F423910

General Info

Members Datasets Scaffolds Average Seq Length
366 194 732 140

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100664871|Ga0070670_1006648712
Length 146
Sequence MSGFPLVYPMFAMVLLTFAVAVVLFRARIRAVREGHTAVSYFRTFAGSPPEQEFLAKPTRHFANLFEVPTLFYAGCLAAMVVGATGPTGLVLAWGYVAARLAHAWVHLGGNRVRHRFRIYLASWIFLLALWFYVCSAVALKSGSPV

Samples

Sample ID Description Type Environment
1 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
127 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
128 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
129 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
130 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
131 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
132 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
133 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
134 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
135 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
136 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
137 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
138 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
139 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
140 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
141 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
142 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
143 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
144 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
145 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
146 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
147 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
148 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
149 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
152 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
153 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
154 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
155 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
156 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
157 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
158 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
159 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
160 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
161 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
162 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
163 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
164 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
165 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
166 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
167 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
168 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
169 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
170 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
171 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
172 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
173 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
174 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
175 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
176 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
177 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
183 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
184 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
185 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
186 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
187 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
188 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
189 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
190 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
191 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
192 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
193 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
194 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.27
Nodule 0
Rhizoplane 2.73
Rhizosphere 94.54
Stem 0
Stem Tuber 0
Unclassified 40.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070670_100664871 3300005331 Bacteria 935
2 MBSR1b_contig_3191732 2162886012 Bacteria 1443
3 rootH2_10260939 3300003320 Bacteria 2148
4 rootH1_10007976 3300003323 Bacteria 4896
5 rootH1_10318078 3300003323 Unclassified 1371
6 Ga0065715_10260889 3300005293 Bacteria 1125
7 Ga0070676_10064025 3300005328 Unclassified 2191
8 Ga0070683_100504989 3300005329 Bacteria 1155
9 Ga0070690_100003398 3300005330 Bacteria 8698
10 Ga0070670_100193769 3300005331 Bacteria 1765
11 Ga0070670_100586330 3300005331 Unclassified 997
12 Ga0070677_10004550 3300005333 Bacteria 4529
13 Ga0068869_100080298 3300005334 Bacteria 2433
14 Ga0068869_100476935 3300005334 Bacteria 1038
15 Ga0068869_100837660 3300005334 Unclassified 793
16 Ga0068869_101494552 3300005334 Unclassified 600
17 Ga0070666_10334262 3300005335 Bacteria 1082
18 Ga0070682_100209087 3300005337 Bacteria 1382
19 Ga0070689_100102468 3300005340 Bacteria 2267
20 Ga0070689_100450429 3300005340 Bacteria 1095
21 Ga0070689_100738506 3300005340 Unclassified 862
22 Ga0070689_100978903 3300005340 Unclassified 752
23 Ga0070691_10242720 3300005341 Bacteria 963
24 Ga0070691_11104469 3300005341 Unclassified 500
25 Ga0070687_100102080 3300005343 Bacteria 1608
26 Ga0070687_100241467 3300005343 Bacteria 1117
27 Ga0070692_10136858 3300005345 Bacteria 1382
28 Ga0070692_10190302 3300005345 Unclassified 1195
29 Ga0070668_100156488 3300005347 Unclassified 1847
30 Ga0070668_100340487 3300005347 Unclassified 1267
31 Ga0070669_100043326 3300005353 Bacteria 3277
32 Ga0070669_100051028 3300005353 Unclassified 3022
33 Ga0070669_100066107 3300005353 Bacteria 2664
34 Ga0070669_100511598 3300005353 Bacteria 997
35 Ga0070675_100027599 3300005354 Bacteria 4562
36 Ga0070675_100304705 3300005354 Bacteria 1404
37 Ga0070675_100318052 3300005354 Bacteria 1375
38 Ga0070675_100321272 3300005354 Bacteria 1367
39 Ga0070674_100007354 3300005356 Bacteria 6494
40 Ga0070674_100051199 3300005356 Bacteria 2845
41 Ga0070674_100058421 3300005356 Bacteria 2681
42 Ga0070674_100156395 3300005356 Unclassified 1725
43 Ga0070674_100404198 3300005356 Unclassified 1117
44 Ga0070674_100838923 3300005356 Bacteria 796
45 Ga0070673_100021471 3300005364 Bacteria 4682
46 Ga0070673_100328353 3300005364 Bacteria 1353
47 Ga0070673_100775538 3300005364 Bacteria 884
48 Ga0070673_101071609 3300005364 Bacteria 752
49 Ga0070688_100022604 3300005365 Bacteria 3688
50 Ga0070688_100232220 3300005365 Bacteria 1305
51 Ga0070659_100365593 3300005366 Bacteria 1213
52 Ga0070659_100446450 3300005366 Bacteria 1096
53 Ga0070659_100959873 3300005366 Archaea 749
54 Ga0070667_100074982 3300005367 Unclassified 2887
55 Ga0070667_100442050 3300005367 Unclassified 1187
56 Ga0070701_10139380 3300005438 Bacteria 1385
57 Ga0070701_10264156 3300005438 Bacteria 1044
58 Ga0070701_10286565 3300005438 Bacteria 1007
59 Ga0070705_100004417 3300005440 Bacteria 6851
60 Ga0070700_100053765 3300005441 Unclassified 2514
61 Ga0070700_100056587 3300005441 Bacteria 2459
62 Ga0070700_100166711 3300005441 Unclassified 1522
63 Ga0070700_100167442 3300005441 Bacteria 1519
64 Ga0070700_100366640 3300005441 Unclassified 1073
65 Ga0070700_100835774 3300005441 Unclassified 745
66 Ga0070700_100849281 3300005441 Bacteria 739
67 Ga0070700_101018112 3300005441 Unclassified 682
68 Ga0070694_100103942 3300005444 Bacteria 2013
69 Ga0070694_101085046 3300005444 Unclassified 667
70 Ga0070663_100063884 3300005455 Bacteria 2659
71 Ga0070663_101119263 3300005455 Bacteria 689
72 Ga0070678_100049280 3300005456 Unclassified 3038
73 Ga0070662_100222098 3300005457 Archaea 1508
74 Ga0070662_100480001 3300005457 Unclassified 1035
75 Ga0068867_100054711 3300005459 Bacteria 2948
76 Ga0068867_100728657 3300005459 Unclassified 878
77 Ga0068867_100842442 3300005459 Unclassified 821
78 Ga0070685_10104613 3300005466 Unclassified 1733
79 Ga0070685_10169022 3300005466 Unclassified 1400
80 Ga0070685_10456810 3300005466 Unclassified 896
81 Ga0070672_100002342 3300005543 Bacteria 11979
