F424074

General Info

Members Datasets Scaffolds Average Seq Length
366 212 364 257

Family's Representative Sequence

Representative Sequence 3300035170|Ga0373943_0123537|Ga0373943_0123537_228_1088
Length 286
Sequence LGIVGVARAHEVANPLRRWYPFPSSGGSMSFSLEGRVAVVFGVANKRSIAWSIAQGLHQAGAKLAITYQNERLELEAKDLIQSLPSAEAFMCDVSKDEEIERLFGELKDRYGKLHVLVHSVAFALAEDMKGEFVNTTREGFRIAHDVSVYSLIAVSRAAAPLMTDESGGSIVTMSYYGAEKVVPHYNVMGVAKAALECTVRYLANDLGPKKIRVNAISAGPIKTLAARGVSGLGEMLKSHSERSPLKRNVDVNEVGATGVFLASDASSGITGEVIYVDCGYNIMGF

Samples

Sample ID Description Type Environment
1 2852673933 Sporosarcina sp. JAI121 Isolate Rhizosphere
2 2928510474 Sporosarcina psychrophila 1288 Isolate Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
81 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
82 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
83 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
84 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
85 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
117 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
118 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
119 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
120 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
121 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
122 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
123 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
124 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
125 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
126 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
127 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
128 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
129 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
130 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
131 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
133 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
134 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
135 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
136 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
137 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
138 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
139 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
140 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
141 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
142 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
143 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
146 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
148 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
149 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
150 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
151 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
152 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
153 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
154 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
155 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
156 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
157 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
158 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
159 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
160 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
161 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
162 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
163 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
164 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
165 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
166 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
167 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
168 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
169 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
170 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
171 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
172 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
173 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
174 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
175 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
176 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
177 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
178 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
179 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
180 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
181 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
182 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
183 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
186 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
187 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
188 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
189 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
190 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
191 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
192 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
193 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
194 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
195 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
196 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
197 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
198 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
199 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
200 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
201 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
202 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
203 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
204 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
205 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
206 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
207 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
208 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
209 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
210 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
211 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
212 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.18
Metatranscriptomes 0.27
Isolates 0.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.55
Nodule 0
Rhizoplane 2.73
Rhizosphere 94.81
Stem 0
Stem Tuber 0
Unclassified 1.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1004044 3300001977 Bacteria 2318
2 JGI25406J46586_10022636 3300003203 Bacteria 2499
3 JGI25406J46586_10085294 3300003203 Bacteria 961
4 Ga0065704_10181983 3300005289 Bacteria 1232
5 Ga0065712_10070856 3300005290 Bacteria 5650
6 Ga0065712_10101048 3300005290 Bacteria 2046
7 Ga0065712_10106652 3300005290 Bacteria 1913
8 Ga0065715_10102822 3300005293 Bacteria 3082
9 Ga0070658_10010246 3300005327 Bacteria 7516
10 Ga0068869_100021497 3300005334 Bacteria 4439
11 Ga0070682_100086099 3300005337 Bacteria 2045
12 Ga0070682_100409949 3300005337 Bacteria 1027
13 Ga0070689_100309967 3300005340 Bacteria 1316
14 Ga0070674_100075369 3300005356 Bacteria 2396
15 Ga0070674_100342998 3300005356 Bacteria 1204
16 Ga0070673_100119298 3300005364 Bacteria 2198
17 Ga0070709_10058471 3300005434 Bacteria 2445
18 Ga0070709_10231927 3300005434 Bacteria 1321
19 Ga0070709_10347116 3300005434 Bacteria 1095
20 Ga0070714_100104370 3300005435 Bacteria 2501
21 Ga0070714_100115215 3300005435 Bacteria 2385
22 Ga0070713_100006273 3300005436 Bacteria 8230
23 Ga0070713_100034930 3300005436 Bacteria 4044
24 Ga0070713_100090357 3300005436 Bacteria 2632
25 Ga0070713_100277201 3300005436 Bacteria 1537
26 Ga0070713_100318266 3300005436 Bacteria 1436
27 Ga0070710_10260696 3300005437 Bacteria 1117
28 Ga0070711_100080444 3300005439 Unclassified 2320
29 Ga0070711_100247111 3300005439 Bacteria 1398
30 Ga0070700_100150699 3300005441 Bacteria 1590
31 Ga0070700_100330369 3300005441 Bacteria 1123
32 Ga0070708_100002287 3300005445 Bacteria 14823
