F423780

General Info

Members Datasets Scaffolds Average Seq Length
365 220 730 157

Family's Representative Sequence

Representative Sequence 3300046461|Ga0495641_0099111|Ga0495641_0099111_41_586
Length 181
Sequence MSSFDLFGSSGGADGGGPASPQLETDNQYLFTAFNFAVEIDVPGISGKVCNAAFAECDGLELTHDVKTIREGGNNRAQIRLTGPTSFGTVTLRRGMTPNFQLWQWFDGVVANPALRAHGEVVIFTGAYRESGREERARFLLENCVPVKLKAPPLNARDGMVAIEELQLACESITLKGAAGA

Samples

Sample ID Description Type Environment
1 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
63 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
90 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
91 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
142 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
143 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
144 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
145 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
146 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
147 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
148 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
149 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
150 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
151 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
152 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
153 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
154 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
155 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
156 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
157 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
158 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
159 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
160 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
161 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
162 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
163 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
164 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
165 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
166 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
169 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
170 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
171 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
172 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
173 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
174 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
175 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
176 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
177 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
178 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
179 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
180 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
181 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
182 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
183 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
184 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
185 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
186 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
187 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
188 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
189 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
190 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
191 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
192 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
193 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
194 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
195 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
196 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
197 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
198 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
199 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
200 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
201 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
202 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
203 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
204 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
205 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
206 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
207 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
208 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
209 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
210 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
211 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
212 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
213 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
214 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
215 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
216 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
217 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
218 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
219 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
220 2643221583 Caulobacter sp. Root655 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.45
Metatranscriptomes 0
Isolates 0.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.19
Nodule 0
Rhizoplane 5.75
Rhizosphere 90.41
Stem 0
Stem Tuber 0
Unclassified 28.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495641_0099111 3300046461 Viruses 1300
2 MRS1b_contig_2612244 2162886011 Bacteria 1245
3 LJQas_1000328 3300000549 Bacteria 8254
4 JGI24751J29686_10000009 3300002459 Bacteria 125815
5 JGI24751J29686_10000037 3300002459 Bacteria 81730
6 JGI25165J46597_1000010 3300003214 Bacteria 442113