82 Ga0070672_100098917 3300005543 Unclassified 2363
83 Ga0070672_100131239 3300005543 Bacteria 2059
84 Ga0070672_100135583 3300005543 Bacteria 2027
85 Ga0070672_101184045 3300005543 Unclassified 680
86 Ga0070686_100065439 3300005544 Bacteria 2361
87 Ga0070686_100294505 3300005544 Unclassified 1201
88 Ga0070686_100303697 3300005544 Bacteria 1184
89 Ga0070693_101014309 3300005547 Bacteria 629
90 Ga0070665_100004383 3300005548 Bacteria 14840
91 Ga0070665_100223611 3300005548 Bacteria 1883
92 Ga0070665_101568820 3300005548 Bacteria 666
93 Ga0070704_100057826 3300005549 Bacteria 2760
94 Ga0070664_100017417 3300005564 Bacteria 5899
95 Ga0070664_100479330 3300005564 Bacteria 1145
96 Ga0068857_100313458 3300005577 Bacteria 1448
97 Ga0068854_100741455 3300005578 Unclassified 851
98 Ga0070702_100389465 3300005615 Bacteria 993
99 Ga0070702_101406818 3300005615 Unclassified 570
100 Ga0068852_101075568 3300005616 Unclassified 824
101 Ga0068859_100271542 3300005617 Bacteria 1788
102 Ga0068859_100532174 3300005617 Bacteria 1270
103 Ga0068864_100042130 3300005618 Unclassified 3906
104 Ga0068864_100179059 3300005618 Bacteria 1937
105 Ga0068866_10502149 3300005718 Unclassified 803
106 Ga0068866_10664695 3300005718 Unclassified 711
107 Ga0068861_100015764 3300005719 Bacteria 5335
108 Ga0068861_100016981 3300005719 Bacteria 5161
109 Ga0068861_100088277 3300005719 Unclassified 2441
110 Ga0068861_100114820 3300005719 Bacteria 2163
111 Ga0068861_100197723 3300005719 Bacteria 1685
112 Ga0068861_100487642 3300005719 Unclassified 1112
113 Ga0068870_10011744 3300005840 Unclassified 4072
114 Ga0068870_10459484 3300005840 Unclassified 841
115 Ga0068870_10496186 3300005840 Bacteria 813
116 Ga0068863_100035927 3300005841 Unclassified 4719
117 Ga0068863_100151879 3300005841 Bacteria 2216
118 Ga0068863_100672922 3300005841 Bacteria 1027
119 Ga0068858_101409137 3300005842 Bacteria 687
120 Ga0068860_100152119 3300005843 Bacteria 2228
121 Ga0068860_101573651 3300005843 Bacteria 679
122 Ga0068862_100061902 3300005844 Bacteria 3217
123 Ga0068862_100081761 3300005844 Bacteria 2803
124 Ga0068862_100246261 3300005844 Unclassified 1627
125 Ga0070715_10282909 3300006163 Bacteria 880
126 Ga0097621_100032863 3300006237 Bacteria 4127
127 Ga0097621_100262153 3300006237 Bacteria 1516
128 Ga0097621_100420126 3300006237 Unclassified 1200
129 Ga0068871_100146889 3300006358 Bacteria 2008
130 Ga0068871_100421100 3300006358 Bacteria 1192
131 Ga0075428_100040279 3300006844 Bacteria 5141
132 Ga0075428_100102084 3300006844 Unclassified 3127
133 Ga0075428_100277435 3300006844 Unclassified 1803
134 Ga0075431_100215164 3300006847 Unclassified 1961
135 Ga0075431_100255300 3300006847 Unclassified 1780
136 Ga0075431_100902026 3300006847 Unclassified 853
137 Ga0075429_100031822 3300006880 Unclassified 4585
138 Ga0068865_100009054 3300006881 Bacteria 6158
139 Ga0068865_100287575 3300006881 Unclassified 1311
140 Ga0068865_100301547 3300006881 Unclassified 1282
141 Ga0097620_100271557 3300006931 Bacteria 1788
142 Ga0097620_100532172 3300006931 Bacteria 1270
143 Ga0111539_10299937 3300009094 Unclassified 1870
144 Ga0111539_11925350 3300009094 Unclassified 686
145 Ga0114129_10386468 3300009147 Unclassified 1847
146 Ga0105243_10059070 3300009148 Unclassified 3059
147 Ga0105243_12683448 3300009148 Unclassified 538
148 Ga0105242_10800126 3300009176 Unclassified 933
149 Ga0105248_10063894 3300009177 Bacteria 4132
150 Ga0105248_10811105 3300009177 Unclassified 1056
151 Ga0105248_12076349 3300009177 Unclassified 646
152 Ga0105249_10049645 3300009553 Unclassified 3826
153 Ga0105249_10706950 3300009553 Unclassified 1068
154 Ga0105249_10839871 3300009553 Unclassified 984
155 Ga0105249_11196566 3300009553 Bacteria 831
156 Ga0105249_11210251 3300009553 Archaea 826
157 Ga0157374_10039597 3300013296 Bacteria 4338
158 Ga0157378_10395581 3300013297 Bacteria 1360
159 Ga0157378_11401265 3300013297 Unclassified 742
160 Ga0163162_10545588 3300013306 Bacteria 1288
161 Ga0163162_10615925 3300013306 Bacteria 1211
