F424155

General Info

Members Datasets Scaffolds Average Seq Length
366 198 732 338

Family's Representative Sequence

Representative Sequence 3300049585|Ga0501069_0045689|Ga0501069_0045689_64_1092
Length 342
Sequence MGTNDTLGRPLRNLRVSVTDRCNLRCAYCMPEPEYAWLPRADILRFEEIGRLVEVFTRLGVDRVRLTGGEPLVRQNLPELVRILAGNPEVRDLAMTTNGVLLAEAARSLRDAGLHRLTVSLDTLRPERFRLLTRTDAHARVLAGLDAAAAAGFARGSLKIDTVVLRDCNDDELADLLEAGKRWGAEVRFIEYMDVGGATLWTRQSVVSRREILDRLAERFGPATPVAEHTSAPAERFRLPDGTVFGVIASTTAPFCRSCDRSRLTADGLWYLCLYAARGMDLRGPLRAGESDEGLAERIASVWRARADRGAEERLELANRSALLPTAELKRDPHLEMHTRGG

Samples

Sample ID Description Type Environment
1 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
46 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
49 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
50 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
107 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
111 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
112 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
113 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
114 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
115 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
116 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
117 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
118 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
119 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
120 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
121 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
122 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
123 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
124 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
125 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
126 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
127 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
128 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
129 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
130 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
131 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
132 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
133 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
134 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
135 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
136 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
137 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
138 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
139 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
140 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
141 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
142 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
143 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
144 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
145 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
146 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
162 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
163 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
164 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
165 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
166 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
167 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
168 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
169 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
170 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
171 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
172 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
173 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
174 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
177 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
178 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
179 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
180 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
181 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
182 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
183 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
184 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
185 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
186 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
187 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
188 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
189 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