33 Ga0070708_100007880 3300005445 Bacteria 8529
34 Ga0070708_100127118 3300005445 Bacteria 2357
35 Ga0070708_100306751 3300005445 Bacteria 1495
36 Ga0070678_100061402 3300005456 Bacteria 2770
37 Ga0070678_100149456 3300005456 Bacteria 1880
38 Ga0070681_10071772 3300005458 Bacteria 3427
39 Ga0070681_10089035 3300005458 Bacteria 3038
40 Ga0070681_10100231 3300005458 Bacteria 2843
41 Ga0070681_10104687 3300005458 Bacteria 2772
42 Ga0070681_10161921 3300005458 Bacteria 2161
43 Ga0070706_100192069 3300005467 Bacteria 1908
44 Ga0070707_100001757 3300005468 Bacteria 20876
45 Ga0070699_100072443 3300005518 Bacteria 2997
46 Ga0070699_100440947 3300005518 Bacteria 1180
47 Ga0070679_100070982 3300005530 Bacteria 3473
48 Ga0070697_100000097 3300005536 Bacteria 72732
49 Ga0070697_100002435 3300005536 Bacteria 14318
50 Ga0068853_100012582 3300005539 Bacteria 6884
51 Ga0068853_100049013 3300005539 Bacteria 3628
52 Ga0070696_100116803 3300005546 Bacteria 1927
53 Ga0070693_100017809 3300005547 Bacteria 3700
54 Ga0070693_100063722 3300005547 Bacteria 2149
55 Ga0070665_100100413 3300005548 Bacteria 2898
56 Ga0070704_100001046 3300005549 Bacteria 14290
57 Ga0068855_100454938 3300005563 Bacteria 1396
58 Ga0070664_100129114 3300005564 Bacteria 2219
59 Ga0068854_100055893 3300005578 Bacteria 2844
60 Ga0068856_100133551 3300005614 Bacteria 2487
61 Ga0068856_100479545 3300005614 Bacteria 1265
62 Ga0070702_100001690 3300005615 Bacteria 9157
63 Ga0070702_100181231 3300005615 Bacteria 1378
64 Ga0070702_100496744 3300005615 Bacteria 895
65 Ga0068852_100137824 3300005616 Unclassified 2254
66 Ga0068852_100212617 3300005616 Bacteria 1835
67 Ga0068859_100522891 3300005617 Bacteria 1281
68 Ga0068864_100053286 3300005618 Bacteria 3489
69 Ga0068864_100231288 3300005618 Bacteria 1710
70 Ga0068851_10030963 3300005834 Bacteria 2655
71 Ga0068858_100444616 3300005842 Bacteria 1249
72 Ga0068862_100280664 3300005844 Bacteria 1526
73 Ga0081539_10000022 3300005985 Bacteria 356710
74 Ga0081539_10003445 3300005985 Bacteria 19432
75 Ga0081539_10142771 3300005985 Unclassified 1161
76 Ga0070717_10001725 3300006028 Bacteria 15249
77 Ga0070717_10010972 3300006028 Bacteria 6860
78 Ga0070717_10108564 3300006028 Bacteria 2364
79 Ga0070717_10407952 3300006028 Bacteria 1221
80 Ga0070716_100006877 3300006173 Bacteria 5576
81 Ga0070716_100366989 3300006173 Bacteria 1024
82 Ga0070712_100002791 3300006175 Bacteria 10788
83 Ga0070712_100309846 3300006175 Bacteria 1280
84 Ga0097621_100144218 3300006237 Bacteria 2037
85 Ga0075428_100004509 3300006844 Bacteria 15380
86 Ga0075428_100298807 3300006844 Bacteria 1731
87 Ga0075431_100002500 3300006847 Bacteria 17731
88 Ga0075431_100211151 3300006847 Bacteria 1983
89 Ga0075433_10036152 3300006852 Bacteria 4252
90 Ga0075434_100010745 3300006871 Bacteria 8599
91 Ga0075434_100056114 3300006871 Bacteria 3914
92 Ga0075429_100031615 3300006880 Bacteria 4600
93 Ga0075429_100649937 3300006880 Bacteria 924
94 Ga0075436_100047009 3300006914 Bacteria 2977
95 Ga0075436_100209707 3300006914 Bacteria 1381
96 Ga0097620_100522914 3300006931 Bacteria 1281
97 Ga0075435_100008893 3300007076 Bacteria 7236
98 Ga0075435_100017301 3300007076 Bacteria 5454
99 Ga0075435_100121391 3300007076 Bacteria 2181
100 Ga0099794_10081353 3300007265 Bacteria 1598
101 Ga0105240_10084439 3300009093 Bacteria 3893
102 Ga0105240_10721415 3300009093 Bacteria 1086
103 Ga0111539_10006615 3300009094 Bacteria 14932
104 Ga0111539_10021014 3300009094 Bacteria 8039
105 Ga0111539_10026836 3300009094 Bacteria 7036
106 Ga0105245_10030198 3300009098 Bacteria 4792
107 Ga0105245_10126013 3300009098 Bacteria 2398
108 Ga0105245_10219841 3300009098 Bacteria 1832
109 Ga0105247_10060100 3300009101 Bacteria 2355
110 Ga0105247_10178313 3300009101 Bacteria 1416
111 Ga0114129_10004357 3300009147 Bacteria 19984
112 Ga0114129_10251636 3300009147 Bacteria 2371
113 Ga0105241_10045985 3300009174 Bacteria 3314
114 Ga0105241_10129496 3300009174 Bacteria 2041
115 Ga0105242_10128463 3300009176 Bacteria 2184
116 Ga0105248_10081558 3300009177 Bacteria 3636
117 Ga0105237_10167947 3300009545 Unclassified 2193
118 Ga0105238_10155903 3300009551 Bacteria 2259
119 Ga0105238_10279202 3300009551 Bacteria 1651
120 Ga0105238_10820864 3300009551 Bacteria 946
121 Ga0105239_10096650 3300010375 Bacteria 3263
122 Ga0105239_10877486 3300010375 Bacteria 1029
123 Ga0105246_10429777 3300011119 Bacteria 1104
124 Ga0157373_10428656 3300013100 Bacteria 950
125 Ga0157371_10114538 3300013102 Bacteria 1915
126 Ga0157370_10019660 3300013104 Bacteria 6764
127 Ga0157369_10000234 3300013105 Bacteria 76957
128 Ga0157369_10205203 3300013105 Bacteria 2067
129 Ga0157369_10209954 3300013105 Bacteria 2041
130 Ga0157374_10300742 3300013296 Bacteria 1587
131 Ga0157378_10032469 3300013297 Bacteria 4612
132 Ga0157378_10125691 3300013297 Bacteria 2368
133 Ga0157378_10630051 3300013297 Bacteria 1086
134 Ga0163162_10404361 3300013306 Bacteria 1498
135 Ga0157372_10323668 3300013307 Bacteria 1795
136 Ga0163163_10194067 3300014325 Bacteria 2078
137 Ga0157380_10003003 3300014326 Bacteria 11485
138 Ga0213873_10001976 3300021358 Bacteria 3500
139 Ga0213872_10007301 3300021361 Bacteria 5454
140 Ga0213876_10000236 3300021384 Bacteria 53620
141 Ga0213875_10019242 3300021388 Bacteria 3286
142 Ga0224572_1001070 3300024225 Bacteria 3832
143 Ga0207656_10008745 3300025321 Bacteria 3741
144 Ga0207699_10021948 3300025906 Bacteria 3451
145 Ga0207643_10000775 3300025908 Bacteria 19477
146 Ga0207684_10006193 3300025910 Bacteria 10925
147 Ga0207684_10136119 3300025910 Bacteria 2109
148 Ga0207684_10163797 3300025910 Bacteria 1915
149 Ga0207707_10014874 3300025912 Bacteria 6777
150 Ga0207707_10058670 3300025912 Unclassified 3349
151 Ga0207707_10217742 3300025912 Unclassified 1662
152 Ga0207707_10547544 3300025912 Bacteria 983
153 Ga0207695_10125931 3300025913 Bacteria 2524
154 Ga0207671_10221614 3300025914 Unclassified 1482
155 Ga0207693_10012921 3300025915 Bacteria 6738
156 Ga0207693_10083895 3300025915 Bacteria 2496
157 Ga0207663_10273608 3300025916 Bacteria 1252
158 Ga0207660_10250935 3300025917 Bacteria 1396
159 Ga0207652_10011269 3300025921 Bacteria 7203
160 Ga0207652_10085531 3300025921 Bacteria 2764
161 Ga0207652_10180217 3300025921 Bacteria 1898
162 Ga0207646_10002595 3300025922 Bacteria 21331
163 Ga0207646_10105971 3300025922 Bacteria 2521
164 Ga0207694_10269687 3300025924 Bacteria 1396
165 Ga0207687_10000669 3300025927 Bacteria 23062
166 Ga0207687_10284134 3300025927 Bacteria 1327
167 Ga0207700_10017148 3300025928 Bacteria 4829
168 Ga0207700_10053819 3300025928 Bacteria 3018
169 Ga0207700_10226252 3300025928 Bacteria 1588
170 Ga0207700_10315088 3300025928 Bacteria 1354
171 Ga0207700_10350663 3300025928 Bacteria 1285
172 Ga0207700_10413125 3300025928 Bacteria 1184
173 Ga0207664_10125913 3300025929 Bacteria 2151
174 Ga0207690_10101466 3300025932 Bacteria 2056
175 Ga0207665_10008078 3300025939 Bacteria 6945
176 Ga0207665_10035302 3300025939 Bacteria 3319
177 Ga0207711_10376685 3300025941 Bacteria 1316
178 Ga0207689_10181514 3300025942 Bacteria 1735
179 Ga0207661_10025691 3300025944 Bacteria 4480
180 Ga0207661_10148341 3300025944 Bacteria 2025
181 Ga0207667_10366718 3300025949 Bacteria 1468
182 Ga0207667_10468890 3300025949 Bacteria 1279
183 Ga0207640_10066114 3300025981 Bacteria 2415
184 Ga0207640_10106933 3300025981 Bacteria 1974
185 Ga0207677_10498810 3300026023 Bacteria 1052
186 Ga0207703_10291686 3300026035 Bacteria 1485
187 Ga0207639_10054798 3300026041 Bacteria 3049
188 Ga0207639_10076360 3300026041 Bacteria 2638
189 Ga0207702_10099029 3300026078 Bacteria 2569
190 Ga0207702_10116503 3300026078 Bacteria 2384
191 Ga0207702_10154578 3300026078 Bacteria 2090
192 Ga0207641_10066089 3300026088 Bacteria 3095
193 Ga0207676_10062701 3300026095 Bacteria 2949
194 Ga0207676_10235281 3300026095 Bacteria 1640
195 Ga0207674_10026221 3300026116 Bacteria 6197
196 Ga0207674_10240678 3300026116 Bacteria 1756
197 Ga0209179_1052051 3300027512 Bacteria 879