162 Ga0157375_10051495 3300013308 Unclassified 4044
163 Ga0157375_10066106 3300013308 Bacteria 3607
164 Ga0157375_10454363 3300013308 Unclassified 1447
165 Ga0157375_11169117 3300013308 Unclassified 902
166 Ga0163163_10063622 3300014325 Bacteria 3659
167 Ga0163163_11085159 3300014325 Unclassified 863
168 Ga0163163_11709983 3300014325 Bacteria 690
169 Ga0157380_10041405 3300014326 Bacteria 3595
170 Ga0157380_10076247 3300014326 Unclassified 2728
171 Ga0157380_10086158 3300014326 Bacteria 2580
172 Ga0157380_10318783 3300014326 Bacteria 1440
173 Ga0157379_12282990 3300014968 Unclassified 539
174 Ga0157376_10176933 3300014969 Unclassified 1947
175 Ga0163161_10197706 3300017792 Unclassified 1548
176 Ga0163161_10231125 3300017792 Unclassified 1435
177 Ga0207688_10338760 3300025901 Bacteria 925
178 Ga0207680_10841026 3300025903 Bacteria 658
179 Ga0207645_10023844 3300025907 Bacteria 3972
180 Ga0207645_10212610 3300025907 Bacteria 1274
181 Ga0207643_10007178 3300025908 Bacteria 5980
182 Ga0207643_10103017 3300025908 Bacteria 1675
183 Ga0207660_10121083 3300025917 Unclassified 1982
184 Ga0207662_10121861 3300025918 Bacteria 1636
185 Ga0207662_10315456 3300025918 Bacteria 1043
186 Ga0207649_10682716 3300025920 Unclassified 795
187 Ga0207681_10038105 3300025923 Bacteria 3182
188 Ga0207681_10056149 3300025923 Bacteria 2685
189 Ga0207681_10080021 3300025923 Unclassified 2304
190 Ga0207650_10163397 3300025925 Bacteria 1765
191 Ga0207650_10173063 3300025925 Bacteria 1717
192 Ga0207659_10006067 3300025926 Bacteria 7376
193 Ga0207659_10047369 3300025926 Bacteria 3040
194 Ga0207659_10061368 3300025926 Bacteria 2710
195 Ga0207687_11283243 3300025927 Unclassified 629
196 Ga0207700_10836480 3300025928 Bacteria 823
197 Ga0207644_10669627 3300025931 Bacteria 864
198 Ga0207706_10264843 3300025933 Unclassified 1500
199 Ga0207706_10424695 3300025933 Bacteria 1151
200 Ga0207686_10367106 3300025934 Bacteria 1088
201 Ga0207670_10215087 3300025936 Bacteria 1468
202 Ga0207670_11618222 3300025936 Unclassified 551
203 Ga0207669_10001903 3300025937 Bacteria 8852
204 Ga0207669_10040514 3300025937 Bacteria 2703
205 Ga0207669_10079968 3300025937 Unclassified 2089
206 Ga0207669_10129581 3300025937 Bacteria 1730
207 Ga0207669_10765974 3300025937 Bacteria 798
208 Ga0207704_10180931 3300025938 Unclassified 1523
209 Ga0207704_10858663 3300025938 Bacteria 761
210 Ga0207691_10005736 3300025940 Bacteria 12009
211 Ga0207691_10011392 3300025940 Bacteria 8535
212 Ga0207691_10022602 3300025940 Bacteria 5930
213 Ga0207691_10047384 3300025940 Unclassified 3944
214 Ga0207691_10118420 3300025940 Bacteria 2349
215 Ga0207711_10040309 3300025941 Bacteria 3973
216 Ga0207711_10327905 3300025941 Bacteria 1415
217 Ga0207711_11126566 3300025941 Unclassified 726
218 Ga0207689_10342945 3300025942 Unclassified 1241
219 Ga0207689_10416383 3300025942 Bacteria 1121
220 Ga0207689_10432030 3300025942 Bacteria 1099
221 Ga0207689_10482180 3300025942 Bacteria 1038
222 Ga0207689_10709700 3300025942 Bacteria 848
223 Ga0207679_10057847 3300025945 Bacteria 2870
224 Ga0207651_10050412 3300025960 Bacteria 2826
225 Ga0207651_10059311 3300025960 Bacteria 2650
226 Ga0207651_11046861 3300025960 Bacteria 730
227 Ga0207712_10358812 3300025961 Unclassified 1214
228 Ga0207712_10547587 3300025961 Bacteria 995
229 Ga0207668_10276957 3300025972 Unclassified 1374
230 Ga0207668_10834857 3300025972 Unclassified 817
231 Ga0207640_10641235 3300025981 Unclassified 904
232 Ga0207658_10219362 3300025986 Bacteria 1599
233 Ga0207658_10351723 3300025986 Bacteria 1283
234 Ga0207658_11682200 3300025986 Bacteria 580
235 Ga0207678_10975816 3300026067 Unclassified 750
236 Ga0207708_10050820 3300026075 Bacteria 3156
237 Ga0207708_10053523 3300026075 Unclassified 3075
238 Ga0207708_10072462 3300026075 Bacteria 2639
239 Ga0207708_10090406 3300026075 Unclassified 2360
240 Ga0207708_10129405 3300026075 Bacteria 1973
241 Ga0207708_10201017 3300026075 Bacteria 1590
242 Ga0207708_10233299 3300026075 Bacteria 1478
243 Ga0207708_11708205 3300026075 Unclassified 553