190 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
191 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
192 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
193 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
194 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
195 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
196 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
197 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
198 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.37
Nodule 0
Rhizoplane 2.46
Rhizosphere 93.17
Stem 0
Stem Tuber 0
Unclassified 1.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501069_0045689 3300049585 Bacteria 2427
2 Ga0065715_10023196 3300005293 Bacteria 2245
3 Ga0065715_10113207 3300005293 Bacteria 2499
4 Ga0065715_10191091 3300005293 Bacteria 1414
5 Ga0070676_10122417 3300005328 Bacteria 1635
6 Ga0070690_100004159 3300005330 Bacteria 8003
7 Ga0070690_100317510 3300005330 Bacteria 1121
8 Ga0070670_100001541 3300005331 Bacteria 18578
9 Ga0068869_100005696 3300005334 Bacteria 7860
10 Ga0068869_100025746 3300005334 Bacteria 4088
11 Ga0070666_10010806 3300005335 Bacteria 5716
12 Ga0070689_100051246 3300005340 Bacteria 3190
13 Ga0070691_10139136 3300005341 Bacteria 1235
14 Ga0070687_100019202 3300005343 Bacteria 3175
15 Ga0070661_100047046 3300005344 Bacteria 3157
16 Ga0070668_100157060 3300005347 Bacteria 1843
17 Ga0070669_100002231 3300005353 Bacteria 14027
18 Ga0070669_100029722 3300005353 Bacteria 3941
19 Ga0070669_100094584 3300005353 Bacteria 2246
20 Ga0070675_100203404 3300005354 Bacteria 1719
21 Ga0070675_100373439 3300005354 Bacteria 1268
22 Ga0070671_100116704 3300005355 Bacteria 2244
23 Ga0070674_100306657 3300005356 Bacteria 1268
24 Ga0070673_100093324 3300005364 Bacteria 2464
25 Ga0070673_100115384 3300005364 Bacteria 2233
26 Ga0070659_100208807 3300005366 Bacteria 1609
27 Ga0070659_100253861 3300005366 Bacteria 1458
28 Ga0070667_100004446 3300005367 Bacteria 11819
29 Ga0070713_100003248 3300005436 Bacteria 10721
30 Ga0070705_100082352 3300005440 Bacteria 1980
31 Ga0070708_100442226 3300005445 Bacteria 1226
32 Ga0070681_10092612 3300005458 Bacteria 2971
33 Ga0068867_100011266 3300005459 Bacteria 6306
34 Ga0068867_100029623 3300005459 Bacteria 3944
35 Ga0070706_100024539 3300005467 Bacteria 5551
36 Ga0070698_100171561 3300005471 Bacteria 2110
37 Ga0070698_100273044 3300005471 Bacteria 1622
38 Ga0070697_100115606 3300005536 Bacteria 2240
39 Ga0070672_100001243 3300005543 Bacteria 15668
40 Ga0070686_100011087 3300005544 Bacteria 5105
41 Ga0070693_100005803 3300005547 Bacteria 5962
42 Ga0070693_100013176 3300005547 Bacteria 4205
43 Ga0070693_100130747 3300005547 Bacteria 1569
44 Ga0070665_100036157 3300005548 Bacteria 4969
45 Ga0070704_100081147 3300005549 Bacteria 2388
46 Ga0070664_100007934 3300005564 Bacteria 8576
47 Ga0068857_100009817 3300005577 Bacteria 8315
48 Ga0068854_100036100 3300005578 Bacteria 3463
49 Ga0068856_100027141 3300005614 Bacteria 5586
50 Ga0070702_100034202 3300005615 Bacteria 2800
51 Ga0070702_100060080 3300005615 Bacteria 2209
52 Ga0068852_100393866 3300005616 Bacteria 1361
53 Ga0068859_100004828 3300005617 Bacteria 13723
54 Ga0068859_100358839 3300005617 Bacteria 1552
55 Ga0068859_100511311 3300005617 Bacteria 1296
56 Ga0068866_10027461 3300005718 Bacteria 2700
57 Ga0068863_100061867 3300005841 Bacteria 3540
58 Ga0068863_100182933 3300005841 Bacteria 2012
59 Ga0068858_100001090 3300005842 Bacteria 28100
60 Ga0068858_100163057 3300005842 Bacteria 2099
61 Ga0068860_100005884 3300005843 Bacteria 12341
62 Ga0068860_100077786 3300005843 Bacteria 3155
63 Ga0068862_100097994 3300005844 Bacteria 2560
64 Ga0068862_100291004 3300005844 Bacteria 1500
65 Ga0075365_10139254 3300006038 Bacteria 1684
66 Ga0075368_10039586 3300006042 Bacteria 1848
67 Ga0075364_10115103 3300006051 Bacteria 1797
68 Ga0075362_10039086 3300006177 Bacteria 2085
69 Ga0075367_10003333 3300006178 Bacteria 7629
70 Ga0075367_10018496 3300006178 Bacteria 3846
71 Ga0075367_10076531 3300006178 Bacteria 2019
72 Ga0075366_10005182 3300006195 Bacteria 7055
73 Ga0075366_10009657 3300006195 Bacteria 5393
74 Ga0097621_100108956 3300006237 Bacteria 2339
75 Ga0068871_100082876 3300006358 Bacteria 2660
76 Ga0075428_100008656 3300006844 Bacteria 11287
77 Ga0075428_100014673 3300006844 Bacteria 8702
78 Ga0075428_100017905 3300006844 Bacteria 7830
79 Ga0075428_100027501 3300006844 Bacteria 6292
80 Ga0075428_100066629 3300006844 Unclassified 3942