198 Ga0265337_1003556 3300028556 Bacteria 6716
199 Ga0265319_1000684 3300028563 Bacteria 22095
200 Ga0265318_10001920 3300028577 Bacteria 11624
201 Ga0265336_10013829 3300028666 Bacteria 2685
202 Ga0265336_10026270 3300028666 Bacteria 1830
203 Ga0265338_10006778 3300028800 Bacteria 14442
204 Ga0265338_10052802 3300028800 Bacteria 3643
205 Ga0316182_1370321 3300030745 Bacteria 867
206 Ga0265320_10064744 3300031240 Bacteria 1736
207 Ga0265339_10057999 3300031249 Bacteria 2092
208 Ga0265316_10044887 3300031344 Bacteria 3512
209 Ga0307408_100356755 3300031548 Bacteria 1242
210 Ga0265314_10034397 3300031711 Bacteria 3704
211 Ga0265314_10113999 3300031711 Bacteria 1713
212 Ga0307405_10162178 3300031731 Bacteria 1585
213 Ga0316577_10142451 3300031733 Bacteria 1350
214 Ga0307406_10272153 3300031901 Bacteria 1287
215 Ga0316583_10059993 3300032133 Bacteria 1334
216 Ga0316586_1036440 3300033527 Bacteria 855
217 Ga0373926_0008168 3300035083 Bacteria 3485
218 Ga0373926_0012319 3300035083 Bacteria 2889
219 Ga0373936_0142826 3300035113 Bacteria 1034
220 Ga0373939_0069602 3300035114 Bacteria 1142
221 Ga0373945_0005328 3300035116 Bacteria 4116
222 Ga0373943_0106799 3300035170 Bacteria 1471
223 Ga0373943_0123537 3300035170 Bacteria 1378
224 Ga0373943_0132831 3300035170 Bacteria 1333
225 Ga0373943_0189154 3300035170 Bacteria 1135
226 Ga0373946_0027732 3300035171 Bacteria 2242
227 Ga0373946_0171916 3300035171 Bacteria 1023
228 Ga0373942_0035742 3300035207 Bacteria 1334
229 Ga0373924_0123974 3300035410 Bacteria 1122
230 Ga0373931_0021802 3300035691 Bacteria 3217
231 Ga0373935_0001266 3300035692 Bacteria 13929
232 Ga0373935_0100005 3300035692 Bacteria 1910
233 Ga0373935_0139068 3300035692 Bacteria 1639
234 Ga0373935_0413383 3300035692 Bacteria 970
235 Ga0373927_0007668 3300035695 Bacteria 7303
236 Ga0373927_0008982 3300035695 Bacteria 6709
237 Ga0373927_0033421 3300035695 Bacteria 3349
238 Ga0373927_0046600 3300035695 Bacteria 2805
239 Ga0373947_0010972 3300035725 Bacteria 5198
240 Ga0373947_0016967 3300035725 Bacteria 4184
241 Ga0373947_0023027 3300035725 Bacteria 3619
242 Ga0373947_0155223 3300035725 Unclassified 1477
243 Ga0373947_0510249 3300035725 Bacteria 817
244 Ga0373937_0000094 3300036401 Bacteria 82254
245 Ga0373937_0035702 3300036401 Bacteria 4526
246 Ga0373937_0370587 3300036401 Bacteria 1358
247 Ga0316582_0197719 3300036647 Unclassified 1371
248 Ga0373925_0003934 3300037068 Bacteria 11343
249 Ga0373925_0015061 3300037068 Bacteria 5589
250 Ga0373925_0054982 3300037068 Bacteria 2978
251 Ga0373925_0067100 3300037068 Bacteria 2705
252 Ga0373925_0152148 3300037068 Bacteria 1817
253 Ga0373925_0377848 3300037068 Bacteria 1153
254 Ga0395898_0172052 3300037466 Bacteria 2070
255 Ga0436364_0987940 3300037853 Bacteria 2771
256 Ga0436364_1440387 3300037853 Bacteria 959
257 Ga0436365_0243354 3300039437 Bacteria 1962
258 Ga0436365_0845597 3300039437 Bacteria 47720
259 Ga0436360_1000797 3300039438 Bacteria 1418
260 Ga0436361_0248901 3300039447 Bacteria 25197
261 Ga0436362_0899955 3300039453 Bacteria 4151
262 Ga0451577_0132692 3300042876 Bacteria 2235
263 Ga0451577_0219277 3300042876 Bacteria 1719
264 Ga0451577_0587780 3300042876 Bacteria 1011
265 Ga0451577_0723981 3300042876 Bacteria 901
266 Ga0453683_0096027 3300044673 Bacteria 1860
267 Ga0466957_0001046 3300044842 Bacteria 14271
268 Ga0451576_0001510 3300045051 Bacteria 39222
269 Ga0451576_0007066 3300045051 Bacteria 13563
270 Ga0451576_0033283 3300045051 Bacteria 5479
271 Ga0451576_0071201 3300045051 Bacteria 3618
272 Ga0451576_0299661 3300045051 Bacteria 1681
273 Ga0466967_0012628 3300045976 Bacteria 6476
274 Ga0466967_0056731 3300045976 Bacteria 3455
275 Ga0495580_0000223 3300046472 Bacteria 44018
276 Ga0495580_0009330 3300046472 Bacteria 7720
277 Ga0495580_0028230 3300046472 Bacteria 4080
278 Ga0495580_0049621 3300046472 Bacteria 2969
279 Ga0495580_0066804 3300046472 Bacteria 2516
280 Ga0495580_0072561 3300046472 Bacteria 2404
281 Ga0495580_0081094 3300046472 Bacteria 2261
282 Ga0495580_0148792 3300046472 Bacteria 1622
283 Ga0495582_0005902 3300046473 Bacteria 6824
284 Ga0495582_0067569 3300046473 Bacteria 1975
285 Ga0495639_0079390 3300046475 Bacteria 1526
286 Ga0495639_0163825 3300046475 Bacteria 1077
287 Ga0495594_0381702 3300046499 Bacteria 802
288 Ga0495608_0238895 3300046511 Bacteria 1136
289 Ga0495618_0188227 3300046514 Bacteria 1310
290 Ga0495630_0111500 3300046517 Bacteria 2072
291 Ga0495630_0167141 3300046517 Bacteria 1675
292 Ga0495665_0002199 3300046531 Bacteria 10562
293 Ga0495665_0025596 3300046531 Bacteria 3169
294 Ga0495665_0068576 3300046531 Bacteria 1870
295 Ga0495667_0132993 3300046559 Bacteria 1604
296 Ga0495667_0267587 3300046559 Bacteria 1086
297 Ga0495668_0076407 3300046616 Bacteria 1839
298 Ga0495634_0167027 3300046642 Bacteria 1385
299 Ga0495635_0133808 3300046663 Bacteria 1690
300 Ga0495658_0199069 3300046683 Bacteria 1248
301 Ga0495658_0373824 3300046683 Bacteria 907
302 Ga0495669_0017093 3300046684 Bacteria 3109
303 Ga0495669_0116346 3300046684 Bacteria 1251
304 Ga0495581_0005004 3300047315 Bacteria 7678
305 Ga0495581_0017273 3300047315 Bacteria 4193
306 Ga0495581_0084186 3300047315 Bacteria 1843
307 Ga0495604_0122858 3300047317 Bacteria 1877
308 Ga0495674_0325282 3300047319 Bacteria 1252
309 Ga0495674_0429592 3300047319 Bacteria 1063
310 Ga0495614_0127699 3300048089 Bacteria 1124
311 Ga0496104_0226365 3300048907 Bacteria 1782
312 Ga0496104_0425957 3300048907 Bacteria 1239
313 Ga0496105_0000394 3300048908 Bacteria 28691
314 Ga0496105_0467993 3300048908 Bacteria 993
315 Ga0496111_0097364 3300048914 Bacteria 2160
316 Ga0496112_0023825 3300048915 Bacteria 5855
317 Ga0496112_0151529 3300048915 Bacteria 2286
318 Ga0496112_0517821 3300048915 Unclassified 1127
319 Ga0496113_0258014 3300048916 Bacteria 1392
320 Ga0496115_0004216 3300048918 Bacteria 10392
321 Ga0496126_0005616 3300048929 Bacteria 14262
322 Ga0501039_0044217 3300049575 Bacteria 3440
323 Ga0501041_0007003 3300049577 Bacteria 6614
324 Ga0501068_0203263 3300049584 Bacteria 1256
325 Ga0501070_0014518 3300049586 Bacteria 6627
326 Ga0501072_0305742 3300049588 Bacteria 1264
327 Ga0501075_0040134 3300049591 Bacteria 3504
328 Ga0501076_0003483 3300049592 Bacteria 11054
329 Ga0501076_0402230 3300049592 Bacteria 1126
330 Ga0501077_0005232 3300049593 Bacteria 7885
331 Ga0501077_0015088 3300049593 Bacteria 4858
332 Ga0501079_0021753 3300049741 Bacteria 4909
333 Ga0501079_0501580 3300049741 Bacteria 954
334 Ga0501080_0063288 3300049742 Bacteria 3443
335 Ga0501080_0105322 3300049742 Bacteria 2615
336 Ga0501081_0003140 3300049743 Bacteria 10501
337 Ga0501083_0149005 3300049744 Bacteria 1532
338 Ga0501272_012261 3300049769 Bacteria 973
339 Ga0501045_0022481 3300049824 Bacteria 4516
340 nmdc:mga05p37_207208_c1 3300050507 Bacteria 2371
341 nmdc:mga05p37_689854_c1 3300050507 Bacteria 1136
342 nmdc:mga09592_10191_c1 3300050508 Bacteria 7650
343 nmdc:mga0qj67_558581_c1 3300050509 Bacteria 918
344 nmdc:mga06r32_2326_c1 3300050510 Bacteria 17026
345 nmdc:mga08y16_5259_c1 3300050511 Bacteria 13520
346 nmdc:mga08y16_9459_c1 3300050511 Bacteria 10225
347 nmdc:mga0n895_1289_c1 3300050512 Bacteria 18538
348 nmdc:mga0n895_194378_c1 3300050512 Bacteria 2060
349 nmdc:mga0n895_29518_c1 3300050512 Bacteria 5232
350 nmdc:mga0n895_604049_c1 3300050512 Bacteria 1099
351 nmdc:mga0rr50_2930_c1 3300050513 Bacteria 9747
352 nmdc:mga0rr50_96953_c1 3300050513 Bacteria 2308
353 nmdc:mga08x19_104055_c1 3300050514 Bacteria 1886
354 nmdc:mga08x19_263932_c1 3300050514 Bacteria 1191
355 nmdc:mga08x19_8830_c1 3300050514 Bacteria 6012
356 nmdc:mga0a205_124217_c1 3300050515 Bacteria 2481
357 Ga0495601_0011584 3300053077 Bacteria 5284
358 Ga0495619_0054064 3300053085 Bacteria 2657
359 Ga0500641_0002574 3300053096 Bacteria 6412
360 Ga0500616_0001265 3300053153 Bacteria 25253
361 Ga0501084_0040024 3300054114 Bacteria 3920
362 Ga0501082_0031800 3300060353 Bacteria 4551
363 Ga0501082_0268958 3300060353 Bacteria 1483
364 Ga0530510_0001323 3300061734 Bacteria 16562