244 Ga0207641_10451635 3300026088 Bacteria 1242
245 Ga0207641_11908306 3300026088 Unclassified 595
246 Ga0207641_12153796 3300026088 Unclassified 558
247 Ga0207648_10116028 3300026089 Bacteria 2353
248 Ga0207648_10122310 3300026089 Bacteria 2289
249 Ga0207648_10822550 3300026089 Unclassified 865
250 Ga0207676_10315940 3300026095 Bacteria 1432
251 Ga0207676_10601807 3300026095 Bacteria 1056
252 Ga0207676_11151526 3300026095 Unclassified 768
253 Ga0207674_10214869 3300026116 Bacteria 1872
254 Ga0207675_100002280 3300026118 Bacteria 19054
255 Ga0207675_100008108 3300026118 Bacteria 9896
256 Ga0207675_100035384 3300026118 Bacteria 4658
257 Ga0207675_100099406 3300026118 Bacteria 2740
258 Ga0207675_100168841 3300026118 Unclassified 2090
259 Ga0207675_100536831 3300026118 Unclassified 1167
260 Ga0207683_10054896 3300026121 Bacteria 3493
261 Ga0207683_10204653 3300026121 Bacteria 1795
262 Ga0209969_1021621 3300027360 Unclassified 961
263 Ga0209981_1034455 3300027378 Unclassified 748
264 Ga0209984_1010800 3300027424 Unclassified 1176
265 Ga0209999_1027038 3300027543 Unclassified 1061
266 Ga0209982_1000495 3300027552 Bacteria 4891
267 Ga0209970_1009729 3300027614 Unclassified 1572
268 Ga0210002_1010842 3300027617 Unclassified 1404
269 Ga0209983_1000677 3300027665 Bacteria 7317
270 Ga0209971_1006832 3300027682 Bacteria 2704
271 Ga0209966_1031344 3300027695 Archaea 1078
272 Ga0209998_10004282 3300027717 Bacteria 3039
273 Ga0209974_10015141 3300027876 Unclassified 2561
274 Ga0268266_10007256 3300028379 Bacteria 10021
275 Ga0268265_10071928 3300028380 Bacteria 2696
276 Ga0268265_10095767 3300028380 Bacteria 2384
277 Ga0268265_10298925 3300028380 Unclassified 1448
278 Ga0268264_10479831 3300028381 Unclassified 1209
279 Ga0268264_11504281 3300028381 Bacteria 684
280 Ga0265318_10104055 3300028577 Bacteria 1044
281 Ga0265338_10003361 3300028800 Bacteria 22584
282 Ga0265338_10425296 3300028800 Unclassified 943
283 Ga0265328_10003557 3300031239 Bacteria 6868
284 Ga0265320_10103738 3300031240 Unclassified 1308
285 Ga0265340_10335883 3300031247 Bacteria 668
286 Ga0265331_10003935 3300031250 Bacteria 9388
287 Ga0307513_10034118 3300031456 Bacteria 5714
288 Ga0307509_10368650 3300031507 Bacteria 1153
289 Ga0307408_100333132 3300031548 Unclassified 1282
290 Ga0307408_100688492 3300031548 Bacteria 918
291 Ga0307516_10043983 3300031730 Bacteria 4422
292 Ga0307405_10552774 3300031731 Bacteria 932
293 Ga0307405_11697353 3300031731 Bacteria 559
294 Ga0307413_10003208 3300031824 Bacteria 6843
295 Ga0307413_10194284 3300031824 Unclassified 1460
296 Ga0307410_10092438 3300031852 Bacteria 2150
297 Ga0307406_10014123 3300031901 Bacteria 4589
298 Ga0307407_10179737 3300031903 Bacteria 1401
299 Ga0307407_10320582 3300031903 Unclassified 1087
300 Ga0307409_100014163 3300031995 Bacteria 5171
301 Ga0307409_100320515 3300031995 Unclassified 1450
302 Ga0307416_101794219 3300032002 Bacteria 717
303 Ga0307414_10721164 3300032004 Unclassified 904
304 Ga0307411_10042135 3300032005 Bacteria 2910
305 Ga0307411_11023723 3300032005 Unclassified 740
306 Ga0307415_100141594 3300032126 Bacteria 1838
307 Ga0373945_0346839 3300035116 Bacteria 643
308 Ga0373956_0122380 3300035119 Unclassified 1216
309 Ga0373943_0419236 3300035170 Unclassified 775
310 Ga0373935_0255832 3300035692 Bacteria 1227
311 Ga0373937_0306589 3300036401 Unclassified 1501
312 Ga0373937_1994993 3300036401 Unclassified 526
313 Ga0451789_0361568 3300041443 Bacteria 1481
314 Ga0451789_1016324 3300041443 Bacteria 948
315 Ga0451791_0565651 3300041451 Unclassified 894
316 Ga0451791_0697457 3300041451 Bacteria 1338
317 Ga0451797_0055628 3300041453 Bacteria 944
318 Ga0451802_1118703 3300041460 Bacteria 1185
319 Ga0451802_2166366 3300041460 Bacteria 1098
320 Ga0451804_0313223 3300041463 Unclassified 567
321 Ga0451807_1754672 3300041486 Unclassified 1002
322 Ga0451807_2619384 3300041486 Bacteria 995
323 Ga0451833_0161320 3300041491 Bacteria 1539
324 Ga0451837_0745171 3300041494 Bacteria 2557
325 Ga0451853_0132751 3300041512 Bacteria 576
326 Ga0439443_043346 3300042003 Unclassified 773