81 Ga0075428_100106962 3300006844 Bacteria 3049
82 Ga0075428_100209581 3300006844 Bacteria 2106
83 Ga0075430_100000529 3300006846 Bacteria 28699
84 Ga0075430_100030948 3300006846 Bacteria 4544
85 Ga0075430_100120138 3300006846 Bacteria 2190
86 Ga0075431_100002968 3300006847 Bacteria 16412
87 Ga0075431_100032531 3300006847 Bacteria 5374
88 Ga0075431_100069468 3300006847 Bacteria 3634
89 Ga0075431_100109464 3300006847 Bacteria 2852
90 Ga0075431_100148107 3300006847 Bacteria 2418
91 Ga0075433_10027780 3300006852 Bacteria 4803
92 Ga0075433_10039655 3300006852 Bacteria 4073
93 Ga0075433_10086617 3300006852 Bacteria 2766
94 Ga0075433_10275357 3300006852 Bacteria 1492
95 Ga0075434_100006207 3300006871 Bacteria 10948
96 Ga0075434_100029333 3300006871 Bacteria 5411
97 Ga0075434_100075183 3300006871 Bacteria 3371
98 Ga0075429_100038507 3300006880 Bacteria 4162
99 Ga0075429_100291750 3300006880 Bacteria 1428
100 Ga0075429_100344864 3300006880 Unclassified 1304
101 Ga0075436_100003964 3300006914 Bacteria 10149
102 Ga0097620_100004828 3300006931 Bacteria 13723
103 Ga0097620_100358836 3300006931 Bacteria 1552
104 Ga0097620_100511274 3300006931 Bacteria 1296
105 Ga0075435_100013064 3300007076 Bacteria 6167
106 Ga0075435_100042825 3300007076 Bacteria 3623
107 Ga0105240_10165030 3300009093 Bacteria 2627
108 Ga0111539_10000544 3300009094 Bacteria 48062
109 Ga0111539_10004387 3300009094 Bacteria 18455
110 Ga0111539_10014410 3300009094 Bacteria 9868
111 Ga0111539_10026494 3300009094 Bacteria 7087
112 Ga0111539_10090160 3300009094 Bacteria 3603
113 Ga0111539_10253978 3300009094 Bacteria 2047
114 Ga0111539_10284668 3300009094 Bacteria 1924
115 Ga0105245_10229105 3300009098 Bacteria 1796
116 Ga0105245_10446747 3300009098 Bacteria 1300
117 Ga0114129_10000118 3300009147 Bacteria 79809
118 Ga0114129_10002709 3300009147 Bacteria 24665
119 Ga0114129_10002818 3300009147 Bacteria 24260
120 Ga0114129_10003807 3300009147 Bacteria 21263
121 Ga0114129_10015165 3300009147 Bacteria 10968
122 Ga0114129_10015684 3300009147 Bacteria 10774
123 Ga0114129_10058965 3300009147 Bacteria 5368
124 Ga0114129_10072381 3300009147 Bacteria 4805
125 Ga0114129_10554283 3300009147 Bacteria 1494
126 Ga0114129_10591054 3300009147 Bacteria 1439
127 Ga0105242_10175285 3300009176 Bacteria 1887
128 Ga0105242_10199006 3300009176 Bacteria 1778
129 Ga0105248_10001501 3300009177 Bacteria 25949
130 Ga0105248_10065390 3300009177 Bacteria 4084
131 Ga0105248_10247028 3300009177 Bacteria 2009
132 Ga0105249_10001034 3300009553 Bacteria 24616
133 Ga0157378_10151440 3300013297 Bacteria 2162
134 Ga0157375_10002194 3300013308 Bacteria 16873
135 Ga0163163_10000137 3300014325 Bacteria 75320
136 Ga0157380_10299807 3300014326 Bacteria 1480
137 Ga0157380_10672919 3300014326 Bacteria 1036
138 Ga0157379_10004960 3300014968 Bacteria 11416
139 Ga0207688_10010648 3300025901 Bacteria 5002
140 Ga0207680_10008000 3300025903 Bacteria 5176
141 Ga0207645_10011010 3300025907 Bacteria 6189
142 Ga0207657_10032834 3300025919 Bacteria 4684
143 Ga0207646_10083970 3300025922 Bacteria 2849
144 Ga0207681_10018924 3300025923 Bacteria 4343
145 Ga0207650_10003621 3300025925 Bacteria 10588
146 Ga0207659_10155081 3300025926 Bacteria 1792
147 Ga0207700_10004156 3300025928 Bacteria 8498
148 Ga0207690_10147454 3300025932 Unclassified 1741
149 Ga0207690_10208860 3300025932 Bacteria 1487
150 Ga0207706_10054149 3300025933 Bacteria 3541
151 Ga0207686_10098079 3300025934 Bacteria 1950
152 Ga0207670_10040650 3300025936 Bacteria 3053
153 Ga0207670_10113537 3300025936 Bacteria 1957
154 Ga0207670_10131057 3300025936 Bacteria 1837
155 Ga0207669_10083483 3300025937 Bacteria 2055
156 Ga0207691_10001363 3300025940 Bacteria 24367
157 Ga0207711_10011741 3300025941 Bacteria 7277
158 Ga0207711_10114435 3300025941 Bacteria 2402
159 Ga0207689_10011554 3300025942 Bacteria 7563
160 Ga0207689_10012720 3300025942 Bacteria 7190
161 Ga0207661_10019536 3300025944 Bacteria 5054
162 Ga0207661_10269229 3300025944 Bacteria 1520
163 Ga0207679_10022998 3300025945 Bacteria 4254
164 Ga0207679_10090952 3300025945 Bacteria 2360
165 Ga0207679_10342367 3300025945 Bacteria 1301
166 Ga0207667_10182576 3300025949 Bacteria 2154
167 Ga0207651_10006308 3300025960 Bacteria 6189
168 Ga0207651_10090614 3300025960 Bacteria 2236
169 Ga0207712_10091976 3300025961 Bacteria 2235
170 Ga0207658_10032259 3300025986 Bacteria 3726
171 Ga0207703_10054232 3300026035 Bacteria 3259
172 Ga0207678_10218522 3300026067 Bacteria 1631
173 Ga0207678_10292341 3300026067 Bacteria 1399