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046499 Ga0495594_0381702 Ga0495594_0381702_130_789 204
2 3300028800 Ga0265338_10052802 Ga0265338_100528025 205
3 3300025924 Ga0207694_10269687 Ga0207694_102696871 212
4 3300006847 Ga0075431_100211151 Ga0075431_1002111511 224
5 3300025981 Ga0207640_10066114 Ga0207640_100661142 226
6 3300049592 Ga0501076_0402230 Ga0501076_0402230_24_749 227
7 3300053096 Ga0500641_0002574 Ga0500641_0002574_5644_6363 227
8 3300013297 Ga0157378_10125691 Ga0157378_101256912 230
9 3300005441 Ga0070700_100330369 Ga0070700_1003303691 231
10 3300009098 Ga0105245_10219841 Ga0105245_102198412 231
11 3300025932 Ga0207690_10101466 Ga0207690_101014662 231
12 3300050512 nmdc:mga0n895_194378_c1 nmdc:mga0n895_194378_c1_75_863 231
13 3300005356 Ga0070674_100075369 Ga0070674_1000753691 232
14 3300005456 Ga0070678_100061402 Ga0070678_1000614022 232
15 3300005615 Ga0070702_100181231 Ga0070702_1001812311 232
16 3300035692 Ga0373935_0100005 Ga0373935_0100005_26_730 232
17 3300035725 Ga0373947_0510249 Ga0373947_0510249_27_731 232
18 3300049586 Ga0501070_0014518 Ga0501070_0014518_5041_5835 234
19 3300049593 Ga0501077_0015088 Ga0501077_0015088_1305_2099 234
20 3300031733 Ga0316577_10142451 Ga0316577_101424512 235
21 3300045051 Ga0451576_0001510 Ga0451576_0001510_23872_24654 235
22 3300005548 Ga0070665_100100413 Ga0070665_1001004132 237
23 3300046642 Ga0495634_0167027 Ga0495634_0167027_264_1070 240
24 3300042876 Ga0451577_0723981 Ga0451577_0723981_16_747 242
25 3300006173 Ga0070716_100006877 Ga0070716_1000068777 243
26 3300025939 Ga0207665_10008078 Ga0207665_100080782 243
27 3300050514 nmdc:mga08x19_8830_c1 nmdc:mga08x19_8830_c1_2705_3505 243
28 3300006852 Ga0075433_10036152 Ga0075433_100361526 244
29 3300050515 nmdc:mga0a205_124217_c1 nmdc:mga0a205_124217_c1_1460_2266 244
30 3300005536 Ga0070697_100002435 Ga0070697_1000024355 252
31 3300006844 Ga0075428_100298807 Ga0075428_1002988072 252
32 3300009101 Ga0105247_10178313 Ga0105247_101783132 252
33 3300013100 Ga0157373_10428656 Ga0157373_104286562 252
34 3300013297 Ga0157378_10032469 Ga0157378_100324693 252
35 3300045051 Ga0451576_0299661 Ga0451576_0299661_428_1189 252
36 3300047317 Ga0495604_0122858 Ga0495604_0122858_195_953 252
37 3300048915 Ga0496112_0151529 Ga0496112_0151529_1039_1797 252
38 3300048918 Ga0496115_0004216 Ga0496115_0004216_466_1248 252
39 3300053077 Ga0495601_0011584 Ga0495601_0011584_3429_4187 252
40 3300003203 JGI25406J46586_10022636 JGI25406J46586_100226364 253
41 3300003203 JGI25406J46586_10085294 JGI25406J46586_100852942 253
42 3300005289 Ga0065704_10181983 Ga0065704_101819831 253
43 3300005290 Ga0065712_10070856 Ga0065712_100708562 253
44 3300005293 Ga0065715_10102822 Ga0065715_101028223 253
45 3300005334 Ga0068869_100021497 Ga0068869_1000214972 253
46 3300005340 Ga0070689_100309967 Ga0070689_1003099672 253
47 3300005364 Ga0070673_100119298 Ga0070673_1001192983 253
48 3300005458 Ga0070681_10100231 Ga0070681_101002313 253
49 3300005468 Ga0070707_100001757 Ga0070707_10000175712 253
50 3300005549 Ga0070704_100001046 Ga0070704_10000104615 253
51 3300005617 Ga0068859_100522891 Ga0068859_1005228912 253
52 3300005618 Ga0068864_100053286 Ga0068864_1000532862 253
53 3300005618 Ga0068864_100231288 Ga0068864_1002312883 253
54 3300005844 Ga0068862_100280664 Ga0068862_1002806642 253
55 3300005985 Ga0081539_10000022 Ga0081539_1000002269 253
56 3300005985 Ga0081539_10003445 Ga0081539_100034456 253
57 3300006844 Ga0075428_100004509 Ga0075428_1000045097 253
58 3300006847 Ga0075431_100002500 Ga0075431_1000025007 253
59 3300006871 Ga0075434_100056114 Ga0075434_1000561145 253
60 3300006880 Ga0075429_100031615 Ga0075429_1000316152 253
61 3300006880 Ga0075429_100649937 Ga0075429_1006499371 253
62 3300006931 Ga0097620_100522914 Ga0097620_1005229142 253
63 3300009094 Ga0111539_10026836 Ga0111539_100268364 253
64 3300009101 Ga0105247_10060100 Ga0105247_100601003 253
65 3300009147 Ga0114129_10004357 Ga0114129_100043576 253
66 3300009177 Ga0105248_10081558 Ga0105248_100815585 253
67 3300011119 Ga0105246_10429777 Ga0105246_104297772 253
68 3300013306 Ga0163162_10404361 Ga0163162_104043612 253
69 3300021384 Ga0213876_10000236 Ga0213876_1000023618 253
70 3300025908 Ga0207643_10000775 Ga0207643_100007754 253
71 3300025912 Ga0207707_10058670 Ga0207707_100586705 253
72 3300025921 Ga0207652_10180217 Ga0207652_101802171 253
73 3300025922 Ga0207646_10002595 Ga0207646_1000259512 253
74 3300025927 Ga0207687_10284134 Ga0207687_102841341 253
75 3300025941 Ga0207711_10376685 Ga0207711_103766852 253
76 3300025942 Ga0207689_10181514 Ga0207689_101815142 253
77 3300026088 Ga0207641_10066089 Ga0207641_100660893 253
78 3300026095 Ga0207676_10062701 Ga0207676_100627013 253
79 3300026095 Ga0207676_10235281 Ga0207676_102352812 253
80 3300030745 Ga0316182_1370321 Ga0316182_13703211 253
81 3300031548 Ga0307408_100356755 Ga0307408_1003567552 253
82 3300031901 Ga0307406_10272153 Ga0307406_102721532 253
83 3300039437 Ga0436365_0243354 Ga0436365_0243354_809_1570 253
84 3300039437 Ga0436365_0845597 Ga0436365_0845597_33202_33963 253
85 3300049769 Ga0501272_012261 Ga0501272_012261_131_895 253
86 3300050508 nmdc:mga09592_10191_c1 nmdc:mga09592_10191_c1_2801_3586 253
87 3300050509 nmdc:mga0qj67_558581_c1 nmdc:mga0qj67_558581_c1_98_883 253
88 3300050510 nmdc:mga06r32_2326_c1 nmdc:mga06r32_2326_c1_7710_8495 253
89 3300050511 nmdc:mga08y16_5259_c1 nmdc:mga08y16_5259_c1_4343_5128 253
90 3300050512 nmdc:mga0n895_29518_c1 nmdc:mga0n895_29518_c1_2770_3534 253
91 iso_pu_bacteria 2852673933 2852676276 253
92 iso_pu_bacteria 2928510474 2928513667 253