327 Ga0450914_020417 3300042118 Bacteria 734
328 Ga0450896_002452 3300042133 Unclassified 2395
329 Ga0495590_0003884 3300046457 Bacteria 6079
330 Ga0495638_0391722 3300046460 Bacteria 723
331 Ga0495580_0188549 3300046472 Unclassified 1423
332 Ga0495585_0159159 3300046492 Bacteria 1173
333 Ga0495616_0004598 3300046513 Bacteria 8674
334 Ga0495630_1369386 3300046517 Bacteria 532
335 Ga0495632_0118372 3300046519 Unclassified 1239
336 Ga0495654_0261775 3300046530 Unclassified 717
337 Ga0495656_0047348 3300046615 Unclassified 1823
338 Ga0495634_0573192 3300046642 Bacteria 657
339 Ga0495669_0472885 3300046684 Unclassified 609
340 Ga0495649_0049532 3300046694 Unclassified 2282
341 Ga0495674_1124280 3300047319 Unclassified 597
342 Ga0495680_0418569 3300047322 Unclassified 922
343 Ga0501033_0315245 3300049570 Bacteria 1099
344 Ga0501036_0447554 3300049572 Bacteria 1076
345 Ga0501038_0235356 3300049574 Bacteria 1456
346 Ga0501040_0519707 3300049576 Bacteria 858
347 Ga0501041_0090881 3300049577 Unclassified 1885
348 Ga0501071_0130846 3300049587 Unclassified 1864
349 Ga0501073_0198821 3300049589 Bacteria 1386
350 Ga0501075_0265584 3300049591 Bacteria 1308
351 Ga0501076_0103113 3300049592 Unclassified 2301
352 Ga0501080_0612053 3300049742 Unclassified 966
353 Ga0501045_0050596 3300049824 Unclassified 3032
354 nmdc:mga05p37_782273_c1 3300050507 Unclassified 1047
355 nmdc:mga09592_129130_c1 3300050508 Unclassified 2174
356 nmdc:mga0qj67_632452_c1 3300050509 Unclassified 855
357 nmdc:mga06r32_1589356_c1 3300050510 Unclassified 593
358 nmdc:mga06r32_163325_c1 3300050510 Unclassified 2210
359 nmdc:mga06r32_495029_c1 3300050510 Unclassified 1200
360 nmdc:mga08y16_1464152_c1 3300050511 Unclassified 644
361 nmdc:mga08y16_1835880_c1 3300050511 Unclassified 558
362 nmdc:mga08y16_623154_c1 3300050511 Bacteria 1085
363 nmdc:mga08y16_67781_c1 3300050511 Unclassified 3722
364 Ga0500611_052879 3300053727 Unclassified 936
365 Ga0501082_0281953 3300060353 Bacteria 1446
366 Ga0501082_1150717 3300060353 Bacteria 678
367 Ga0070670_100664871
368 MBSR1b_contig_3191732
369 rootH2_10260939
370 rootH1_10007976
371 rootH1_10318078
372 Ga0065715_10260889
373 Ga0070676_10064025
374 Ga0070683_100504989
375 Ga0070690_100003398
376 Ga0070670_100193769
377 Ga0070670_100586330
378 Ga0070677_10004550
379 Ga0068869_100080298
380 Ga0068869_100476935
381 Ga0068869_100837660
382 Ga0068869_101494552
383 Ga0070666_10334262
384 Ga0070682_100209087
385 Ga0070689_100102468
386 Ga0070689_100450429
387 Ga0070689_100738506
388 Ga0070689_100978903
389 Ga0070691_10242720
390 Ga0070691_11104469
391 Ga0070687_100102080
392 Ga0070687_100241467
393 Ga0070692_10136858
394 Ga0070692_10190302
395 Ga0070668_100156488
396 Ga0070668_100340487
397 Ga0070669_100043326
398 Ga0070669_100051028
399 Ga0070669_100066107
400 Ga0070669_100511598
401 Ga0070675_100027599
402 Ga0070675_100304705
403 Ga0070675_100318052
404 Ga0070675_100321272
405 Ga0070674_100007354
406 Ga0070674_100051199
407 Ga0070674_100058421
408 Ga0070674_100156395
409 Ga0070674_100404198
410 Ga0070674_100838923
411 Ga0070673_100021471
412 Ga0070673_100328353
413 Ga0070673_100775538
414 Ga0070673_101071609
415 Ga0070688_100022604
416 Ga0070688_100232220
417 Ga0070659_100365593
418 Ga0070659_100446450
419 Ga0070659_100959873
420 Ga0070667_100074982
421 Ga0070667_100442050
422 Ga0070701_10139380
423 Ga0070701_10264156
424 Ga0070701_10286565
425 Ga0070705_100004417
426 Ga0070700_100053765
427 Ga0070700_100056587
428 Ga0070700_100166711
429 Ga0070700_100167442
430 Ga0070700_100366640
431 Ga0070700_100835774
432 Ga0070700_100849281
433 Ga0070700_101018112
434 Ga0070694_100103942
435 Ga0070694_101085046
436 Ga0070663_100063884
437 Ga0070663_101119263
438 Ga0070678_100049280
439 Ga0070662_100222098
440 Ga0070662_100480001
441 Ga0068867_100054711
442 Ga0068867_100728657
443 Ga0068867_100842442
444 Ga0070685_10104613
445 Ga0070685_10169022
446 Ga0070685_10456810
447 Ga0070672_100002342
448 Ga0070672_100098917
449 Ga0070672_100131239
450 Ga0070672_100135583