174 Ga0207708_10007093 3300026075 Bacteria 8279
175 Ga0207708_10300486 3300026075 Bacteria 1305
176 Ga0207702_10022841 3300026078 Bacteria 5189
177 Ga0207641_10044682 3300026088 Bacteria 3726
178 Ga0207641_10152040 3300026088 Bacteria 2097
179 Ga0207648_10017239 3300026089 Bacteria 6580
180 Ga0207648_10020608 3300026089 Bacteria 5935
181 Ga0207674_10015360 3300026116 Bacteria 8414
182 Ga0207675_100057208 3300026118 Bacteria 3638
183 Ga0207698_10519479 3300026142 Bacteria 1162
184 Ga0207428_10001847 3300027907 Bacteria 21649
185 Ga0207428_10005495 3300027907 Bacteria 11813
186 Ga0207428_10023807 3300027907 Bacteria 5144
187 Ga0207428_10037868 3300027907 Bacteria 3923
188 Ga0207428_10093927 3300027907 Bacteria 2326
189 Ga0268266_10022012 3300028379 Bacteria 5434
190 Ga0268265_10050346 3300028380 Bacteria 3138
191 Ga0268264_10019966 3300028381 Bacteria 5475
192 Ga0307408_100029833 3300031548 Bacteria 3782
193 Ga0307408_100070463 3300031548 Bacteria 2581
194 Ga0307413_10223287 3300031824 Bacteria 1378
195 Ga0307410_10228382 3300031852 Bacteria 1436
196 Ga0307406_10019093 3300031901 Bacteria 4019
197 Ga0307409_100079539 3300031995 Bacteria 2642
198 Ga0307409_100398256 3300031995 Bacteria 1314
199 Ga0307416_100005088 3300032002 Bacteria 8023
200 Ga0307416_100045454 3300032002 Bacteria 3458
201 Ga0307416_100074278 3300032002 Bacteria 2839
202 Ga0307416_100178280 3300032002 Bacteria 1988
203 Ga0307416_100444985 3300032002 Bacteria 1347
204 Ga0307411_10090923 3300032005 Bacteria 2130
205 Ga0307411_10161706 3300032005 Bacteria 1678
206 Ga0307411_10234182 3300032005 Bacteria 1433
207 Ga0307415_100067803 3300032126 Bacteria 2495
208 Ga0373934_0002818 3300035086 Bacteria 6369
209 Ga0373953_0075887 3300035117 Bacteria 1392
210 Ga0373954_0044501 3300035118 Bacteria 2072
211 Ga0373956_0043871 3300035119 Bacteria 1991
212 Ga0373955_0003836 3300035172 Bacteria 6627
213 Ga0373931_0077344 3300035691 Bacteria 1829
214 Ga0373933_0079496 3300035724 Bacteria 2008
215 Ga0373947_0105744 3300035725 Bacteria 1773
216 Ga0373947_0316889 3300035725 Bacteria 1042
217 Ga0373937_0000436 3300036401 Bacteria 38637
218 Ga0373937_0008092 3300036401 Bacteria 9127
219 Ga0373937_0356795 3300036401 Bacteria 1385
220 Ga0373925_0015503 3300037068 Bacteria 5511
221 Ga0439446_0085990 3300042156 Bacteria 979
222 Ga0453683_0046439 3300044673 Bacteria 2723
223 Ga0453684_0053588 3300044712 Bacteria 5264
224 Ga0451576_0026932 3300045051 Bacteria 6177
225 Ga0495653_0019805 3300046463 Bacteria 5455
226 Ga0495662_0020210 3300046476 Bacteria 3221
227 Ga0495630_0176220 3300046517 Bacteria 1630
228 Ga0495598_0085812 3300046537 Bacteria 1018
229 Ga0495613_0108270 3300046689 Bacteria 2004
230 Ga0495680_0084111 3300047322 Bacteria 2398
231 Ga0496102_0004395 3300048905 Bacteria 11909
232 Ga0496106_0008786 3300048909 Bacteria 7466
233 Ga0496106_0009554 3300048909 Bacteria 7163
234 Ga0496107_0000755 3300048910 Bacteria 18603
235 Ga0496108_0153754 3300048911 Bacteria 1986
236 Ga0496110_0014619 3300048913 Bacteria 6522
237 Ga0496111_0051702 3300048914 Bacteria 2966
238 Ga0496112_0097992 3300048915 Bacteria 2902
239 Ga0496115_0333992 3300048918 Bacteria 1238
240 Ga0501031_0245633 3300049568 Bacteria 1163
241 Ga0501032_0020238 3300049569 Bacteria 4638
242 Ga0501032_0185568 3300049569 Bacteria 1360
243 Ga0501033_0008877 3300049570 Bacteria 7765
244 Ga0501033_0019803 3300049570 Bacteria 5085
245 Ga0501033_0160810 3300049570 Bacteria 1617
246 Ga0501033_0243429 3300049570 Bacteria 1276
247 Ga0501034_0204088 3300049571 Bacteria 1933
248 Ga0501036_0004095 3300049572 Bacteria 11734
249 Ga0501036_0076560 3300049572 Bacteria 2830
250 Ga0501037_0132160 3300049573 Bacteria 1789
251 Ga0501037_0158023 3300049573 Bacteria 1617
252 Ga0501038_0043653 3300049574 Bacteria 3897
253 Ga0501038_0054036 3300049574 Bacteria 3454
254 Ga0501039_0013579 3300049575 Bacteria 6229
255 Ga0501040_0003736 3300049576 Bacteria 9870
256 Ga0501040_0033723 3300049576 Bacteria 3470
257 Ga0501041_0005673 3300049577 Bacteria 7296
258 Ga0501042_0052637 3300049578 Bacteria 2904
259 Ga0501043_0067447 3300049579 Bacteria 2809
260 Ga0501046_0014029 3300049580 Bacteria 6767
261 Ga0501046_0046256 3300049580 Bacteria 3455
262 Ga0501046_0048679 3300049580 Bacteria 3355
263 Ga0501047_0313249 3300049581 Bacteria 1409
264 Ga0501048_0013554 3300049582 Bacteria 6048
265 Ga0501048_0021493 3300049582 Bacteria 4725
266 Ga0501048_0032641 3300049582 Bacteria 3762
267 Ga0501048_0057869 3300049582 Bacteria 2748
268 Ga0501067_0041611 3300049583 Bacteria 2551