93 3300005337 Ga0070682_100409949 Ga0070682_1004099491 254
94 3300005356 Ga0070674_100342998 Ga0070674_1003429981 254
95 3300005456 Ga0070678_100149456 Ga0070678_1001494562 254
96 3300005458 Ga0070681_10089035 Ga0070681_100890351 254
97 3300005539 Ga0068853_100012582 Ga0068853_1000125825 254
98 3300005564 Ga0070664_100129114 Ga0070664_1001291141 254
99 3300005615 Ga0070702_100001690 Ga0070702_1000016906 254
100 3300005615 Ga0070702_100496744 Ga0070702_1004967441 254
101 3300005842 Ga0068858_100444616 Ga0068858_1004446162 254
102 3300006914 Ga0075436_100047009 Ga0075436_1000470092 254
103 3300009174 Ga0105241_10045985 Ga0105241_100459852 254
104 3300009551 Ga0105238_10279202 Ga0105238_102792022 254
105 3300010375 Ga0105239_10096650 Ga0105239_100966502 254
106 3300013297 Ga0157378_10630051 Ga0157378_106300511 254
107 3300013307 Ga0157372_10323668 Ga0157372_103236682 254
108 3300026035 Ga0207703_10291686 Ga0207703_102916861 254
109 3300026041 Ga0207639_10076360 Ga0207639_100763602 254
110 3300026116 Ga0207674_10026221 Ga0207674_100262214 254
111 3300031731 Ga0307405_10162178 Ga0307405_101621782 254
112 3300032133 Ga0316583_10059993 Ga0316583_100599931 254
113 3300033527 Ga0316586_1036440 Ga0316586_10364401 254
114 3300036647 Ga0316582_0197719 Ga0316582_0197719_325_1125 254
115 3300037853 Ga0436364_0987940 Ga0436364_0987940_1839_2624 254
116 3300042876 Ga0451577_0219277 Ga0451577_0219277_283_1077 254
117 3300046514 Ga0495618_0188227 Ga0495618_0188227_219_1028 254
118 3300046616 Ga0495668_0076407 Ga0495668_0076407_665_1450 254
119 3300046683 Ga0495658_0199069 Ga0495658_0199069_91_900 254
120 3300047319 Ga0495674_0429592 Ga0495674_0429592_222_1031 254
121 3300049741 Ga0501079_0501580 Ga0501079_0501580_30_821 254
122 3300049742 Ga0501080_0063288 Ga0501080_0063288_1232_2023 254
123 3300050514 nmdc:mga08x19_104055_c1 nmdc:mga08x19_104055_c1_415_1269 254
124 3300053153 Ga0500616_0001265 Ga0500616_0001265_12388_13194 254
125 3300005327 Ga0070658_10010246 Ga0070658_100102462 255
126 3300005337 Ga0070682_100086099 Ga0070682_1000860994 255
127 3300005435 Ga0070714_100115215 Ga0070714_1001152153 255
128 3300005436 Ga0070713_100090357 Ga0070713_1000903573 255
129 3300005436 Ga0070713_100277201 Ga0070713_1002772011 255
130 3300005436 Ga0070713_100318266 Ga0070713_1003182663 255
131 3300005437 Ga0070710_10260696 Ga0070710_102606961 255
132 3300005439 Ga0070711_100080444 Ga0070711_1000804443 255
133 3300005441 Ga0070700_100150699 Ga0070700_1001506991 255
134 3300005445 Ga0070708_100007880 Ga0070708_1000078802 255
135 3300005445 Ga0070708_100306751 Ga0070708_1003067512 255
136 3300005458 Ga0070681_10104687 Ga0070681_101046873 255
137 3300005458 Ga0070681_10161921 Ga0070681_101619213 255
138 3300005467 Ga0070706_100192069 Ga0070706_1001920691 255
139 3300005518 Ga0070699_100072443 Ga0070699_1000724432 255
140 3300005530 Ga0070679_100070982 Ga0070679_1000709821 255
141 3300005539 Ga0068853_100049013 Ga0068853_1000490134 255
142 3300005546 Ga0070696_100116803 Ga0070696_1001168032 255
143 3300005547 Ga0070693_100017809 Ga0070693_1000178094 255
144 3300005547 Ga0070693_100063722 Ga0070693_1000637222 255
145 3300005563 Ga0068855_100454938 Ga0068855_1004549382 255
146 3300005578 Ga0068854_100055893 Ga0068854_1000558933 255
147 3300005614 Ga0068856_100133551 Ga0068856_1001335512 255
148 3300005614 Ga0068856_100479545 Ga0068856_1004795452 255
149 3300005616 Ga0068852_100137824 Ga0068852_1001378242 255
150 3300005616 Ga0068852_100212617 Ga0068852_1002126173 255
151 3300005834 Ga0068851_10030963 Ga0068851_100309633 255
152 3300005985 Ga0081539_10142771 Ga0081539_101427713 255
153 3300006173 Ga0070716_100366989 Ga0070716_1003669892 255
154 3300006175 Ga0070712_100002791 Ga0070712_1000027918 255
155 3300006175 Ga0070712_100309846 Ga0070712_1003098461 255
156 3300007076 Ga0075435_100017301 Ga0075435_1000173013 255
157 3300009093 Ga0105240_10084439 Ga0105240_100844394 255
158 3300009093 Ga0105240_10721415 Ga0105240_107214151 255
159 3300009098 Ga0105245_10030198 Ga0105245_100301983 255
160 3300009098 Ga0105245_10126013 Ga0105245_101260133 255
161 3300009147 Ga0114129_10251636 Ga0114129_102516362 255
162 3300009176 Ga0105242_10128463 Ga0105242_101284633 255
163 3300009545 Ga0105237_10167947 Ga0105237_101679472 255
164 3300009551 Ga0105238_10155903 Ga0105238_101559032 255
165 3300009551 Ga0105238_10820864 Ga0105238_108208641 255
166 3300013104 Ga0157370_10019660 Ga0157370_100196603 255
167 3300013105 Ga0157369_10000234 Ga0157369_1000023431 255
168 3300013105 Ga0157369_10205203 Ga0157369_102052033 255
169 3300013105 Ga0157369_10209954 Ga0157369_102099543 255
170 3300013296 Ga0157374_10300742 Ga0157374_103007423 255
171 3300021358 Ga0213873_10001976 Ga0213873_100019763 255
172 3300021361 Ga0213872_10007301 Ga0213872_100073016 255
173 3300025321 Ga0207656_10008745 Ga0207656_100087453 255
174 3300025910 Ga0207684_10006193 Ga0207684_100061939 255
175 3300025910 Ga0207684_10136119 Ga0207684_101361192 255
176 3300025912 Ga0207707_10014874 Ga0207707_100148745 255
177 3300025912 Ga0207707_10217742 Ga0207707_102177422 255
178 3300025912 Ga0207707_10547544 Ga0207707_105475442 255
179 3300025913 Ga0207695_10125931 Ga0207695_101259313 255
180 3300025914 Ga0207671_10221614 Ga0207671_102216142 255
181 3300025915 Ga0207693_10012921 Ga0207693_100129215 255
182 3300025915 Ga0207693_10083895 Ga0207693_100838952 255
183 3300025916 Ga0207663_10273608 Ga0207663_102736082 255
184 3300025917 Ga0207660_10250935 Ga0207660_102509351 255
185 3300025921 Ga0207652_10011269 Ga0207652_100112692 255
186 3300025921 Ga0207652_10085531 Ga0207652_100855313 255
187 3300025927 Ga0207687_10000669 Ga0207687_100006699 255