451 Ga0070672_101184045
452 Ga0070686_100065439
453 Ga0070686_100294505
454 Ga0070686_100303697
455 Ga0070693_101014309
456 Ga0070665_100004383
457 Ga0070665_100223611
458 Ga0070665_101568820
459 Ga0070704_100057826
460 Ga0070664_100017417
461 Ga0070664_100479330
462 Ga0068857_100313458
463 Ga0068854_100741455
464 Ga0070702_100389465
465 Ga0070702_101406818
466 Ga0068852_101075568
467 Ga0068859_100271542
468 Ga0068859_100532174
469 Ga0068864_100042130
470 Ga0068864_100179059
471 Ga0068866_10502149
472 Ga0068866_10664695
473 Ga0068861_100015764
474 Ga0068861_100016981
475 Ga0068861_100088277
476 Ga0068861_100114820
477 Ga0068861_100197723
478 Ga0068861_100487642
479 Ga0068870_10011744
480 Ga0068870_10459484
481 Ga0068870_10496186
482 Ga0068863_100035927
483 Ga0068863_100151879
484 Ga0068863_100672922
485 Ga0068858_101409137
486 Ga0068860_100152119
487 Ga0068860_101573651
488 Ga0068862_100061902
489 Ga0068862_100081761
490 Ga0068862_100246261
491 Ga0070715_10282909
492 Ga0097621_100032863
493 Ga0097621_100262153
494 Ga0097621_100420126
495 Ga0068871_100146889
496 Ga0068871_100421100
497 Ga0075428_100040279
498 Ga0075428_100102084
499 Ga0075428_100277435
500 Ga0075431_100215164
501 Ga0075431_100255300
502 Ga0075431_100902026
503 Ga0075429_100031822
504 Ga0068865_100009054
505 Ga0068865_100287575
506 Ga0068865_100301547
507 Ga0097620_100271557
508 Ga0097620_100532172
509 Ga0111539_10299937
510 Ga0111539_11925350
511 Ga0114129_10386468
512 Ga0105243_10059070
513 Ga0105243_12683448
514 Ga0105242_10800126
515 Ga0105248_10063894
516 Ga0105248_10811105
517 Ga0105248_12076349
518 Ga0105249_10049645
519 Ga0105249_10706950
520 Ga0105249_10839871
521 Ga0105249_11196566
522 Ga0105249_11210251
523 Ga0157374_10039597
524 Ga0157378_10395581
525 Ga0157378_11401265
526 Ga0163162_10545588
527 Ga0163162_10615925
528 Ga0157375_10051495
529 Ga0157375_10066106
530 Ga0157375_10454363
531 Ga0157375_11169117
532 Ga0163163_10063622
533 Ga0163163_11085159
534 Ga0163163_11709983
535 Ga0157380_10041405
536 Ga0157380_10076247
537 Ga0157380_10086158
538 Ga0157380_10318783
539 Ga0157379_12282990
540 Ga0157376_10176933
541 Ga0163161_10197706
542 Ga0163161_10231125
543 Ga0207688_10338760
544 Ga0207680_10841026
545 Ga0207645_10023844
546 Ga0207645_10212610
547 Ga0207643_10007178
548 Ga0207643_10103017
549 Ga0207660_10121083
550 Ga0207662_10121861
551 Ga0207662_10315456
552 Ga0207649_10682716
553 Ga0207681_10038105
554 Ga0207681_10056149
555 Ga0207681_10080021
556 Ga0207650_10163397
557 Ga0207650_10173063
558 Ga0207659_10006067
559 Ga0207659_10047369
560 Ga0207659_10061368
561 Ga0207687_11283243
562 Ga0207700_10836480
563 Ga0207644_10669627
564 Ga0207706_10264843
565 Ga0207706_10424695
566 Ga0207686_10367106
567 Ga0207670_10215087
568 Ga0207670_11618222
569 Ga0207669_10001903
570 Ga0207669_10040514
571 Ga0207669_10079968
572 Ga0207669_10129581
573 Ga0207669_10765974
574 Ga0207704_10180931
575 Ga0207704_10858663
576 Ga0207691_10005736
577 Ga0207691_10011392
578 Ga0207691_10022602
579 Ga0207691_10047384
580 Ga0207691_10118420
581 Ga0207711_10040309
582 Ga0207711_10327905
583 Ga0207711_11126566
584 Ga0207689_10342945
585 Ga0207689_10416383
586 Ga0207689_10432030
587 Ga0207689_10482180
588 Ga0207689_10709700
589 Ga0207679_10057847
590 Ga0207651_10050412
591 Ga0207651_10059311
592 Ga0207651_11046861
593 Ga0207712_10358812
594 Ga0207712_10547587
595 Ga0207668_10276957
596 Ga0207668_10834857
597 Ga0207640_10641235
598 Ga0207658_10219362
599 Ga0207658_10351723
600 Ga0207658_11682200
601 Ga0207678_10975816
602 Ga0207708_10050820
603 Ga0207708_10053523
604 Ga0207708_10072462
605 Ga0207708_10090406
606 Ga0207708_10129405
607 Ga0207708_10201017
608 Ga0207708_10233299
609 Ga0207708_11708205
610 Ga0207641_10451635
611 Ga0207641_11908306
612 Ga0207641_12153796
613 Ga0207648_10116028
614 Ga0207648_10122310
615 Ga0207648_10822550
616 Ga0207676_10315940
617 Ga0207676_10601807
618 Ga0207676_11151526
619 Ga0207674_10214869
620 Ga0207675_100002280
621 Ga0207675_100008108
622 Ga0207675_100035384
