100074990	Ga0075363_1000749902	158
155	3300006048	Ga0075363_100168494	Ga0075363_1001684942	158
156	3300006051	Ga0075364_10137579	Ga0075364_101375792	158
157	3300006175	Ga0070712_100095567	Ga0070712_1000955674	158
158	3300006178	Ga0075367_10024051	Ga0075367_100240515	158
159	3300006178	Ga0075367_10115516	Ga0075367_101155162	158
160	3300006353	Ga0075370_10020104	Ga0075370_100201043	158
161	3300006353	Ga0075370_10080919	Ga0075370_100809192	158
162	3300006353	Ga0075370_10643018	Ga0075370_106430181	158
163	3300006844	Ga0075428_100000535	Ga0075428_10000053514	158
164	3300006846	Ga0075430_100000880	Ga0075430_10000088019	158
165	3300006847	Ga0075431_100075996	Ga0075431_1000759964	158
166	3300006880	Ga0075429_100001129	Ga0075429_10000112916	158
167	3300006881	Ga0068865_100184399	Ga0068865_1001843992	158
168	3300007265	Ga0099794_10007424	Ga0099794_100074245	158
169	3300009098	Ga0105245_10015497	Ga0105245_100154975	158
170	3300009098	Ga0105245_10135632	Ga0105245_101356323	158
171	3300009098	Ga0105245_11037160	Ga0105245_110371602	158
172	3300009147	Ga0114129_10210397	Ga0114129_102103974	158
173	3300009148	Ga0105243_10003587	Ga0105243_100035873	158
174	3300009148	Ga0105243_10049574	Ga0105243_100495743	158
175	3300009148	Ga0105243_10728626	Ga0105243_107286261	158
176	3300009174	Ga0105241_10659884	Ga0105241_106598842	158
177	3300009176	Ga0105242_10114205	Ga0105242_101142053	158
178	3300009176	Ga0105242_10272485	Ga0105242_102724853	158
179	3300009177	Ga0105248_10537053	Ga0105248_105370532	158
180	3300009545	Ga0105237_10170445	Ga0105237_101704451	158
181	3300009993	Ga0105028_108551	Ga0105028_1085512	158
182	3300011119	Ga0105246_10392238	Ga0105246_103922382	158
183	3300012510	Ga0157316_1007694	Ga0157316_10076942	158
184	3300012513	Ga0157326_1079324	Ga0157326_10793241	158
185	3300013296	Ga0157374_10590596	Ga0157374_105905961	158
186	3300013297	Ga0157378_10857796	Ga0157378_108577962	158
187	3300013306	Ga0163162_10476506	Ga0163162_104765063	158
188	3300013308	Ga0157375_10162533	Ga0157375_101625332	158
189	3300013308	Ga0157375_10169621	Ga0157375_101696213	158
190	3300014325	Ga0163163_10986929	Ga0163163_109869291	158
191	3300020082	Ga0206353_10460254	Ga0206353_104602543	158
192	3300021388	Ga0213875_10070627	Ga0213875_100706272	158
193	3300025885	Ga0207653_10087418	Ga0207653_100874182	158
194	3300025898	Ga0207692_10014113	Ga0207692_100141133	158
195	3300025901	Ga0207688_10697488	Ga0207688_106974882	158
196	3300025904	Ga0207647_10177007	Ga0207647_101770072	158
197	3300025907	Ga0207645_10098986	Ga0207645_100989862	158
198	3300025909	Ga0207705_10002794	Ga0207705_100027948	158
199	3300025909	Ga0207705_10151311	Ga0207705_101513111	158
200	3300025910	Ga0207684_10155903	Ga0207684_101559032	158
201	3300025910	Ga0207684_10280360	Ga0207684_102803602	158
202	3300025912	Ga0207707_10140348	Ga0207707_101403481	158
203	3300025915	Ga0207693_10116336	Ga0207693_101163361	158
204	3300025919	Ga0207657_10235211	Ga0207657_102352111	158
205	3300025921	Ga0207652_10072756	Ga0207652_100727565	158
206	3300025922	Ga0207646_10069038	Ga0207646_100690383	158
207	3300025922	Ga0207646_10199898	Ga0207646_101998981	158
208	3300025922	Ga0207646_10444592	Ga0207646_104445921	158
209	3300025927	Ga0207687_10067797	Ga0207687_100677973	158
210	3300025927	Ga0207687_10219625	Ga0207687_102196253	158