269 Ga0501068_0015964 3300049584 Bacteria 4325
270 Ga0501068_0048498 3300049584 Bacteria 2564
271 Ga0501069_0015928 3300049585 Bacteria 4031
272 Ga0501070_0006376 3300049586 Bacteria 10042
273 Ga0501070_0071943 3300049586 Bacteria 2862
274 Ga0501070_0274274 3300049586 Bacteria 1377
275 Ga0501071_0008097 3300049587 Bacteria 6930
276 Ga0501071_0091475 3300049587 Bacteria 2235
277 Ga0501071_0272067 3300049587 Bacteria 1281
278 Ga0501072_0007286 3300049588 Bacteria 8387
279 Ga0501072_0026391 3300049588 Bacteria 4530
280 Ga0501073_0033154 3300049589 Bacteria 3679
281 Ga0501074_0000463 3300049590 Bacteria 24468
282 Ga0501074_0024133 3300049590 Bacteria 4419
283 Ga0501074_0065194 3300049590 Bacteria 2622
284 Ga0501075_0073384 3300049591 Bacteria 2588
285 Ga0501075_0114008 3300049591 Bacteria 2055
286 Ga0501075_0290034 3300049591 Bacteria 1247
287 Ga0501076_0035099 3300049592 Bacteria 3923
288 Ga0501076_0044834 3300049592 Bacteria 3489
289 Ga0501077_0098132 3300049593 Bacteria 1857
290 Ga0501079_0007650 3300049741 Bacteria 8184
291 Ga0501079_0047289 3300049741 Bacteria 3319
292 Ga0501079_0226227 3300049741 Bacteria 1461
293 Ga0501079_0481337 3300049741 Unclassified 975
294 Ga0501080_0013631 3300049742 Bacteria 7484
295 Ga0501080_0304028 3300049742 Bacteria 1446
296 Ga0501083_0005317 3300049744 Bacteria 9104
297 Ga0501083_0030156 3300049744 Bacteria 3727
298 Ga0501035_0129748 3300049822 Bacteria 2198
299 Ga0501044_0005392 3300049823 Bacteria 14202
300 Ga0501045_0027381 3300049824 Bacteria 4107
301 Ga0501045_0139814 3300049824 Bacteria 1800
302 nmdc:mga03683_2084_c1 3300050489 Bacteria 6142
303 nmdc:mga00v17_166440_c1 3300050491 Bacteria 1420
304 nmdc:mga00v17_18045_c1 3300050491 Bacteria 4005
305 nmdc:mga00v17_20075_c1 3300050491 Bacteria 3824
306 nmdc:mga0yw44_4106_c1 3300050492 Bacteria 6603
307 nmdc:mga0k408_13670_c1 3300050493 Bacteria 4456
308 nmdc:mga06z11_9489_c1 3300050494 Bacteria 4102
309 nmdc:mga05p37_1065_c1 3300050507 Bacteria 31391
310 nmdc:mga05p37_111176_c1 3300050507 Bacteria 3370
311 nmdc:mga05p37_12192_c1 3300050507 Bacteria 10263
312 nmdc:mga05p37_1280_c1 3300050507 Bacteria 29233
313 nmdc:mga05p37_182481_c1 3300050507 Bacteria 2552
314 nmdc:mga05p37_30587_c1 3300050507 Bacteria 6570
315 nmdc:mga05p37_30_c1 3300050507 Bacteria 114300
316 nmdc:mga05p37_33870_c1 3300050507 Bacteria 6257
317 nmdc:mga05p37_8617_c1 3300050507 Bacteria 12055
318 nmdc:mga09592_190643_c1 3300050508 Bacteria 1774
319 nmdc:mga09592_32889_c1 3300050508 Bacteria 4325
320 nmdc:mga0qj67_183904_c1 3300050509 Bacteria 1698
321 nmdc:mga0qj67_243326_c1 3300050509 Bacteria 1459
322 nmdc:mga0qj67_32212_c1 3300050509 Bacteria 4087
323 nmdc:mga0qj67_41988_c1 3300050509 Bacteria 3599
324 nmdc:mga0qj67_5853_c1 3300050509 Bacteria 9001
325 nmdc:mga06r32_114922_c1 3300050510 Bacteria 2650
326 nmdc:mga06r32_188851_c1 3300050510 Bacteria 2048
327 nmdc:mga06r32_230796_c1 3300050510 Bacteria 1839
328 nmdc:mga06r32_439234_c1 3300050510 Bacteria 1285
329 nmdc:mga06r32_70642_c1 3300050510 Unclassified 3377
330 nmdc:mga06r32_89029_c1 3300050510 Bacteria 3013
331 nmdc:mga06r32_93491_c1 3300050510 Bacteria 2941
332 nmdc:mga06r32_99128_c1 3300050510 Bacteria 2857
333 nmdc:mga08y16_2181_c1 3300050511 Bacteria 20079
334 nmdc:mga08y16_332918_c1 3300050511 Bacteria 1562
335 nmdc:mga08y16_364539_c1 3300050511 Bacteria 1483
336 nmdc:mga08y16_4232_c1 3300050511 Bacteria 14976
337 nmdc:mga08y16_5039_c1 3300050511 Bacteria 13809
338 nmdc:mga08y16_61412_c1 3300050511 Bacteria 3924
339 nmdc:mga08y16_962_c1 3300050511 Bacteria 28000
340 nmdc:mga0n895_31751_c1 3300050512 Bacteria 5060
341 nmdc:mga0n895_377358_c1 3300050512 Bacteria 1435
342 nmdc:mga0n895_393_c1 3300050512 Bacteria 29329
343 nmdc:mga0n895_7501_c1 3300050512 Bacteria 9367
344 nmdc:mga0rr50_18036_c1 3300050513 Bacteria 4732
345 nmdc:mga0rr50_90361_c1 3300050513 Bacteria 2383
346 nmdc:mga0a205_109907_c1 3300050515 Bacteria 2655
347 nmdc:mga0a205_27409_c1 3300050515 Bacteria 5441
348 nmdc:mga0a205_4326_c1 3300050515 Bacteria 12733
349 nmdc:mga0a205_49291_c1 3300050515 Bacteria 4065
350 nmdc:mga0a205_53463_c1 3300050515 Bacteria 3898
351 Ga0495601_0051115 3300053077 Bacteria 2609
352 Ga0495619_0142870 3300053085 Bacteria 1649
353 Ga0501084_0018855 3300054114 Bacteria 5744
354 Ga0501084_0034573 3300054114 Bacteria 4226
355 Ga0501084_0064507 3300054114 Bacteria 3065
356 Ga0501084_0161925 3300054114 Bacteria 1888
357 Ga0501084_0278934 3300054114 Bacteria 1411
358 Ga0501084_0542030 3300054114 Bacteria 983
