F424106

General Info

Members Datasets Scaffolds Average Seq Length
366 233 732 175

Family's Representative Sequence

Representative Sequence 3300044765|Ga0466970_0240638|Ga0466970_0240638_64_585
Length 173
Sequence MEAINLGTSDGLPPVQWADIETKLATGSAPPPDAMNSRTTWLATINEDGSPHVTAVGAIWLDGTFWVQTGNTRKARNIARDPRCSLSLSIRDADVVLEGDLVHVTDPAAVARAAKAWAESGWPAQPDESGTGITAPFNAPAQGPPPWNVYRIELRSAVVGVSAEPGGLTRFRF

Samples

Sample ID Description Type Environment
1 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
32 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
41 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
64 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
97 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
101 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
102 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
103 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
104 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
105 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
106 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
107 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
108 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
109 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
110 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
111 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
112 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
115 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
116 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
117 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
118 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
119 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
120 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
121 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
122 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
123 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
124 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
125 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
126 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
127 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
128 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
129 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
130 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
131 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
132 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
133 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
134 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
135 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
136 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
137 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
138 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
139 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
140 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
141 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
142 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
143 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
144 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
145 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
146 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
147 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
148 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
149 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
150 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
151 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
152 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
153 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
154 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
155 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
156 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
157 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
158 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
159 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
160 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
161 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
162 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
163 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
164 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
165 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
166 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