211	3300025928	Ga0207700_10003053	Ga0207700_100030538	158
212	3300025929	Ga0207664_10016978	Ga0207664_100169784	158
213	3300025932	Ga0207690_10253776	Ga0207690_102537762	158
214	3300025933	Ga0207706_10135198	Ga0207706_101351983	158
215	3300025934	Ga0207686_10497710	Ga0207686_104977102	158
216	3300025938	Ga0207704_10108808	Ga0207704_101088083	158
217	3300025941	Ga0207711_10986962	Ga0207711_109869622	158
218	3300025981	Ga0207640_10872569	Ga0207640_108725692	158
219	3300026067	Ga0207678_10763565	Ga0207678_107635651	158
220	3300026075	Ga0207708_10018870	Ga0207708_100188703	158
221	3300026095	Ga0207676_10699015	Ga0207676_106990152	158
222	3300026118	Ga0207675_100046034	Ga0207675_1000460344	158
223	3300026142	Ga0207698_11052186	Ga0207698_110521862	158
224	3300027671	Ga0209588_1052453	Ga0209588_10524532	158
225	3300027866	Ga0209813_10000714	Ga0209813_100007146	158
226	3300028379	Ga0268266_10993076	Ga0268266_109930761	158
227	3300030733	Ga0314311_1223351	Ga0314311_12233512	158
228	3300030736	Ga0316180_1175829	Ga0316180_11758292	158
229	3300030742	Ga0316183_1157413	Ga0316183_11574132	158
230	3300030744	Ga0316181_1182988	Ga0316181_11829883	158
231	3300031548	Ga0307408_100122964	Ga0307408_1001229642	158
232	3300031691	Ga0316579_10149112	Ga0316579_101491122	158
233	3300031727	Ga0316576_10011718	Ga0316576_100117186	158
234	3300031731	Ga0307405_10166516	Ga0307405_101665161	158
235	3300031733	Ga0316577_10149202	Ga0316577_101492022	158
236	3300031852	Ga0307410_10582046	Ga0307410_105820462	158
237	3300031911	Ga0307412_10143666	Ga0307412_101436662	158
238	3300031995	Ga0307409_100013874	Ga0307409_1000138742	158
239	3300031995	Ga0307409_100026676	Ga0307409_1000266763	158
240	3300032004	Ga0307414_10065650	Ga0307414_100656504	158
241	3300032005	Ga0307411_10394182	Ga0307411_103941821	158
242	3300032005	Ga0307411_10642643	Ga0307411_106426432	158
243	3300032126	Ga0307415_100028882	Ga0307415_1000288822	158
244	3300032133	Ga0316583_10131547	Ga0316583_101315472	158
245	3300032137	Ga0316585_10049323	Ga0316585_100493232	158
246	3300035089	Ga0373944_0000307	Ga0373944_0000307_304_786	158
247	3300035113	Ga0373936_0009113	Ga0373936_0009113_109_591	158
248	3300035116	Ga0373945_0000124	Ga0373945_0000124_1045_1527	158
249	3300035170	Ga0373943_0539337	Ga0373943_0539337_117_599	158
250	3300035172	Ga0373955_0069870	Ga0373955_0069870_1063_1545	158
251	3300035410	Ga0373924_0000742	Ga0373924_0000742_9387_9869	158
252	3300035691	Ga0373931_0033931	Ga0373931_0033931_717_1199	158
253	3300035695	Ga0373927_0005074	Ga0373927_0005074_6600_7082	158
254	3300037068	Ga0373925_1374378	Ga0373925_1374378_30_509	158
255	3300037853	Ga0436364_0418507	Ga0436364_0418507_1940_2437	158
256	3300041406	Ga0439439_0005951	Ga0439439_0005951_696_1187	158
257	3300041411	Ga0439466_0028592	Ga0439466_0028592_1194_1685	158
258	3300041443	Ga0451789_0825545	Ga0451789_0825545_25_507	158
259	3300041498	Ga0451841_1455482	Ga0451841_1455482_50_574	158
260	3300042005	Ga0439448_0212785	Ga0439448_0212785_34_519	158
261	3300042007	Ga0439449_0004592	Ga0439449_0004592_3190_3681	158
262	3300042012	Ga0439455_0143502	Ga0439455_0143502_25_510	158
263	3300042014	Ga0439457_001110	Ga0439457_001110_6090_6581	158
264	3300042146	Ga0450907_004513	Ga0450907_004513_1371_1862	158
265	3300042146	Ga0450907_021865	Ga0450907_021865_526_1017	158