359 Ga0590071_001017 3300059421 Bacteria 7633
360 Ga0590074_004314 3300059423 Bacteria 2351
361 Ga0590075_000043 3300059424 Bacteria 33018
362 Ga0590077_000073 3300059426 Bacteria 25304
363 Ga0501082_0009279 3300060353 Bacteria 8478
364 Ga0501082_0140183 3300060353 Bacteria 2099
365 Ga0501082_0151342 3300060353 Bacteria 2015
366 Ga0530510_0009096 3300061734 Bacteria 6962
367 Ga0501069_0045689
368 Ga0065715_10023196
369 Ga0065715_10113207
370 Ga0065715_10191091
371 Ga0070676_10122417
372 Ga0070690_100004159
373 Ga0070690_100317510
374 Ga0070670_100001541
375 Ga0068869_100005696
376 Ga0068869_100025746
377 Ga0070666_10010806
378 Ga0070689_100051246
379 Ga0070691_10139136
380 Ga0070687_100019202
381 Ga0070661_100047046
382 Ga0070668_100157060
383 Ga0070669_100002231
384 Ga0070669_100029722
385 Ga0070669_100094584
386 Ga0070675_100203404
387 Ga0070675_100373439
388 Ga0070671_100116704
389 Ga0070674_100306657
390 Ga0070673_100093324
391 Ga0070673_100115384
392 Ga0070659_100208807
393 Ga0070659_100253861
394 Ga0070667_100004446
395 Ga0070713_100003248
396 Ga0070705_100082352
397 Ga0070708_100442226
398 Ga0070681_10092612
399 Ga0068867_100011266
400 Ga0068867_100029623
401 Ga0070706_100024539
402 Ga0070698_100171561
403 Ga0070698_100273044
404 Ga0070697_100115606
405 Ga0070672_100001243
406 Ga0070686_100011087
407 Ga0070693_100005803
408 Ga0070693_100013176
409 Ga0070693_100130747
410 Ga0070665_100036157
411 Ga0070704_100081147
412 Ga0070664_100007934
413 Ga0068857_100009817
414 Ga0068854_100036100
415 Ga0068856_100027141
416 Ga0070702_100034202
417 Ga0070702_100060080
418 Ga0068852_100393866
419 Ga0068859_100004828
420 Ga0068859_100358839
421 Ga0068859_100511311
422 Ga0068866_10027461
423 Ga0068863_100061867
424 Ga0068863_100182933
425 Ga0068858_100001090
426 Ga0068858_100163057
427 Ga0068860_100005884
428 Ga0068860_100077786
429 Ga0068862_100097994
430 Ga0068862_100291004
431 Ga0075365_10139254
432 Ga0075368_10039586
433 Ga0075364_10115103
434 Ga0075362_10039086
435 Ga0075367_10003333
436 Ga0075367_10018496
437 Ga0075367_10076531
438 Ga0075366_10005182
439 Ga0075366_10009657
440 Ga0097621_100108956
441 Ga0068871_100082876
442 Ga0075428_100008656
443 Ga0075428_100014673
444 Ga0075428_100017905
445 Ga0075428_100027501
446 Ga0075428_100066629
447 Ga0075428_100106962
448 Ga0075428_100209581
449 Ga0075430_100000529
450 Ga0075430_100030948
451 Ga0075430_100120138
452 Ga0075431_100002968
453 Ga0075431_100032531
454 Ga0075431_100069468
455 Ga0075431_100109464
456 Ga0075431_100148107
457 Ga0075433_10027780
458 Ga0075433_10039655
459 Ga0075433_10086617
460 Ga0075433_10275357
461 Ga0075434_100006207
462 Ga0075434_100029333
463 Ga0075434_100075183
464 Ga0075429_100038507
465 Ga0075429_100291750
466 Ga0075429_100344864
467 Ga0075436_100003964
468 Ga0097620_100004828
469 Ga0097620_100358836
470 Ga0097620_100511274
471 Ga0075435_100013064
472 Ga0075435_100042825
473 Ga0105240_10165030
474 Ga0111539_10000544
475 Ga0111539_10004387
476 Ga0111539_10014410
477 Ga0111539_10026494
478 Ga0111539_10090160
479 Ga0111539_10253978
480 Ga0111539_10284668
481 Ga0105245_10229105
482 Ga0105245_10446747
483 Ga0114129_10000118
484 Ga0114129_10002709
485 Ga0114129_10002818
486 Ga0114129_10003807
487 Ga0114129_10015165
488 Ga0114129_10015684
489 Ga0114129_10058965
490 Ga0114129_10072381
491 Ga0114129_10554283
492 Ga0114129_10591054
493 Ga0105242_10175285
494 Ga0105242_10199006
495 Ga0105248_10001501
496 Ga0105248_10065390
497 Ga0105248_10247028
498 Ga0105249_10001034
499 Ga0157378_10151440
500 Ga0157375_10002194
501 Ga0163163_10000137
502 Ga0157380_10299807
503 Ga0157380_10672919
504 Ga0157379_10004960
505 Ga0207688_10010648
506 Ga0207680_10008000
507 Ga0207645_10011010
508 Ga0207657_10032834
509 Ga0207646_10083970
510 Ga0207681_10018924
511 Ga0207650_10003621
512 Ga0207659_10155081
513 Ga0207700_10004156
514 Ga0207690_10147454
515 Ga0207690_10208860
516 Ga0207706_10054149
517 Ga0207686_10098079
518 Ga0207670_10040650
519 Ga0207670_10113537
520 Ga0207670_10131057
521 Ga0207669_10083483
522 Ga0207691_10001363
523 Ga0207711_10011741
524 Ga0207711_10114435
525 Ga0207689_10011554
526 Ga0207689_10012720
527 Ga0207661_10019536
528 Ga0207661_10269229
529 Ga0207679_10022998
530 Ga0207679_10090952
531 Ga0207679_10342367
532 Ga0207667_10182576
533 Ga0207651_10006308
534 Ga0207651_10090614
535 Ga0207712_10091976
536 Ga0207658_10032259
537 Ga0207703_10054232
538 Ga0207678_10218522
539 Ga0207678_10292341
540 Ga0207708_10007093
541 Ga0207708_10300486