167 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
168 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
169 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
170 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
171 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
172 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
173 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
174 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
175 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
176 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
177 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
178 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
179 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
180 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
181 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
182 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
197 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
198 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
199 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
200 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
201 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
202 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
203 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
204 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
205 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
206 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
207 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
208 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
209 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
210 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
211 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
214 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
215 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
216 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
217 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
218 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
219 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
220 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
221 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
222 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
223 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
224 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
225 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
226 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
227 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
228 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
229 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
230 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
231 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
232 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
233 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.36
Metatranscriptomes 1.64
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.2
Nodule 0
Rhizoplane 6.83
Rhizosphere 83.61
Stem 0
Stem Tuber 0
Unclassified 27.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466970_0240638 3300044765 Bacteria 1013
2 Ga0070658_10000278 3300005327 Bacteria 44894
3 Ga0070658_10307990 3300005327 Bacteria 1351
4 Ga0070690_100009067 3300005330 Bacteria 5754
5 Ga0070689_100109069 3300005340 Bacteria 2200
6 Ga0070687_100492570 3300005343 Bacteria 823
7 Ga0070668_100083904 3300005347 Unclassified 2502
8 Ga0070668_100665438 3300005347 Unclassified 916
9 Ga0070673_100944567 3300005364 Bacteria 801
10 Ga0070688_100064283 3300005365 Unclassified 2328
11 Ga0070688_101071962 3300005365 Bacteria 643
12 Ga0070659_100431205 3300005366 Bacteria 1116
13 Ga0070667_100587769 3300005367 Bacteria 1025
14 Ga0070678_100883698 3300005456 Bacteria 816
15 Ga0070681_10138657 3300005458 Bacteria 2362
16 Ga0070681_11041891 3300005458 Bacteria 738
17 Ga0070699_100311691 3300005518 Unclassified 1413
18 Ga0070679_100026578 3300005530 Bacteria 5690
19 Ga0070697_100373666 3300005536 Unclassified 1234
20 Ga0068853_101227745 3300005539 Bacteria 724
21 Ga0068853_101822536 3300005539 Unclassified 590
22 Ga0070686_100015074 3300005544 Bacteria 4469
23 Ga0070696_100839133 3300005546 Unclassified 759
24 Ga0070693_100221946 3300005547 Bacteria 1239
25 Ga0070665_100527070 3300005548 Bacteria 1193
26 Ga0068855_100152109 3300005563 Bacteria 2631
27 Ga0070702_100194981 3300005615 Bacteria 1336