266	3300044658	Ga0466972_0054495	Ga0466972_0054495_546_1031	158
267	3300044658	Ga0466972_0457881	Ga0466972_0457881_101_586	158
268	3300044683	Ga0466965_0043377	Ga0466965_0043377_401_886	158
269	3300044693	Ga0466961_0290675	Ga0466961_0290675_91_576	158
270	3300044694	Ga0466963_0061228	Ga0466963_0061228_197_673	158
271	3300044694	Ga0466963_0211130	Ga0466963_0211130_828_1307	158
272	3300044765	Ga0466970_0125307	Ga0466970_0125307_853_1338	158
273	3300044842	Ga0466957_0447448	Ga0466957_0447448_252_737	158
274	3300044901	Ga0466960_0027878	Ga0466960_0027878_406_891	158
275	3300044901	Ga0466960_0470332	Ga0466960_0470332_103_588	158
276	3300045976	Ga0466967_0101116	Ga0466967_0101116_134_610	158
277	3300046455	Ga0495603_0003127	Ga0495603_0003127_1453_1935	158
278	3300046455	Ga0495603_0113934	Ga0495603_0113934_42_530	158
279	3300046455	Ga0495603_0262916	Ga0495603_0262916_477_971	158
280	3300046455	Ga0495603_0627642	Ga0495603_0627642_21_503	158
281	3300046459	Ga0495629_0194792	Ga0495629_0194792_596_1078	158
282	3300046461	Ga0495641_0149534	Ga0495641_0149534_514_996	158
283	3300046463	Ga0495653_0119088	Ga0495653_0119088_1032_1538	158
284	3300046463	Ga0495653_0151986	Ga0495653_0151986_164_670	158
285	3300046463	Ga0495653_0185706	Ga0495653_0185706_621_1103	158
286	3300046472	Ga0495580_0058585	Ga0495580_0058585_1168_1653	158
287	3300046472	Ga0495580_0164418	Ga0495580_0164418_652_1134	158
288	3300046475	Ga0495639_0066932	Ga0495639_0066932_557_1039	158
289	3300046476	Ga0495662_0000204	Ga0495662_0000204_10113_10595	158
290	3300046491	Ga0495584_0338259	Ga0495584_0338259_194_679	158
291	3300046499	Ga0495594_0139156	Ga0495594_0139156_402_884	158
292	3300046501	Ga0495607_0294378	Ga0495607_0294378_16_501	158
293	3300046517	Ga0495630_1010419	Ga0495630_1010419_48_530	158
294	3300046528	Ga0495642_0284413	Ga0495642_0284413_72_557	158
295	3300046531	Ga0495665_0042080	Ga0495665_0042080_183_677	158
296	3300046531	Ga0495665_0151303	Ga0495665_0151303_180_665	158
297	3300046531	Ga0495665_0198025	Ga0495665_0198025_503_985	158
298	3300046533	Ga0495640_0003778	Ga0495640_0003778_11608_12090	158
299	3300046535	Ga0495586_0007659	Ga0495586_0007659_3923_4405	158
300	3300046535	Ga0495586_0755576	Ga0495586_0755576_66_548	158
301	3300046543	Ga0495645_0503887	Ga0495645_0503887_68_565	158
302	3300046616	Ga0495668_0000573	Ga0495668_0000573_24357_24851	158
303	3300046642	Ga0495634_0161754	Ga0495634_0161754_48_530	158
304	3300046674	Ga0495588_0015148	Ga0495588_0015148_1532_2026	158
305	3300046674	Ga0495588_0027476	Ga0495588_0027476_630_1118	158
306	3300046674	Ga0495588_0074539	Ga0495588_0074539_1126_1611	158
307	3300046679	Ga0495623_0091822	Ga0495623_0091822_551_1036	158
308	3300046679	Ga0495623_0691698	Ga0495623_0691698_32_511	158
309	3300046683	Ga0495658_0346730	Ga0495658_0346730_59_541	158
310	3300046689	Ga0495613_0191710	Ga0495613_0191710_569_1063	158
311	3300046794	Ga0495589_0258365	Ga0495589_0258365_151_636	158
312	3300047315	Ga0495581_0019417	Ga0495581_0019417_1506_2000	158
313	3300047315	Ga0495581_0021188	Ga0495581_0021188_2505_2987	158
314	3300047317	Ga0495604_0004121	Ga0495604_0004121_5322_5807	158
315	3300047318	Ga0495636_0283622	Ga0495636_0283622_46_528	158
316	3300047321	Ga0495676_0022579	Ga0495676_0022579_1151_1636	158