542 Ga0207702_10022841
543 Ga0207641_10044682
544 Ga0207641_10152040
545 Ga0207648_10017239
546 Ga0207648_10020608
547 Ga0207674_10015360
548 Ga0207675_100057208
549 Ga0207698_10519479
550 Ga0207428_10001847
551 Ga0207428_10005495
552 Ga0207428_10023807
553 Ga0207428_10037868
554 Ga0207428_10093927
555 Ga0268266_10022012
556 Ga0268265_10050346
557 Ga0268264_10019966
558 Ga0307408_100029833
559 Ga0307408_100070463
560 Ga0307413_10223287
561 Ga0307410_10228382
562 Ga0307406_10019093
563 Ga0307409_100079539
564 Ga0307409_100398256
565 Ga0307416_100005088
566 Ga0307416_100045454
567 Ga0307416_100074278
568 Ga0307416_100178280
569 Ga0307416_100444985
570 Ga0307411_10090923
571 Ga0307411_10161706
572 Ga0307411_10234182
573 Ga0307415_100067803
574 Ga0373934_0002818
575 Ga0373953_0075887
576 Ga0373954_0044501
577 Ga0373956_0043871
578 Ga0373955_0003836
579 Ga0373931_0077344
580 Ga0373933_0079496
581 Ga0373947_0105744
582 Ga0373947_0316889
583 Ga0373937_0000436
584 Ga0373937_0008092
585 Ga0373937_0356795
586 Ga0373925_0015503
587 Ga0439446_0085990
588 Ga0453683_0046439
589 Ga0453684_0053588
590 Ga0451576_0026932
591 Ga0495653_0019805
592 Ga0495662_0020210
593 Ga0495630_0176220
594 Ga0495598_0085812
595 Ga0495613_0108270
596 Ga0495680_0084111
597 Ga0496102_0004395
598 Ga0496106_0008786
599 Ga0496106_0009554
600 Ga0496107_0000755
601 Ga0496108_0153754
602 Ga0496110_0014619
603 Ga0496111_0051702
604 Ga0496112_0097992
605 Ga0496115_0333992
606 Ga0501031_0245633
607 Ga0501032_0020238
608 Ga0501032_0185568
609 Ga0501033_0008877
610 Ga0501033_0019803
611 Ga0501033_0160810
612 Ga0501033_0243429
613 Ga0501034_0204088
614 Ga0501036_0004095
615 Ga0501036_0076560
616 Ga0501037_0132160
617 Ga0501037_0158023
618 Ga0501038_0043653
619 Ga0501038_0054036
620 Ga0501039_0013579
621 Ga0501040_0003736
622 Ga0501040_0033723
623 Ga0501041_0005673
624 Ga0501042_0052637
625 Ga0501043_0067447
626 Ga0501046_0014029
627 Ga0501046_0046256
628 Ga0501046_0048679
629 Ga0501047_0313249
630 Ga0501048_0013554
631 Ga0501048_0021493
632 Ga0501048_0032641
633 Ga0501048_0057869
634 Ga0501067_0041611
635 Ga0501068_0015964
636 Ga0501068_0048498
637 Ga0501069_0015928
638 Ga0501070_0006376
639 Ga0501070_0071943
640 Ga0501070_0274274
641 Ga0501071_0008097
642 Ga0501071_0091475
643 Ga0501071_0272067
644 Ga0501072_0007286
645 Ga0501072_0026391
646 Ga0501073_0033154
647 Ga0501074_0000463
648 Ga0501074_0024133
649 Ga0501074_0065194
650 Ga0501075_0073384
651 Ga0501075_0114008
652 Ga0501075_0290034
653 Ga0501076_0035099
654 Ga0501076_0044834
655 Ga0501077_0098132
656 Ga0501079_0007650
657 Ga0501079_0047289
658 Ga0501079_0226227
659 Ga0501079_0481337
660 Ga0501080_0013631
661 Ga0501080_0304028
662 Ga0501083_0005317
663 Ga0501083_0030156
664 Ga0501035_0129748
665 Ga0501044_0005392
666 Ga0501045_0027381
667 Ga0501045_0139814
668 nmdc:mga03683_2084_c1
669 nmdc:mga00v17_166440_c1
670 nmdc:mga00v17_18045_c1
671 nmdc:mga00v17_20075_c1
672 nmdc:mga0yw44_4106_c1
673 nmdc:mga0k408_13670_c1
674 nmdc:mga06z11_9489_c1
675 nmdc:mga05p37_1065_c1
676 nmdc:mga05p37_111176_c1
677 nmdc:mga05p37_12192_c1
678 nmdc:mga05p37_1280_c1
679 nmdc:mga05p37_182481_c1
680 nmdc:mga05p37_30587_c1
681 nmdc:mga05p37_30_c1
682 nmdc:mga05p37_33870_c1
683 nmdc:mga05p37_8617_c1
684 nmdc:mga09592_190643_c1
685 nmdc:mga09592_32889_c1
686 nmdc:mga0qj67_183904_c1
687 nmdc:mga0qj67_243326_c1
688 nmdc:mga0qj67_32212_c1
689 nmdc:mga0qj67_41988_c1
690 nmdc:mga0qj67_5853_c1
691 nmdc:mga06r32_114922_c1
692 nmdc:mga06r32_188851_c1
693 nmdc:mga06r32_230796_c1
694 nmdc:mga06r32_439234_c1
695 nmdc:mga06r32_70642_c1
696 nmdc:mga06r32_89029_c1
697 nmdc:mga06r32_93491_c1
698 nmdc:mga06r32_99128_c1
699 nmdc:mga08y16_2181_c1
700 nmdc:mga08y16_332918_c1
701 nmdc:mga08y16_364539_c1
702 nmdc:mga08y16_4232_c1
703 nmdc:mga08y16_5039_c1
704 nmdc:mga08y16_61412_c1
705 nmdc:mga08y16_962_c1
706 nmdc:mga0n895_31751_c1
707 nmdc:mga0n895_377358_c1
708 nmdc:mga0n895_393_c1
709 nmdc:mga0n895_7501_c1
710 nmdc:mga0rr50_18036_c1
711 nmdc:mga0rr50_90361_c1
712 nmdc:mga0a205_109907_c1
713 nmdc:mga0a205_27409_c1
714 nmdc:mga0a205_4326_c1
715 nmdc:mga0a205_49291_c1
716 nmdc:mga0a205_53463_c1
717 Ga0495601_0051115
718 Ga0495619_0142870
719 Ga0501084_0018855
720 Ga0501084_0034573
721 Ga0501084_0064507
722 Ga0501084_0161925
723 Ga0501084_0278934
724 Ga0501084_0542030
725 Ga0590071_001017
726 Ga0590074_004314
727 Ga0590075_000043
728 Ga0590077_000073
729 Ga0501082_0009279
730 Ga0501082_0140183
731 Ga0501082_0151342
732 Ga0530510_0009096