28 Ga0068859_100221229 3300005617 Bacteria 1981
29 Ga0068859_102142411 3300005617 Unclassified 617
30 Ga0068866_10018832 3300005718 Bacteria 3131
31 Ga0068861_100239745 3300005719 Bacteria 1542
32 Ga0068870_10417459 3300005840 Bacteria 877
33 Ga0068863_100620728 3300005841 Viruses 1071
34 Ga0068858_101085243 3300005842 Unclassified 786
35 Ga0075365_10025549 3300006038 Bacteria 3740
36 Ga0075365_10185413 3300006038 Bacteria 1455
37 Ga0075365_10272166 3300006038 Bacteria 1191
38 Ga0075364_10000990 3300006051 Bacteria 15049
39 Ga0075364_10171408 3300006051 Bacteria 1467
40 Ga0075364_10471352 3300006051 Bacteria 858
41 Ga0075367_10283165 3300006178 Unclassified 1042
42 Ga0075366_10227972 3300006195 Bacteria 1135
43 Ga0097621_100059166 3300006237 Bacteria 3136
44 Ga0068871_100150266 3300006358 Bacteria 1986
45 Ga0068871_101018237 3300006358 Bacteria 772
46 Ga0075428_100064880 3300006844 Bacteria 3999
47 Ga0075428_100238340 3300006844 Bacteria 1963
48 Ga0075428_100507115 3300006844 Bacteria 1291
49 Ga0075428_100693963 3300006844 Unclassified 1084
50 Ga0075430_100041775 3300006846 Bacteria 3879
51 Ga0075430_100221545 3300006846 Unclassified 1569
52 Ga0075431_100046651 3300006847 Bacteria 4468
53 Ga0075429_100135946 3300006880 Bacteria 2151
54 Ga0097620_100221211 3300006931 Bacteria 1981
55 Ga0097620_102142536 3300006931 Unclassified 617
56 Ga0099794_10429435 3300007265 Unclassified 692
57 Ga0099795_10270734 3300007788 Unclassified 738
58 Ga0105240_10144722 3300009093 Bacteria 2837
59 Ga0111539_10001628 3300009094 Bacteria 30018
60 Ga0111539_11380975 3300009094 Unclassified 817
61 Ga0105245_10064326 3300009098 Bacteria 3314
62 Ga0105245_10345942 3300009098 Bacteria 1472
63 Ga0105245_10482205 3300009098 Bacteria 1253
64 Ga0105245_11088264 3300009098 Unclassified 845
65 Ga0114129_10109215 3300009147 Bacteria 3818
66 Ga0114129_10124415 3300009147 Bacteria 3546
67 Ga0114129_10161729 3300009147 Bacteria 3058
68 Ga0114129_12122116 3300009147 Unclassified 677
69 Ga0105243_10181005 3300009148 Bacteria 1833
70 Ga0105243_11126442 3300009148 Unclassified 794
71 Ga0105241_11769420 3300009174 Unclassified 602
72 Ga0105242_10002127 3300009176 Bacteria 15626
73 Ga0105242_10066511 3300009176 Bacteria 2977
74 Ga0105248_10574921 3300009177 Bacteria 1271
75 Ga0105248_11241198 3300009177 Bacteria 843
76 Ga0105249_10122713 3300009553 Bacteria 2471
77 Ga0105246_10972624 3300011119 Bacteria 766
78 Ga0157325_1019486 3300012485 Unclassified 593
79 Ga0157370_10348589 3300013104 Unclassified 1365
80 Ga0157378_10068888 3300013297 Unclassified 3173
81 Ga0157378_10072993 3300013297 Bacteria 3084
82 Ga0157378_10566558 3300013297 Bacteria 1143
83 Ga0157378_11502712 3300013297 Unclassified 718
84 Ga0163162_10547281 3300013306 Bacteria 1286
85 Ga0157372_12140665 3300013307 Unclassified 643
86 Ga0157375_10025570 3300013308 Bacteria 5489
87 Ga0163163_10935667 3300014325 Bacteria 930
88 Ga0157380_11266616 3300014326 Bacteria 783
89 Ga0157377_10337081 3300014745 Unclassified 1007
90 Ga0157379_10200283 3300014968 Unclassified 1806
91 Ga0157376_10516866 3300014969 Bacteria 1176
92 Ga0157376_10963185 3300014969 Bacteria 874
93 Ga0157376_11070723 3300014969 Unclassified 831
94 Ga0157376_11349280 3300014969 Unclassified 744
95 Ga0182007_10295567 3300015262 Unclassified 593
96 Ga0197907_10651705 3300020069 Bacteria 894
97 Ga0206352_10439361 3300020078 Bacteria 803
98 Ga0206350_10769748 3300020080 Bacteria 726
99 Ga0206350_11423628 3300020080 Bacteria 1034
100 Ga0206354_11554126 3300020081 Unclassified 1455
101 Ga0224712_10124631 3300022467 Unclassified 1119
102 Ga0207697_10105438 3300025315 Bacteria 1204
103 Ga0207642_10017718 3300025899 Bacteria 2716
104 Ga0207710_10173410 3300025900 Unclassified 1055
105 Ga0207688_10408365 3300025901 Unclassified 843
106 Ga0207645_10465176 3300025907 Unclassified 854
107 Ga0207705_10279459 3300025909 Bacteria 1278
108 Ga0207707_10357538 3300025912 Bacteria 1258
109 Ga0207707_11352479 3300025912 Bacteria 570
110 Ga0207652_10217444 3300025921 Bacteria 1721
111 Ga0207650_10170707 3300025925 Bacteria 1728
112 Ga0207659_10332144 3300025926 Bacteria 1257
113 Ga0207687_10006374 3300025927 Bacteria 7797
114 Ga0207687_10071295 3300025927 Bacteria 2482
115 Ga0207664_10046938 3300025929 Bacteria 3391
116 Ga0207686_10020706 3300025934 Bacteria 3762
117 Ga0207709_10825315 3300025935 Bacteria 750
118 Ga0207669_10028252 3300025937 Bacteria 3084
119 Ga0207704_10096528 3300025938 Unclassified 1957