623 Ga0207675_100099406
624 Ga0207675_100168841
625 Ga0207675_100536831
626 Ga0207683_10054896
627 Ga0207683_10204653
628 Ga0209969_1021621
629 Ga0209981_1034455
630 Ga0209984_1010800
631 Ga0209999_1027038
632 Ga0209982_1000495
633 Ga0209970_1009729
634 Ga0210002_1010842
635 Ga0209983_1000677
636 Ga0209971_1006832
637 Ga0209966_1031344
638 Ga0209998_10004282
639 Ga0209974_10015141
640 Ga0268266_10007256
641 Ga0268265_10071928
642 Ga0268265_10095767
643 Ga0268265_10298925
644 Ga0268264_10479831
645 Ga0268264_11504281
646 Ga0265318_10104055
647 Ga0265338_10003361
648 Ga0265338_10425296
649 Ga0265328_10003557
650 Ga0265320_10103738
651 Ga0265340_10335883
652 Ga0265331_10003935
653 Ga0307513_10034118
654 Ga0307509_10368650
655 Ga0307408_100333132
656 Ga0307408_100688492
657 Ga0307516_10043983
658 Ga0307405_10552774
659 Ga0307405_11697353
660 Ga0307413_10003208
661 Ga0307413_10194284
662 Ga0307410_10092438
663 Ga0307406_10014123
664 Ga0307407_10179737
665 Ga0307407_10320582
666 Ga0307409_100014163
667 Ga0307409_100320515
668 Ga0307416_101794219
669 Ga0307414_10721164
670 Ga0307411_10042135
671 Ga0307411_11023723
672 Ga0307415_100141594
673 Ga0373945_0346839
674 Ga0373956_0122380
675 Ga0373943_0419236
676 Ga0373935_0255832
677 Ga0373937_0306589
678 Ga0373937_1994993
679 Ga0451789_0361568
680 Ga0451789_1016324
681 Ga0451791_0565651
682 Ga0451791_0697457
683 Ga0451797_0055628
684 Ga0451802_1118703
685 Ga0451802_2166366
686 Ga0451804_0313223
687 Ga0451807_1754672
688 Ga0451807_2619384
689 Ga0451833_0161320
690 Ga0451837_0745171
691 Ga0451853_0132751
692 Ga0439443_043346
693 Ga0450914_020417
694 Ga0450896_002452
695 Ga0495590_0003884
696 Ga0495638_0391722
697 Ga0495580_0188549
698 Ga0495585_0159159
699 Ga0495616_0004598
700 Ga0495630_1369386
701 Ga0495632_0118372
702 Ga0495654_0261775
703 Ga0495656_0047348
704 Ga0495634_0573192
705 Ga0495669_0472885
706 Ga0495649_0049532
707 Ga0495674_1124280
708 Ga0495680_0418569
709 Ga0501033_0315245
710 Ga0501036_0447554
711 Ga0501038_0235356
712 Ga0501040_0519707
713 Ga0501041_0090881
714 Ga0501071_0130846
715 Ga0501073_0198821
716 Ga0501075_0265584
717 Ga0501076_0103113
718 Ga0501080_0612053
719 Ga0501045_0050596
720 nmdc:mga05p37_782273_c1
721 nmdc:mga09592_129130_c1
722 nmdc:mga0qj67_632452_c1
723 nmdc:mga06r32_1589356_c1
724 nmdc:mga06r32_163325_c1
725 nmdc:mga06r32_495029_c1
726 nmdc:mga08y16_1464152_c1
727 nmdc:mga08y16_1835880_c1
728 nmdc:mga08y16_623154_c1
729 nmdc:mga08y16_67781_c1
730 Ga0500611_052879
731 Ga0501082_0281953
732 Ga0501082_1150717

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01124

MAPEG

MAPEG family

6

136

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hv9-assembly1.cif.gz_A human ltc4s mutant-s36e 0.7942 6 139
6ssu-assembly1.cif.gz_B crystal structure of human microsomal glutathione s-transferase 2 in complex with co-substrate glutathione 0.7907 1 138
6sss-assembly1.cif.gz_C crystal structure of human microsomal glutathione s-transferase 2 0.7896 1 139
3leo-assembly1.cif.gz_A structure of human leukotriene c4 synthase mutant r31q in complex with glutathione 0.7886 2 139
4nta-assembly1.cif.gz_A mus musculus ltc4 synthase in apo form 0.7853 2 137
ID Description Score Start End Superfamily
af_Q9JHF3_7_153_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.8261 6 141 1.20.120.550
af_Q9JHF3_7_153_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7937 6 141 1.20.120.550
3leoA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7886 2 139 1.20.120.550
2pnoB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7753 1 139 1.20.120.550
af_Q86B54_20_166_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7604 1 139 1.20.120.550
ID Description Score Start End GO Terms
AF-A0A2E2HAA3-F1-model_v4 MAPEG family protein 0.9671 7 136 GO:0016020
AF-A0A7Z9W9J8-F1-model_v4 deleted 0.9669 1 138
AF-A0A368NIJ9-F1-model_v4 MAPEG family protein 0.963 7 135 GO:0016020
AF-A0A2I2A5B4-F1-model_v4 MAPEG family protein 0.9628 1 139 GO:0016020
AF-A0A370DM11-F1-model_v4 MAPEG family protein 0.9623 1 139 GO:0016020

Map