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04055

Radical_SAM

Radical SAM superfamily

16

179

0.98

PF06463

Mob_synth_C

Molybdenum Cofactor Synthesis C

185

312

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1tv8-assembly1.cif.gz_A structure of moaa in complex with s-adenosylmethionine 0.9156 5 284
2fb2-assembly1.cif.gz_B structure of the moaa arg17/266/268/ala triple mutant 0.9092 5 284
7tom-assembly1.cif.gz_A x-ray crystal structure of glycerol dibiphytanyl glycerol tetraether - macrocyclic archaeol synthase (gdgt-mas) from methanocaldococcus jannaschii with bacterial lipid substrate analog, 5'deoxyadenosine, and methionine bound 0.8581 15 195
3ciw-assembly1.cif.gz_A x-ray structure of the [fefe]-hydrogenase maturase hyde from thermotoga maritima 0.8376 15 162
7o26-assembly1.cif.gz_A complex-b bound [fefe]-hydrogenase maturase hyde fromt. maritima (5'da + methionine) 0.8302 15 162
ID Description Score Start End Superfamily
af_P9WJS3_16_359_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9524 1 311 3.20.20.70
af_P9WJS3_16_359_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9495 1 311 3.20.20.70
1tv8A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9156 5 284 3.20.20.70
af_P9WJS1_27_360_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8917 1 311 3.20.20.70
af_I1KTQ5_72_400_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8784 3 311 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A833E0F9-F1-model_v4 GTP 3',8-cyclase MoaA 0.9653 15 158 GO:0006777
GO:0046872
GO:0051539
GO:0061798
GO:0061799
AF-A0A7V3XHQ7-F1-model_v4 GTP 3',8-cyclase (EC 4.1.99.22) (Molybdenum cofactor biosynthesis protein A) 0.9635 1 311 GO:0005525
GO:0006777
GO:0046872
GO:0051539
GO:0061798
GO:0061799
GO:1904047
AF-A0A2A5DHD3-F1-model_v4 GTP 3',8-cyclase (EC 4.1.99.22) (Molybdenum cofactor biosynthesis protein A) 0.9618 1 311 GO:0005525
GO:0006777
GO:0046872
GO:0051539
GO:0061798
GO:0061799
GO:1904047
AF-A0A7V3XHQ7-F1-model_v4 GTP 3',8-cyclase (EC 4.1.99.22) (Molybdenum cofactor biosynthesis protein A) 0.9605 1 311 GO:0005525
GO:0006777
GO:0046872
GO:0051539
GO:0061798
GO:0061799
GO:1904047
AF-A0A2A5DHD3-F1-model_v4 GTP 3',8-cyclase (EC 4.1.99.22) (Molybdenum cofactor biosynthesis protein A) 0.9588 1 311 GO:0005525
GO:0006777
GO:0046872
GO:0051539
GO:0061798
GO:0061799
GO:1904047

Map