120 Ga0207691_11272657 3300025940 Unclassified 608
121 Ga0207711_10139004 3300025941 Bacteria 2184
122 Ga0207667_10120135 3300025949 Bacteria 2708
123 Ga0207712_10060733 3300025961 Bacteria 2680
124 Ga0207668_10172309 3300025972 Bacteria 1698
125 Ga0207640_11062104 3300025981 Unclassified 715
126 Ga0207677_10967162 3300026023 Bacteria 770
127 Ga0207677_11566335 3300026023 Bacteria 609
128 Ga0207648_10019359 3300026089 Bacteria 6144
129 Ga0207675_100075924 3300026118 Bacteria 3146
130 Ga0207675_100442483 3300026118 Unclassified 1287
131 Ga0207675_101119463 3300026118 Bacteria 807
132 Ga0207683_10157547 3300026121 Bacteria 2051
133 Ga0207698_10606463 3300026142 Bacteria 1080
134 Ga0209813_10060104 3300027866 Bacteria 1211
135 Ga0207428_10376069 3300027907 Bacteria 1043
136 Ga0268265_11601958 3300028380 Bacteria 656
137 Ga0268264_10013067 3300028381 Bacteria 6826
138 Ga0265334_10038198 3300028573 Bacteria 1890
139 Ga0265338_10003811 3300028800 Bacteria 20952
140 Ga0265325_10001494 3300031241 Bacteria 16450
141 Ga0265339_10001791 3300031249 Bacteria 15807
142 Ga0265331_10127718 3300031250 Unclassified 1161
143 Ga0265327_10136320 3300031251 Bacteria 1151
144 Ga0265316_10075417 3300031344 Bacteria 2593
145 Ga0265313_10002797 3300031595 Bacteria 14719
146 Ga0265314_10046416 3300031711 Bacteria 3065
147 Ga0307405_10446828 3300031731 Bacteria 1024
148 Ga0307413_10048768 3300031824 Bacteria 2534
149 Ga0307407_10248377 3300031903 Bacteria 1218
150 Ga0307409_101109625 3300031995 Bacteria 812
151 Ga0307416_100294375 3300032002 Bacteria 1609
152 Ga0307411_10020362 3300032005 Unclassified 3856
153 Ga0307415_100123416 3300032126 Bacteria 1947
154 Ga0373944_0238090 3300035089 Unclassified 669
155 Ga0373936_0413233 3300035113 Bacteria 621
156 Ga0373945_0091947 3300035116 Unclassified 1176
157 Ga0373946_0363782 3300035171 Unclassified 725
158 Ga0395900_0269825 3300037418 Bacteria 1697
159 Ga0436365_0589599 3300039437 Unclassified 1584
160 Ga0436361_0147261 3300039447 Bacteria 1154
161 Ga0451795_0480959 3300041456 Unclassified 660
162 Ga0451804_0541095 3300041463 Bacteria 1077
163 Ga0451841_0380764 3300041498 Unclassified 523
164 Ga0451853_3555519 3300041512 Unclassified 589
165 Ga0439450_051240 3300042008 Unclassified 981
166 Ga0466972_0018411 3300044658 Bacteria 3491
167 Ga0466961_0043254 3300044693 Bacteria 2885
168 Ga0466961_0425859 3300044693 Bacteria 804
169 Ga0466963_0039564 3300044694 Bacteria 3088
170 Ga0466971_0138257 3300044719 Bacteria 1134
171 Ga0466971_0416545 3300044719 Bacteria 656
172 Ga0466970_0011927 3300044765 Bacteria 4436
173 Ga0466957_0034857 3300044842 Bacteria 3019
174 Ga0466957_0988630 3300044842 Unclassified 604
175 Ga0466959_0010667 3300045049 Bacteria 6578
176 Ga0466958_0156677 3300045836 Bacteria 1438
177 Ga0466958_0219707 3300045836 Bacteria 1212
178 Ga0466958_0359736 3300045836 Bacteria 938
179 Ga0466967_1031083 3300045976 Bacteria 819
180 Ga0466967_1355216 3300045976 Bacteria 709
181 Ga0495592_0031111 3300046454 Bacteria 4036
182 Ga0495592_0494513 3300046454 Unclassified 760
183 Ga0495629_0603475 3300046459 Unclassified 734
184 Ga0495651_0975133 3300046462 Bacteria 515
185 Ga0495664_0058101 3300046477 Unclassified 2301
186 Ga0495664_0472852 3300046477 Unclassified 750
187 Ga0495594_0324014 3300046499 Unclassified 878
188 Ga0495608_0116574 3300046511 Bacteria 1714
189 Ga0495608_0128269 3300046511 Bacteria 1624
190 Ga0495608_0297021 3300046511 Unclassified 1000
191 Ga0495618_0257195 3300046514 Unclassified 1094
192 Ga0495628_0006675 3300046516 Bacteria 10064
193 Ga0495628_0018301 3300046516 Bacteria 5807
194 Ga0495628_0405278 3300046516 Unclassified 996
195 Ga0495630_0000885 3300046517 Bacteria 21005
196 Ga0495630_0209107 3300046517 Unclassified 1489
197 Ga0495643_0323480 3300046522 Unclassified 697
198 Ga0495666_0190857 3300046526 Unclassified 944
199 Ga0495652_0399261 3300046529 Unclassified 974
200 Ga0495640_0191063 3300046533 Unclassified 1301
201 Ga0495586_0490554 3300046535 Unclassified 709
202 Ga0495621_0289539 3300046539 Bacteria 677
203 Ga0495645_0218627 3300046543 Bacteria 1283
204 Ga0495667_0208758 3300046559 Bacteria 1248
205 Ga0495634_0025711 3300046642 Bacteria 4112
206 Ga0495657_0055774 3300046675 Bacteria 2635
207 Ga0495657_0336763 3300046675 Unclassified 895
208 Ga0495646_0218365 3300046680 Unclassified 1032
209 Ga0495613_0032288 3300046689 Bacteria 3888
210 Ga0495624_0199088 3300046690 Viruses 1217
211 Ga0495649_0493354 3300046694 Unclassified 609
212 Ga0495600_0254426 3300046809 Bacteria 1117