188 3300025928 Ga0207700_10017148 Ga0207700_100171483 255
189 3300025928 Ga0207700_10315088 Ga0207700_103150882 255
190 3300025928 Ga0207700_10350663 Ga0207700_103506632 255
191 3300025928 Ga0207700_10413125 Ga0207700_104131251 255
192 3300025944 Ga0207661_10025691 Ga0207661_100256914 255
193 3300025944 Ga0207661_10148341 Ga0207661_101483413 255
194 3300025949 Ga0207667_10366718 Ga0207667_103667182 255
195 3300025981 Ga0207640_10106933 Ga0207640_101069333 255
196 3300026023 Ga0207677_10498810 Ga0207677_104988101 255
197 3300026041 Ga0207639_10054798 Ga0207639_100547983 255
198 3300026078 Ga0207702_10099029 Ga0207702_100990292 255
199 3300026078 Ga0207702_10116503 Ga0207702_101165033 255
200 3300026116 Ga0207674_10240678 Ga0207674_102406781 255
201 3300027512 Ga0209179_1052051 Ga0209179_10520511 255
202 3300028556 Ga0265337_1003556 Ga0265337_10035564 255
203 3300028563 Ga0265319_1000684 Ga0265319_10006846 255
204 3300028577 Ga0265318_10001920 Ga0265318_100019204 255
205 3300028666 Ga0265336_10013829 Ga0265336_100138292 255
206 3300028666 Ga0265336_10026270 Ga0265336_100262701 255
207 3300028800 Ga0265338_10006778 Ga0265338_100067789 255
208 3300031240 Ga0265320_10064744 Ga0265320_100647442 255
209 3300031711 Ga0265314_10113999 Ga0265314_101139993 255
210 3300035083 Ga0373926_0008168 Ga0373926_0008168_172_939 255
211 3300035113 Ga0373936_0142826 Ga0373936_0142826_102_869 255
212 3300035114 Ga0373939_0069602 Ga0373939_0069602_65_874 255
213 3300035116 Ga0373945_0005328 Ga0373945_0005328_3102_3869 255
214 3300035170 Ga0373943_0106799 Ga0373943_0106799_266_1033 255
215 3300035171 Ga0373946_0027732 Ga0373946_0027732_460_1227 255
216 3300035171 Ga0373946_0171916 Ga0373946_0171916_64_831 255
217 3300035207 Ga0373942_0035742 Ga0373942_0035742_417_1226 255
218 3300035410 Ga0373924_0123974 Ga0373924_0123974_297_1064 255
219 3300035691 Ga0373931_0021802 Ga0373931_0021802_1705_2514 255
220 3300035692 Ga0373935_0001266 Ga0373935_0001266_10201_10968 255
221 3300035692 Ga0373935_0139068 Ga0373935_0139068_639_1406 255
222 3300035692 Ga0373935_0413383 Ga0373935_0413383_20_787 255
223 3300035695 Ga0373927_0007668 Ga0373927_0007668_2505_3272 255
224 3300035725 Ga0373947_0010972 Ga0373947_0010972_61_828 255
225 3300035725 Ga0373947_0023027 Ga0373947_0023027_1163_1930 255
226 3300036401 Ga0373937_0000094 Ga0373937_0000094_44385_45152 255
227 3300037068 Ga0373925_0015061 Ga0373925_0015061_4774_5541 255
228 3300037068 Ga0373925_0054982 Ga0373925_0054982_1751_2518 255
229 3300037068 Ga0373925_0152148 Ga0373925_0152148_460_1227 255
230 3300037466 Ga0395898_0172052 Ga0395898_0172052_687_1454 255
231 3300037853 Ga0436364_1440387 Ga0436364_1440387_45_815 255
232 3300039438 Ga0436360_1000797 Ga0436360_1000797_341_1108 255
233 3300039447 Ga0436361_0248901 Ga0436361_0248901_9453_10223 255
234 3300039453 Ga0436362_0899955 Ga0436362_0899955_2994_3761 255
235 3300042876 Ga0451577_0132692 Ga0451577_0132692_107_874 255
236 3300042876 Ga0451577_0587780 Ga0451577_0587780_12_782 255
237 3300044673 Ga0453683_0096027 Ga0453683_0096027_418_1188 255
238 3300044842 Ga0466957_0001046 Ga0466957_0001046_7735_8502 255
239 3300045051 Ga0451576_0033283 Ga0451576_0033283_1320_2090 255
240 3300045976 Ga0466967_0012628 Ga0466967_0012628_2724_3491 255
241 3300045976 Ga0466967_0056731 Ga0466967_0056731_178_945 255
242 3300046472 Ga0495580_0028230 Ga0495580_0028230_2564_3331 255
243 3300046475 Ga0495639_0079390 Ga0495639_0079390_171_938 255
244 3300046475 Ga0495639_0163825 Ga0495639_0163825_195_962 255
245 3300046511 Ga0495608_0238895 Ga0495608_0238895_343_1110 255
246 3300046517 Ga0495630_0111500 Ga0495630_0111500_1038_1805 255
247 3300046531 Ga0495665_0068576 Ga0495665_0068576_333_1100 255
248 3300046559 Ga0495667_0267587 Ga0495667_0267587_153_920 255
249 3300046663 Ga0495635_0133808 Ga0495635_0133808_336_1103 255
250 3300046683 Ga0495658_0373824 Ga0495658_0373824_90_857 255
251 3300046684 Ga0495669_0017093 Ga0495669_0017093_1995_2762 255
252 3300046684 Ga0495669_0116346 Ga0495669_0116346_154_921 255
253 3300047315 Ga0495581_0084186 Ga0495581_0084186_811_1578 255
254 3300048907 Ga0496104_0226365 Ga0496104_0226365_719_1486 255
255 3300048907 Ga0496104_0425957 Ga0496104_0425957_453_1220 255
256 3300048908 Ga0496105_0000394 Ga0496105_0000394_15075_15842 255
257 3300048908 Ga0496105_0467993 Ga0496105_0467993_100_867 255
258 3300048914 Ga0496111_0097364 Ga0496111_0097364_368_1135 255
259 3300048915 Ga0496112_0023825 Ga0496112_0023825_134_901 255
260 3300048915 Ga0496112_0517821 Ga0496112_0517821_135_902 255
261 3300048916 Ga0496113_0258014 Ga0496113_0258014_603_1370 255
262 3300048929 Ga0496126_0005616 Ga0496126_0005616_1381_2175 255
263 3300050507 nmdc:mga05p37_207208_c1 nmdc:mga05p37_207208_c1_739_1542 255
264 3300050507 nmdc:mga05p37_689854_c1 nmdc:mga05p37_689854_c1_274_1047 255
265 3300001977 JGI24746J21847_1004044 JGI24746J21847_10040443 256
266 3300005290 Ga0065712_10101048 Ga0065712_101010481 256
267 3300005290 Ga0065712_10106652 Ga0065712_101066522 256
268 3300005434 Ga0070709_10058471 Ga0070709_100584712 256
269 3300005434 Ga0070709_10231927 Ga0070709_102319271 256
270 3300005434 Ga0070709_10347116 Ga0070709_103471162 256
271 3300005435 Ga0070714_100104370 Ga0070714_1001043702 256
272 3300005436 Ga0070713_100006273 Ga0070713_1000062736 256
273 3300005436 Ga0070713_100034930 Ga0070713_1000349305 256
274 3300005439 Ga0070711_100247111 Ga0070711_1002471111 256
275 3300005445 Ga0070708_100002287 Ga0070708_1000022879 256
276 3300005445 Ga0070708_100127118 Ga0070708_1001271182 256
277 3300005458 Ga0070681_10071772 Ga0070681_100717722 256