317	3300047321	Ga0495676_0242190	Ga0495676_0242190_701_1183	158
318	3300047447	Ga0495685_009876	Ga0495685_009876_190_678	158
319	3300048903	Ga0496100_0731119	Ga0496100_0731119_11_487	158
320	3300048904	Ga0496101_0397433	Ga0496101_0397433_198_683	158
321	3300048905	Ga0496102_0273635	Ga0496102_0273635_364_849	158
322	3300048905	Ga0496102_0753746	Ga0496102_0753746_261_743	158
323	3300048909	Ga0496106_0601280	Ga0496106_0601280_235_720	158
324	3300048910	Ga0496107_0688836	Ga0496107_0688836_39_524	158
325	3300048911	Ga0496108_0025318	Ga0496108_0025318_2047_2547	158
326	3300048911	Ga0496108_0043277	Ga0496108_0043277_2887_3381	158
327	3300048911	Ga0496108_0228956	Ga0496108_0228956_1098_1598	158
328	3300048912	Ga0496109_0099643	Ga0496109_0099643_401_895	158
329	3300048913	Ga0496110_0040683	Ga0496110_0040683_1909_2409	158
330	3300048913	Ga0496110_0130352	Ga0496110_0130352_1162_1656	158
331	3300048914	Ga0496111_0306002	Ga0496111_0306002_630_1130	158
332	3300048916	Ga0496113_0426842	Ga0496113_0426842_242_742	158
333	3300048917	Ga0496114_0655241	Ga0496114_0655241_317_811	158
334	3300048928	Ga0496125_0017077	Ga0496125_0017077_4270_4764	158
335	3300049568	Ga0501031_0214252	Ga0501031_0214252_674_1156	158
336	3300049577	Ga0501041_0144217	Ga0501041_0144217_339_821	158
337	3300049578	Ga0501042_0140850	Ga0501042_0140850_805_1287	158
338	3300049583	Ga0501067_0491574	Ga0501067_0491574_63_545	158
339	3300049592	Ga0501076_0029802	Ga0501076_0029802_3692_4174	158
340	3300049823	Ga0501044_0146310	Ga0501044_0146310_1338_1847	158
341	3300049824	Ga0501045_0275960	Ga0501045_0275960_687_1169	158
342	3300049824	Ga0501045_0323448	Ga0501045_0323448_283_774	158
343	3300049851	Ga0501212_003164	Ga0501212_003164_145_633	158
344	3300050489	nmdc:mga03683_64616_c1	nmdc:mga03683_64616_c1_117_605	158
345	3300050490	nmdc:mga03n38_441223_c1	nmdc:mga03n38_441223_c1_192_689	158
346	3300050491	nmdc:mga00v17_14226_c1	nmdc:mga00v17_14226_c1_2522_3010	158
347	3300050491	nmdc:mga00v17_271612_c1	nmdc:mga00v17_271612_c1_262_759	158
348	3300050494	nmdc:mga06z11_13455_c1	nmdc:mga06z11_13455_c1_603_1100	158
349	3300050494	nmdc:mga06z11_15152_c1	nmdc:mga06z11_15152_c1_2498_2992	158
350	3300050495	nmdc:mga04h51_2152_c1	nmdc:mga04h51_2152_c1_1191_1688	158
351	3300050496	nmdc:mga07m45_161109_c1	nmdc:mga07m45_161109_c1_338_814	158
352	3300050496	nmdc:mga07m45_212469_c1	nmdc:mga07m45_212469_c1_91_579	158
353	3300050496	nmdc:mga07m45_27490_c1	nmdc:mga07m45_27490_c1_673_1167	158
354	3300050496	nmdc:mga07m45_525726_c1	nmdc:mga07m45_525726_c1_96_590	158
355	3300050507	nmdc:mga05p37_187944_c1	nmdc:mga05p37_187944_c1_1043_1591	158
356	3300050507	nmdc:mga05p37_238_c1	nmdc:mga05p37_238_c1_24082_24561	158
357	3300050508	nmdc:mga09592_40005_c1	nmdc:mga09592_40005_c1_2780_3259	158
358	3300050509	nmdc:mga0qj67_23695_c1	nmdc:mga0qj67_23695_c1_35_514	158
359	3300050510	nmdc:mga06r32_351143_c1	nmdc:mga06r32_351143_c1_635_1132	158
360	3300050510	nmdc:mga06r32_44933_c1	nmdc:mga06r32_44933_c1_3513_3992	158
361	3300053084	Ga0495595_0125104	Ga0495595_0125104_257_754	158
362	3300054114	Ga0501084_0206492	Ga0501084_0206492_582_1064	158
363	3300060353	Ga0501082_0732269	Ga0501082_0732269_274_756	158
364	iso_pu_bacteria	2883821847	2883824064	158
365	iso_pu_bacteria	2997451912	2997453069	158
366	iso_pu_bacteria	8056054917	8056055505	158