213 Ga0495604_0161653 3300047317 Unclassified 1582
214 Ga0495674_0129185 3300047319 Unclassified 2130
215 Ga0495674_0344820 3300047319 Bacteria 1210
216 Ga0495680_0111994 3300047322 Bacteria 2022
217 Ga0495680_0119745 3300047322 Unclassified 1944
218 Ga0495680_0203001 3300047322 Unclassified 1421
219 Ga0495684_0078238 3300047471 Bacteria 2510
220 Ga0495602_0210639 3300048088 Bacteria 1476
221 Ga0495615_0232615 3300048090 Unclassified 579
222 Ga0496100_0031231 3300048903 Bacteria 3310
223 Ga0496101_0052798 3300048904 Bacteria 2931
224 Ga0496101_1062970 3300048904 Bacteria 636
225 Ga0496102_0042452 3300048905 Bacteria 4121
226 Ga0496102_0553223 3300048905 Bacteria 1073
227 Ga0496104_0137357 3300048907 Bacteria 2348
228 Ga0496104_0800729 3300048907 Bacteria 848
229 Ga0496104_1488104 3300048907 Bacteria 580
230 Ga0496105_0011278 3300048908 Bacteria 7055
231 Ga0496107_0083250 3300048910 Bacteria 2333
232 Ga0496108_0324572 3300048911 Bacteria 1342
233 Ga0496109_0004389 3300048912 Bacteria 11782
234 Ga0496109_0331838 3300048912 Bacteria 1436
235 Ga0496110_0022792 3300048913 Bacteria 5321
236 Ga0496110_0389151 3300048913 Bacteria 1271
237 Ga0496110_0680453 3300048913 Bacteria 929
238 Ga0496111_0026545 3300048914 Bacteria 4091
239 Ga0496111_0038602 3300048914 Bacteria 3422
240 Ga0496112_0001069 3300048915 Bacteria 20234
241 Ga0496113_0087603 3300048916 Bacteria 2394
242 Ga0496114_0165748 3300048917 Bacteria 1923
243 Ga0496114_0280248 3300048917 Bacteria 1470
244 Ga0496115_0386857 3300048918 Bacteria 1137
245 Ga0496118_0232540 3300048921 Bacteria 1062
246 Ga0496121_0009491 3300048924 Bacteria 11169
247 Ga0501031_0035441 3300049568 Bacteria 3255
248 Ga0501031_0199658 3300049568 Unclassified 1305
249 Ga0501032_0038804 3300049569 Bacteria 3241
250 Ga0501032_0215523 3300049569 Unclassified 1250
251 Ga0501033_0015699 3300049570 Bacteria 5743
252 Ga0501034_0052991 3300049571 Bacteria 4087
253 Ga0501034_0088834 3300049571 Bacteria 3088
254 Ga0501034_0236693 3300049571 Unclassified 1773
255 Ga0501036_0001925 3300049572 Bacteria 16112
256 Ga0501036_0382429 3300049572 Unclassified 1175
257 Ga0501036_0606286 3300049572 Unclassified 908
258 Ga0501037_0037431 3300049573 Bacteria 3577
259 Ga0501037_0070685 3300049573 Bacteria 2539
260 Ga0501037_0100616 3300049573 Bacteria 2087
261 Ga0501038_0007885 3300049574 Bacteria 9813
262 Ga0501038_0329654 3300049574 Bacteria 1192
263 Ga0501039_0004186 3300049575 Bacteria 10867
264 Ga0501040_0000915 3300049576 Bacteria 18519
265 Ga0501041_0004056 3300049577 Bacteria 8459
266 Ga0501043_0027876 3300049579 Bacteria 4433
267 Ga0501043_0035272 3300049579 Bacteria 3934
268 Ga0501043_0364904 3300049579 Bacteria 1096
269 Ga0501046_0116472 3300049580 Bacteria 2036
270 Ga0501047_0218384 3300049581 Unclassified 1763
271 Ga0501047_0369864 3300049581 Bacteria 1268
272 Ga0501047_0697540 3300049581 Bacteria 833
273 Ga0501048_0001257 3300049582 Bacteria 19156
274 Ga0501048_0016352 3300049582 Bacteria 5467
275 Ga0501067_0338214 3300049583 Unclassified 839
276 Ga0501068_0064348 3300049584 Bacteria 2232
277 Ga0501069_0006198 3300049585 Bacteria 6249
278 Ga0501070_0007610 3300049586 Bacteria 9198
279 Ga0501070_0008740 3300049586 Bacteria 8564
280 Ga0501070_0009237 3300049586 Bacteria 8337
281 Ga0501071_0005042 3300049587 Bacteria 8449
282 Ga0501071_0022546 3300049587 Bacteria 4390
283 Ga0501071_0073764 3300049587 Unclassified 2490
284 Ga0501071_1095606 3300049587 Unclassified 615
285 Ga0501072_0191163 3300049588 Bacteria 1632
286 Ga0501072_0432511 3300049588 Unclassified 1043
287 Ga0501073_0056606 3300049589 Bacteria 2742
288 Ga0501073_0188930 3300049589 Bacteria 1425
289 Ga0501073_0409279 3300049589 Bacteria 937
290 Ga0501074_0107921 3300049590 Bacteria 1993
291 Ga0501074_0117199 3300049590 Bacteria 1905
292 Ga0501075_0004007 3300049591 Bacteria 9934
293 Ga0501075_0361259 3300049591 Unclassified 1107
294 Ga0501075_0751297 3300049591 Bacteria 742
295 Ga0501076_0001014 3300049592 Bacteria 18434
296 Ga0501076_0265978 3300049592 Bacteria 1404
297 Ga0501076_0287653 3300049592 Bacteria 1347
298 Ga0501076_1076350 3300049592 Unclassified 662
299 Ga0501077_0000742 3300049593 Bacteria 19755
300 Ga0501077_0434863 3300049593 Unclassified 840
301 Ga0501079_0000900 3300049741 Bacteria 20369
302 Ga0501079_0074628 3300049741 Bacteria 2622
303 Ga0501079_0255492 3300049741 Bacteria 1370
304 Ga0501079_0497906 3300049741 Unclassified 958
305 Ga0501080_0113800 3300049742 Bacteria 2508