278 3300005518 Ga0070699_100440947 Ga0070699_1004409471 256
279 3300005536 Ga0070697_100000097 Ga0070697_10000009751 256
280 3300006028 Ga0070717_10001725 Ga0070717_1000172514 256
281 3300006028 Ga0070717_10010972 Ga0070717_100109723 256
282 3300006028 Ga0070717_10108564 Ga0070717_101085643 256
283 3300006028 Ga0070717_10407952 Ga0070717_104079522 256
284 3300006237 Ga0097621_100144218 Ga0097621_1001442183 256
285 3300006871 Ga0075434_100010745 Ga0075434_1000107455 256
286 3300006914 Ga0075436_100209707 Ga0075436_1002097071 256
287 3300007076 Ga0075435_100008893 Ga0075435_1000088936 256
288 3300007076 Ga0075435_100121391 Ga0075435_1001213913 256
289 3300007265 Ga0099794_10081353 Ga0099794_100813532 256
290 3300009094 Ga0111539_10006615 Ga0111539_100066159 256
291 3300009094 Ga0111539_10021014 Ga0111539_100210142 256
292 3300009174 Ga0105241_10129496 Ga0105241_101294964 256
293 3300010375 Ga0105239_10877486 Ga0105239_108774861 256
294 3300013102 Ga0157371_10114538 Ga0157371_101145381 256
295 3300014325 Ga0163163_10194067 Ga0163163_101940672 256
296 3300014326 Ga0157380_10003003 Ga0157380_100030032 256
297 3300021388 Ga0213875_10019242 Ga0213875_100192422 256
298 3300024225 Ga0224572_1001070 Ga0224572_10010703 256
299 3300025906 Ga0207699_10021948 Ga0207699_100219484 256
300 3300025910 Ga0207684_10163797 Ga0207684_101637972 256
301 3300025922 Ga0207646_10105971 Ga0207646_101059712 256
302 3300025928 Ga0207700_10053819 Ga0207700_100538191 256
303 3300025928 Ga0207700_10226252 Ga0207700_102262522 256
304 3300025929 Ga0207664_10125913 Ga0207664_101259134 256
305 3300025939 Ga0207665_10035302 Ga0207665_100353022 256
306 3300025949 Ga0207667_10468890 Ga0207667_104688901 256
307 3300026078 Ga0207702_10154578 Ga0207702_101545782 256
308 3300031249 Ga0265339_10057999 Ga0265339_100579992 256
309 3300031344 Ga0265316_10044887 Ga0265316_100448873 256
310 3300031711 Ga0265314_10034397 Ga0265314_100343973 256
311 3300035083 Ga0373926_0012319 Ga0373926_0012319_1219_1995 256
312 3300035170 Ga0373943_0123537 Ga0373943_0123537_228_1088 256
313 3300035170 Ga0373943_0132831 Ga0373943_0132831_282_1058 256
314 3300035170 Ga0373943_0189154 Ga0373943_0189154_20_790 256
315 3300035695 Ga0373927_0008982 Ga0373927_0008982_3051_3911 256
316 3300035695 Ga0373927_0033421 Ga0373927_0033421_158_934 256
317 3300035695 Ga0373927_0046600 Ga0373927_0046600_74_844 256
318 3300035725 Ga0373947_0016967 Ga0373947_0016967_687_1463 256
319 3300035725 Ga0373947_0155223 Ga0373947_0155223_98_895 256
320 3300036401 Ga0373937_0035702 Ga0373937_0035702_1046_1816 256
321 3300036401 Ga0373937_0370587 Ga0373937_0370587_418_1188 256
322 3300037068 Ga0373925_0003934 Ga0373925_0003934_1709_2479 256
323 3300037068 Ga0373925_0067100 Ga0373925_0067100_374_1150 256
324 3300037068 Ga0373925_0377848 Ga0373925_0377848_236_1012 256
325 3300045051 Ga0451576_0007066 Ga0451576_0007066_6084_6866 256
326 3300045051 Ga0451576_0071201 Ga0451576_0071201_269_1051 256
327 3300046472 Ga0495580_0000223 Ga0495580_0000223_26169_26939 256
328 3300046472 Ga0495580_0009330 Ga0495580_0009330_3238_4008 256
329 3300046472 Ga0495580_0049621 Ga0495580_0049621_916_1692 256
330 3300046472 Ga0495580_0066804 Ga0495580_0066804_671_1441 256
331 3300046472 Ga0495580_0072561 Ga0495580_0072561_1331_2101 256
332 3300046472 Ga0495580_0081094 Ga0495580_0081094_135_905 256
333 3300046472 Ga0495580_0148792 Ga0495580_0148792_496_1266 256
334 3300046473 Ga0495582_0005902 Ga0495582_0005902_5247_6023 256
335 3300046473 Ga0495582_0067569 Ga0495582_0067569_181_951 256
336 3300046517 Ga0495630_0167141 Ga0495630_0167141_195_971 256
337 3300046531 Ga0495665_0002199 Ga0495665_0002199_678_1454 256
338 3300046531 Ga0495665_0025596 Ga0495665_0025596_993_1763 256
339 3300046559 Ga0495667_0132993 Ga0495667_0132993_780_1550 256
340 3300047315 Ga0495581_0005004 Ga0495581_0005004_4931_5701 256
341 3300047315 Ga0495581_0017273 Ga0495581_0017273_2110_2886 256
342 3300047319 Ga0495674_0325282 Ga0495674_0325282_72_842 256
343 3300048089 Ga0495614_0127699 Ga0495614_0127699_324_1094 256
344 3300049575 Ga0501039_0044217 Ga0501039_0044217_306_1097 256
345 3300049577 Ga0501041_0007003 Ga0501041_0007003_1331_2122 256
346 3300049584 Ga0501068_0203263 Ga0501068_0203263_444_1235 256
347 3300049588 Ga0501072_0305742 Ga0501072_0305742_404_1195 256
348 3300049591 Ga0501075_0040134 Ga0501075_0040134_458_1249 256
349 3300049592 Ga0501076_0003483 Ga0501076_0003483_3696_4487 256
350 3300049593 Ga0501077_0005232 Ga0501077_0005232_6649_7440 256
351 3300049741 Ga0501079_0021753 Ga0501079_0021753_2972_3763 256
352 3300049742 Ga0501080_0105322 Ga0501080_0105322_70_861 256
353 3300049743 Ga0501081_0003140 Ga0501081_0003140_6337_7128 256
354 3300049744 Ga0501083_0149005 Ga0501083_0149005_523_1293 256
355 3300049824 Ga0501045_0022481 Ga0501045_0022481_997_1788 256
356 3300050511 nmdc:mga08y16_9459_c1 nmdc:mga08y16_9459_c1_7769_8590 256
357 3300050512 nmdc:mga0n895_1289_c1 nmdc:mga0n895_1289_c1_6338_7108 256
358 3300050512 nmdc:mga0n895_604049_c1 nmdc:mga0n895_604049_c1_82_858 256
359 3300050513 nmdc:mga0rr50_2930_c1 nmdc:mga0rr50_2930_c1_8268_9038 256
360 3300050513 nmdc:mga0rr50_96953_c1 nmdc:mga0rr50_96953_c1_537_1313 256
361 3300050514 nmdc:mga08x19_263932_c1 nmdc:mga08x19_263932_c1_363_1133 256
362 3300053085 Ga0495619_0054064 Ga0495619_0054064_1706_2476 256
363 3300054114 Ga0501084_0040024 Ga0501084_0040024_849_1640 256
364 3300060353 Ga0501082_0031800 Ga0501082_0031800_1655_2446 256
365 3300060353 Ga0501082_0268958 Ga0501082_0268958_610_1401 256
366 3300061734 Ga0530510_0001323 Ga0530510_0001323_9357_10148 256