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01467

CTP_transf_like

Cytidylyltransferase-like

28

156

0.96 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
5o08-assembly1.cif.gz_A	crystal structure of phosphopantetheine adenylyltransferase from mycobacterium abcessus in complex with dephospho-coenzyme a	0.9796	1	156
5o0a-assembly1.cif.gz_B	crystal structure of phosphopantetheine adenylyltransferase from mycobacterium abcessus in complex with 5-methyl-1-phenyl-pyrazole-4-carboxylic acid (fragment 1)	0.9788	1	157
5o0c-assembly1.cif.gz_C	crystal structure of phosphopantetheine adenylyltransferase from mycobacterium abcessus in complex with 3-(3-methyl-1h-indol-1-yl)propanoic acid (fragment 3)	0.9782	1	157
7yy0-assembly1.cif.gz_C	crystal structure of mycobacterium abscessus phosphopantetheine adenylyltransferase in complex with 4'-phosphopantetheine	0.9763	1	157
6qmi-assembly1.cif.gz_A	phosphopantetheine adenylyltransferase from mycobacterium tuberculosis in complex with 3-(1h-indol-1-yl)propanoic acid at 1.7a resolution.	0.9738	1	157

ID	Description	Score	Start	End	Superfamily
6g7vA00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs	0.9738	1	157	3.40.50.620
5ts2A00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs	0.9672	1	157	3.40.50.620
6g7vA00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs	0.9672	1	157	3.40.50.620
3nbkD00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs	0.9668	1	157	3.40.50.620
5ts2A00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs	0.9554	1	157	3.40.50.620

ID	Description	Score	Start	End	GO Terms
AF-A0A0G3V2A6-F1-model_v4	Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT)	0.988	1	156	GO:0004595 GO:0005524 GO:0005737 GO:0015937
AF-A0A7X7ESC9-F1-model_v4	Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT)	0.9879	3	156	GO:0004595 GO:0005524 GO:0005737 GO:0015937
AF-A0A349UQC6-F1-model_v4	Pantetheine-phosphate adenylyltransferase (EC 2.7.7.3)	0.9859	1	146	GO:0004595 GO:0005737 GO:0015937
AF-D7GEI6-F1-model_v4	Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT)	0.9857	3	158	GO:0004595 GO:0005524 GO:0005737 GO:0015937
AF-A0A7L5ZF09-F1-model_v4	Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT)	0.9848	3	156	GO:0004595 GO:0005524 GO:0005737 GO:0015937

Feature Viewer

pLDDT	pTM	Quality
91.89	0.88	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F424194

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF01467

CTP_transf_like

Cytidylyltransferase-like

28

156

0.96

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map