306 Ga0501080_0353298 3300049742 Unclassified 1327
307 Ga0501081_0054621 3300049743 Bacteria 2759
308 Ga0501081_0137152 3300049743 Bacteria 1752
309 Ga0501081_0641401 3300049743 Unclassified 796
310 Ga0501083_0006659 3300049744 Bacteria 8196
311 Ga0501083_0312979 3300049744 Bacteria 1021
312 Ga0501035_0065620 3300049822 Bacteria 3223
313 Ga0501035_0313192 3300049822 Unclassified 1320
314 Ga0501044_0016819 3300049823 Bacteria 7848
315 Ga0501044_0414738 3300049823 Unclassified 1257
316 Ga0501045_0335677 3300049824 Bacteria 1125
317 nmdc:mga03683_82385_c1 3300050489 Bacteria 1391
318 nmdc:mga03n38_152054_c1 3300050490 Bacteria 1165
319 nmdc:mga03n38_171241_c1 3300050490 Unclassified 1106
320 nmdc:mga03n38_19691_c1 3300050490 Bacteria 2685
321 nmdc:mga03n38_22387_c1 3300050490 Bacteria 2557
322 nmdc:mga03n38_4323_c1 3300050490 Bacteria 4689
323 nmdc:mga00v17_100806_c1 3300050491 Bacteria 1822
324 nmdc:mga00v17_111757_c1 3300050491 Bacteria 1734
325 nmdc:mga00v17_173086_c1 3300050491 Unclassified 1393
326 nmdc:mga00v17_223141_c1 3300050491 Unclassified 1220
327 nmdc:mga00v17_330843_c1 3300050491 Bacteria 990
328 nmdc:mga00v17_5965_c1 3300050491 Bacteria 6445
329 nmdc:mga0yw44_8540_c1 3300050492 Bacteria 5112
330 nmdc:mga0yw44_9441_c1 3300050492 Bacteria 4934
331 nmdc:mga06z11_425164_c1 3300050494 Unclassified 801
332 nmdc:mga06z11_44046_c1 3300050494 Bacteria 2248
333 nmdc:mga04h51_269692_c1 3300050495 Unclassified 687
334 nmdc:mga05p37_102282_c1 3300050507 Bacteria 3528
335 nmdc:mga05p37_1770699_c1 3300050507 Bacteria 598
336 nmdc:mga05p37_26473_c1 3300050507 Bacteria 7054
337 nmdc:mga09592_1031109_c1 3300050508 Unclassified 686
338 nmdc:mga09592_245539_c1 3300050508 Bacteria 1552
339 nmdc:mga0qj67_23164_c1 3300050509 Bacteria 4775
340 nmdc:mga0qj67_251078_c1 3300050509 Bacteria 1435
341 nmdc:mga06r32_1030444_c1 3300050510 Unclassified 774
342 nmdc:mga06r32_129022_c1 3300050510 Bacteria 2499
343 nmdc:mga08y16_186216_c1 3300050511 Bacteria 2154
344 nmdc:mga08y16_28534_c1 3300050511 Bacteria 5242
345 nmdc:mga08y16_934309_c1 3300050511 Bacteria 851
346 Ga0495601_0008186 3300053077 Bacteria 6167
347 Ga0495601_0023254 3300053077 Bacteria 3808
348 Ga0495612_0055624 3300053078 Bacteria 1632
349 Ga0495595_0072734 3300053084 Unclassified 1627
350 Ga0495595_0095936 3300053084 Bacteria 1427
351 Ga0495595_0608235 3300053084 Unclassified 559
352 Ga0495619_0081587 3300053085 Bacteria 2178
353 Ga0495619_0099889 3300053085 Bacteria 1974
354 Ga0495619_0265104 3300053085 Unclassified 1190
355 Ga0500568_0095381 3300053139 Bacteria 1119
356 Ga0500616_0002874 3300053153 Bacteria 13816
357 Ga0500616_0014388 3300053153 Bacteria 4547
358 Ga0500616_0025311 3300053153 Bacteria 3293
359 Ga0501084_0002851 3300054114 Bacteria 13971
360 Ga0501084_0596471 3300054114 Unclassified 933
361 Ga0501082_0001696 3300060353 Bacteria 19441
362 Ga0501082_0080793 3300060353 Bacteria 2806
363 Ga0501082_0183570 3300060353 Bacteria 1820
364 Ga0501082_0575105 3300060353 Unclassified 986
365 Ga0501082_0894298 3300060353 Bacteria 777
366 Ga0530510_0001557 3300061734 Bacteria 15483
367 Ga0466970_0240638
368 Ga0070658_10000278
369 Ga0070658_10307990
370 Ga0070690_100009067
371 Ga0070689_100109069
372 Ga0070687_100492570
373 Ga0070668_100083904
374 Ga0070668_100665438
375 Ga0070673_100944567
376 Ga0070688_100064283
377 Ga0070688_101071962
378 Ga0070659_100431205
379 Ga0070667_100587769
380 Ga0070678_100883698
381 Ga0070681_10138657
382 Ga0070681_11041891
383 Ga0070699_100311691
384 Ga0070679_100026578
385 Ga0070697_100373666
386 Ga0068853_101227745
387 Ga0068853_101822536
388 Ga0070686_100015074
389 Ga0070696_100839133
390 Ga0070693_100221946
391 Ga0070665_100527070
392 Ga0068855_100152109
393 Ga0070702_100194981
394 Ga0068859_100221229
395 Ga0068859_102142411
396 Ga0068866_10018832
397 Ga0068861_100239745
398 Ga0068870_10417459
399 Ga0068863_100620728
400 Ga0068858_101085243
401 Ga0075365_10025549
402 Ga0075365_10185413
403 Ga0075365_10272166
404 Ga0075364_10000990
405 Ga0075364_10171408
406 Ga0075364_10471352
407 Ga0075367_10283165
408 Ga0075366_10227972
409 Ga0097621_100059166
410 Ga0068871_100150266
411 Ga0068871_101018237
412 Ga0075428_100064880
413 Ga0075428_100238340
414 Ga0075428_100507115
415 Ga0075428_100693963
416 Ga0075430_100041775
417 Ga0075430_100221545
418 Ga0075431_100046651
419 Ga0075429_100135946
420 Ga0097620_100221211
421 Ga0097620_102142536
422 Ga0099794_10429435
423 Ga0099795_10270734
424 Ga0105240_10144722