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

42

282

0.99

PF00106

adh_short

short chain dehydrogenase

36

231

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2yw9-assembly1.cif.gz_D crystal structure of tt0143 from thermus thermophilus hb8 0.985 4 255
2yw9-assembly2.cif.gz_F crystal structure of tt0143 from thermus thermophilus hb8 0.9834 4 256
4fs3-assembly1.cif.gz_A crystal structure of staphylococcus aureus enoyl-acp reductase in complex with nadp and afn-1252 0.9827 3 254
2yw9-assembly1.cif.gz_A crystal structure of tt0143 from thermus thermophilus hb8 0.9825 4 255
2yw9-assembly2.cif.gz_E crystal structure of tt0143 from thermus thermophilus hb8 0.9812 4 256
ID Description Score Start End Superfamily
3grkC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9803 5 256 3.40.50.720
4cv1H00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.98 1 254 3.40.50.720
af_P0AEK4_1_262_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9781 5 256 3.40.50.720
2wyuB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9761 1 256 3.40.50.720
af_Q2FZQ3_8_202_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9727 10 201 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7X3FH95-F1-model_v4 Enoyl-[acyl-carrier-protein] reductase [NADH] (EC 1.3.1.9) 0.9929 5 256 GO:0004318
GO:0006633
AF-A0A2V9QV27-F1-model_v4 NADH-specific enoyl-ACP reductase 0.9923 65 256 GO:0004318
GO:0006633
AF-A0A261DBJ9-F1-model_v4 Enoyl-[acyl-carrier-protein] reductase [NADH] (EC 1.3.1.9) 0.9914 5 254 GO:0004318
GO:0006633
AF-A0A3N5P5F4-F1-model_v4 Enoyl-[acyl-carrier-protein] reductase [NADH] (EC 1.3.1.9) 0.9912 4 256 GO:0004318
GO:0006633
AF-A0A3B0U629-F1-model_v4 Enoyl-[acyl-carrier-protein] reductase [NADH] (EC 1.3.1.9) 0.99 64 256 GO:0004318
GO:0006633

Feature Viewer

pLDDT pTM Quality
93.35 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map