425 Ga0111539_10001628
426 Ga0111539_11380975
427 Ga0105245_10064326
428 Ga0105245_10345942
429 Ga0105245_10482205
430 Ga0105245_11088264
431 Ga0114129_10109215
432 Ga0114129_10124415
433 Ga0114129_10161729
434 Ga0114129_12122116
435 Ga0105243_10181005
436 Ga0105243_11126442
437 Ga0105241_11769420
438 Ga0105242_10002127
439 Ga0105242_10066511
440 Ga0105248_10574921
441 Ga0105248_11241198
442 Ga0105249_10122713
443 Ga0105246_10972624
444 Ga0157325_1019486
445 Ga0157370_10348589
446 Ga0157378_10068888
447 Ga0157378_10072993
448 Ga0157378_10566558
449 Ga0157378_11502712
450 Ga0163162_10547281
451 Ga0157372_12140665
452 Ga0157375_10025570
453 Ga0163163_10935667
454 Ga0157380_11266616
455 Ga0157377_10337081
456 Ga0157379_10200283
457 Ga0157376_10516866
458 Ga0157376_10963185
459 Ga0157376_11070723
460 Ga0157376_11349280
461 Ga0182007_10295567
462 Ga0197907_10651705
463 Ga0206352_10439361
464 Ga0206350_10769748
465 Ga0206350_11423628
466 Ga0206354_11554126
467 Ga0224712_10124631
468 Ga0207697_10105438
469 Ga0207642_10017718
470 Ga0207710_10173410
471 Ga0207688_10408365
472 Ga0207645_10465176
473 Ga0207705_10279459
474 Ga0207707_10357538
475 Ga0207707_11352479
476 Ga0207652_10217444
477 Ga0207650_10170707
478 Ga0207659_10332144
479 Ga0207687_10006374
480 Ga0207687_10071295
481 Ga0207664_10046938
482 Ga0207686_10020706
483 Ga0207709_10825315
484 Ga0207669_10028252
485 Ga0207704_10096528
486 Ga0207691_11272657
487 Ga0207711_10139004
488 Ga0207667_10120135
489 Ga0207712_10060733
490 Ga0207668_10172309
491 Ga0207640_11062104
492 Ga0207677_10967162
493 Ga0207677_11566335
494 Ga0207648_10019359
495 Ga0207675_100075924
496 Ga0207675_100442483
497 Ga0207675_101119463
498 Ga0207683_10157547
499 Ga0207698_10606463
500 Ga0209813_10060104
501 Ga0207428_10376069
502 Ga0268265_11601958
503 Ga0268264_10013067
504 Ga0265334_10038198
505 Ga0265338_10003811
506 Ga0265325_10001494
507 Ga0265339_10001791
508 Ga0265331_10127718
509 Ga0265327_10136320
510 Ga0265316_10075417
511 Ga0265313_10002797
512 Ga0265314_10046416
513 Ga0307405_10446828
514 Ga0307413_10048768
515 Ga0307407_10248377
516 Ga0307409_101109625
517 Ga0307416_100294375
518 Ga0307411_10020362
519 Ga0307415_100123416
520 Ga0373944_0238090
521 Ga0373936_0413233
522 Ga0373945_0091947
523 Ga0373946_0363782
524 Ga0395900_0269825
525 Ga0436365_0589599
526 Ga0436361_0147261
527 Ga0451795_0480959
528 Ga0451804_0541095
529 Ga0451841_0380764
530 Ga0451853_3555519
531 Ga0439450_051240
532 Ga0466972_0018411
533 Ga0466961_0043254
534 Ga0466961_0425859
535 Ga0466963_0039564
536 Ga0466971_0138257
537 Ga0466971_0416545
538 Ga0466970_0011927
539 Ga0466957_0034857
540 Ga0466957_0988630
541 Ga0466959_0010667
542 Ga0466958_0156677
543 Ga0466958_0219707
544 Ga0466958_0359736
545 Ga0466967_1031083
546 Ga0466967_1355216
547 Ga0495592_0031111
548 Ga0495592_0494513
549 Ga0495629_0603475
550 Ga0495651_0975133
551 Ga0495664_0058101
552 Ga0495664_0472852
553 Ga0495594_0324014
554 Ga0495608_0116574
555 Ga0495608_0128269
556 Ga0495608_0297021
557 Ga0495618_0257195
558 Ga0495628_0006675
559 Ga0495628_0018301
560 Ga0495628_0405278
561 Ga0495630_0000885
562 Ga0495630_0209107
563 Ga0495643_0323480
564 Ga0495666_0190857
565 Ga0495652_0399261
566 Ga0495640_0191063
567 Ga0495586_0490554
568 Ga0495621_0289539
569 Ga0495645_0218627
570 Ga0495667_0208758
571 Ga0495634_0025711
572 Ga0495657_0055774
573 Ga0495657_0336763
574 Ga0495646_0218365
575 Ga0495613_0032288
576 Ga0495624_0199088
577 Ga0495649_0493354
578 Ga0495600_0254426
579 Ga0495604_0161653
580 Ga0495674_0129185
581 Ga0495674_0344820
582 Ga0495680_0111994
583 Ga0495680_0119745
584 Ga0495680_0203001
585 Ga0495684_0078238
586 Ga0495602_0210639
587 Ga0495615_0232615
588 Ga0496100_0031231
589 Ga0496101_0052798
590 Ga0496101_1062970
591 Ga0496102_0042452
592 Ga0496102_0553223
593 Ga0496104_0137357
594 Ga0496104_0800729
595 Ga0496104_1488104
596 Ga0496105_0011278
597 Ga0496107_0083250
598 Ga0496108_0324572
599 Ga0496109_0004389
600 Ga0496109_0331838
601 Ga0496110_0022792
602 Ga0496110_0389151
603 Ga0496110_0680453
604 Ga0496111_0026545
605 Ga0496111_0038602
606 Ga0496112_0001069
607 Ga0496113_0087603
608 Ga0496114_0165748
609 Ga0496114_0280248
610 Ga0496115_0386857
611 Ga0496118_0232540
612 Ga0496121_0009491
613 Ga0501031_0035441
614 Ga0501031_0199658
615 Ga0501032_0038804
616 Ga0501032_0215523
617 Ga0501033_0015699
618 Ga0501034_0052991
619 Ga0501034_0088834
620 Ga0501034_0236693
621 Ga0501036_0001925
622 Ga0501036_0382429
623 Ga0501036_0606286
624 Ga0501037_0037431
625 Ga0501037_0070685
626 Ga0501037_0100616
627 Ga0501038_0007885
628 Ga0501038_0329654
629 Ga0501039_0004186
630 Ga0501040_0000915
631 Ga0501041_0004056
632 Ga0501043_0027876
633 Ga0501043_0035272
634 Ga0501043_0364904
635 Ga0501046_0116472
636 Ga0501047_0218384
637 Ga0501047_0369864
638 Ga0501047_0697540
639 Ga0501048_0001257
640 Ga0501048_0016352
641 Ga0501067_0338214
642 Ga0501068_0064348
643 Ga0501069_0006198
644 Ga0501070_0007610
645 Ga0501070_0008740
646 Ga0501070_0009237
647 Ga0501071_0005042
648 Ga0501071_0022546
649 Ga0501071_0073764
650 Ga0501071_1095606
651 Ga0501072_0191163
652 Ga0501072_0432511
653 Ga0501073_0056606
654 Ga0501073_0188930
655 Ga0501073_0409279
656 Ga0501074_0107921
657 Ga0501074_0117199
658 Ga0501075_0004007
659 Ga0501075_0361259
660 Ga0501075_0751297
661 Ga0501076_0001014
662 Ga0501076_0265978
663 Ga0501076_0287653
664 Ga0501076_1076350
665 Ga0501077_0000742
666 Ga0501077_0434863
667 Ga0501079_0000900
668 Ga0501079_0074628
669 Ga0501079_0255492
670 Ga0501079_0497906
671 Ga0501080_0113800
672 Ga0501080_0353298
673 Ga0501081_0054621
674 Ga0501081_0137152
675 Ga0501081_0641401
676 Ga0501083_0006659
677 Ga0501083_0312979
678 Ga0501035_0065620
679 Ga0501035_0313192
680 Ga0501044_0016819
681 Ga0501044_0414738
682 Ga0501045_0335677
683 nmdc:mga03683_82385_c1
684 nmdc:mga03n38_152054_c1
685 nmdc:mga03n38_171241_c1
686 nmdc:mga03n38_19691_c1
687 nmdc:mga03n38_22387_c1
688 nmdc:mga03n38_4323_c1
689 nmdc:mga00v17_100806_c1
690 nmdc:mga00v17_111757_c1
691 nmdc:mga00v17_173086_c1
692 nmdc:mga00v17_223141_c1
693 nmdc:mga00v17_330843_c1
694 nmdc:mga00v17_5965_c1
695 nmdc:mga0yw44_8540_c1
696 nmdc:mga0yw44_9441_c1
697 nmdc:mga06z11_425164_c1
698 nmdc:mga06z11_44046_c1
699 nmdc:mga04h51_269692_c1
700 nmdc:mga05p37_102282_c1
701 nmdc:mga05p37_1770699_c1
702 nmdc:mga05p37_26473_c1
703 nmdc:mga09592_1031109_c1
704 nmdc:mga09592_245539_c1
705 nmdc:mga0qj67_23164_c1
706 nmdc:mga0qj67_251078_c1
707 nmdc:mga06r32_1030444_c1
708 nmdc:mga06r32_129022_c1
709 nmdc:mga08y16_186216_c1
710 nmdc:mga08y16_28534_c1
711 nmdc:mga08y16_934309_c1
712 Ga0495601_0008186
713 Ga0495601_0023254
714 Ga0495612_0055624
715 Ga0495595_0072734
716 Ga0495595_0095936
717 Ga0495595_0608235
718 Ga0495619_0081587
719 Ga0495619_0099889
720 Ga0495619_0265104
721 Ga0500568_0095381
722 Ga0500616_0002874
723 Ga0500616_0014388
724 Ga0500616_0025311
725 Ga0501084_0002851
726 Ga0501084_0596471
727 Ga0501082_0001696
728 Ga0501082_0080793
729 Ga0501082_0183570
730 Ga0501082_0575105
731 Ga0501082_0894298
732 Ga0530510_0001557

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01243

Putative_PNPOx

Pyridoxamine 5'-phosphate oxidase

33

108

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2hti-assembly1.cif.gz_A-2 crystal structure of a flavin-nucleotide-binding protein (bh_0577) from bacillus halodurans at 2.50 a resolution 0.8195 46 193
3db0-assembly1.cif.gz_B crystal structure of putative pyridoxamine 5'-phosphate oxidase (np_472219.1) from listeria innocua at 2.00 a resolution 0.797 51 197
6vna-assembly1.cif.gz_C pden_1323 0.7867 48 206
2hti-assembly1.cif.gz_A-2 crystal structure of a flavin-nucleotide-binding protein (bh_0577) from bacillus halodurans at 2.50 a resolution 0.7845 46 193
2ig6-assembly1.cif.gz_A crystal structure of a nimc/nima family protein (ca_c2569) from clostridium acetobutylicum at 1.80 a resolution 0.7757 72 203
ID Description Score Start End Superfamily
2htiA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7962 46 192 2.30.110.10
2iabB01 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7864 50 193 2.30.110.10
af_Q2FVN7_2_129_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7805 71 193 2.30.110.10
2imlD01 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7756 71 137 2.30.110.10
1rfeA01 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7697 48 199 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A2W6C6W5-F1-model_v4 Pyridoxamine 5'-phosphate oxidase 0.9783 36 207 GO:0005829
GO:0016627
GO:0070967
AF-A0A2W6C6W5-F1-model_v4 Pyridoxamine 5'-phosphate oxidase 0.9617 36 207 GO:0005829
GO:0016627
GO:0070967
AF-A0A2W4PEQ3-F1-model_v4 Pyridoxamine 5'-phosphate oxidase 0.9565 36 207 GO:0005829
GO:0016627
GO:0070967
AF-A0A2W4PEQ3-F1-model_v4 Pyridoxamine 5'-phosphate oxidase 0.9404 36 207 GO:0005829
GO:0016627
GO:0070967
AF-R1HWJ1-F1-model_v4 Pyridoxamine 5'-phosphate oxidase 0.9335 78 207 GO:0005829
GO:0016627
GO:0070967

Map