7 rootH1_10384735 3300003323 Bacteria 1657
8 Ga0065714_10123262 3300005288 Bacteria 1323
9 Ga0065714_10212097 3300005288 Unclassified 863
10 Ga0065712_10008068 3300005290 Bacteria 6382
11 Ga0065712_10026790 3300005290 Bacteria 1631
12 Ga0065712_10071969 3300005290 Bacteria 4960
13 Ga0065715_10009627 3300005293 Unclassified 3538
14 Ga0065715_10062092 3300005293 Unclassified 751
15 Ga0065707_10208139 3300005295 Bacteria 1278
16 Ga0070683_100004045 3300005329 Bacteria 12012
17 Ga0070670_100001122 3300005331 Bacteria 21301
18 Ga0070670_100002674 3300005331 Bacteria 14723
19 Ga0070670_100031468 3300005331 Bacteria 4569
20 Ga0070670_100074534 3300005331 Bacteria 2916
21 Ga0070670_100462825 3300005331 Bacteria 1125
22 Ga0070666_10408006 3300005335 Unclassified 977
23 Ga0070666_10599440 3300005335 Unclassified 804
24 Ga0070680_100000022 3300005336 Bacteria 81256
25 Ga0070680_100352828 3300005336 Bacteria 1251
26 Ga0070689_100053645 3300005340 Bacteria 3120
27 Ga0070689_100203974 3300005340 Bacteria 1616
28 Ga0070687_100145565 3300005343 Unclassified 1385
29 Ga0070661_100013161 3300005344 Bacteria 5806
30 Ga0070669_100005967 3300005353 Bacteria 8786
31 Ga0070669_100647629 3300005353 Unclassified 889
32 Ga0070675_100064677 3300005354 Unclassified 3024
33 Ga0070675_101078615 3300005354 Unclassified 738
34 Ga0070671_100433908 3300005355 Bacteria 1126
35 Ga0070671_100728828 3300005355 Bacteria 861
36 Ga0070674_101780401 3300005356 Bacteria 558
37 Ga0070673_100450689 3300005364 Bacteria 1157
38 Ga0070673_101375286 3300005364 Bacteria 664
39 Ga0070667_101775864 3300005367 Unclassified 580
40 Ga0070714_101048684 3300005435 Unclassified 794
41 Ga0070701_10029212 3300005438 Unclassified 2717
42 Ga0070705_100007519 3300005440 Bacteria 5364
43 Ga0070705_100678516 3300005440 Bacteria 807
44 Ga0070700_100000063 3300005441 Bacteria 78812
45 Ga0070700_100059112 3300005441 Unclassified 2411
46 Ga0070700_100532330 3300005441 Bacteria 910
47 Ga0070694_100124326 3300005444 Bacteria 1855
48 Ga0070694_100437934 3300005444 Bacteria 1030
49 Ga0070694_100904165 3300005444 Unclassified 729
50 Ga0070708_100003555 3300005445 Bacteria 12219
51 Ga0070662_100288287 3300005457 Bacteria 1330
52 Ga0070662_100732441 3300005457 Unclassified 838
53 Ga0068867_100463271 3300005459 Bacteria 1082
54 Ga0070685_10160622 3300005466 Unclassified 1432
55 Ga0070685_10783106 3300005466 Bacteria 702
56 Ga0070706_100012681 3300005467 Bacteria 7797
57 Ga0070707_100181922 3300005468 Bacteria 2049
58 Ga0070707_100567832 3300005468 Bacteria 1097
59 Ga0070698_100000325 3300005471 Bacteria 48768
60 Ga0070698_100019620 3300005471 Bacteria 7092
61 Ga0070698_100030991 3300005471 Bacteria 5546
62 Ga0070699_100223059 3300005518 Bacteria 1680
63 Ga0070699_100655707 3300005518 Bacteria 958
64 Ga0070679_100569686 3300005530 Unclassified 1076
65 Ga0070684_100002136 3300005535 Bacteria 14591
66 Ga0068853_100811058 3300005539 Unclassified 896
67 Ga0070672_100188460 3300005543 Unclassified 1721
68 Ga0070672_100242928 3300005543 Bacteria 1515
69 Ga0070672_101174923 3300005543 Bacteria 683
70 Ga0070686_100758034 3300005544 Unclassified 779
71 Ga0070695_100311779 3300005545 Bacteria 1166
72 Ga0070696_100072740 3300005546 Bacteria 2421
73 Ga0070693_100059454 3300005547 Bacteria 2215
74 Ga0070693_100341867 3300005547 Unclassified 1022
75 Ga0070664_100000607 3300005564 Bacteria 27439
76 Ga0068857_100164470 3300005577 Bacteria 2014
77 Ga0068857_100637043 3300005577 Bacteria 1009
78 Ga0068854_100247201 3300005578 Bacteria 1423
79 Ga0068854_100296028 3300005578 Bacteria 1307
80 Ga0068856_101351126 3300005614 Bacteria 727
81 Ga0070702_100015359 3300005615 Bacteria 3909
82 Ga0068859_100059405 3300005617 Bacteria 3852
83 Ga0068859_100339062 3300005617 Unclassified 1597
84 Ga0068859_100884346 3300005617 Bacteria 978
85 Ga0068859_100970743 3300005617 Bacteria 932
86 Ga0068859_101157243 3300005617 Bacteria 851
87 Ga0068859_101219862 3300005617 Unclassified 828
88 Ga0068864_100191377 3300005618 Bacteria 1875
89 Ga0068864_100326094 3300005618 Unclassified 1443
90 Ga0068864_100745408 3300005618 Bacteria 959
91 Ga0068864_100886168 3300005618 Bacteria 881
92 Ga0068864_101278450 3300005618 Bacteria 734
93 Ga0068861_100245680 3300005719 Bacteria 1524
94 Ga0068861_100286723 3300005719 Viruses 1420
95 Ga0068863_100090432 3300005841 Unclassified 2902
96 Ga0068863_100385796 3300005841 Bacteria 1368
97 Ga0068858_100000102 3300005842 Bacteria 88959
98 Ga0068858_100198469 3300005842 Bacteria 1897
99 Ga0068858_100372636 3300005842 Bacteria 1369
100 Ga0068858_100502533 3300005842 Unclassified 1171
101 Ga0068860_100107188 3300005843 Unclassified 2670
102 Ga0068860_100121315 3300005843 Bacteria 2503
103 Ga0068860_100188515 3300005843 Unclassified 1995
104 Ga0068860_100387454 3300005843 Bacteria 1380
105 Ga0068860_100920874 3300005843 Bacteria 891
106 Ga0068862_100352321 3300005844 Unclassified 1366
107 Ga0068862_100416276 3300005844 Bacteria 1260
108 Ga0068862_100794713 3300005844 Unclassified 923
109 Ga0097621_100082946 3300006237 Bacteria 2670
110 Ga0075428_100846397 3300006844 Bacteria 971
111 Ga0075431_101547305 3300006847 Bacteria 621
112 Ga0075433_10326952 3300006852 Bacteria 1356
113 Ga0097620_100059405 3300006931 Bacteria 3852
114 Ga0097620_100339091 3300006931 Unclassified 1597
115 Ga0097620_100884315 3300006931 Bacteria 978
116 Ga0097620_100970806 3300006931 Bacteria 932
117 Ga0097620_101157244 3300006931 Bacteria 851
118 Ga0097620_101219924 3300006931 Unclassified 828
119 Ga0099794_10000018 3300007265 Bacteria 74076
120 Ga0099794_10179858 3300007265 Bacteria 1079
121 Ga0105251_10146490 3300009011 Unclassified 1067
122 Ga0105251_10587437 3300009011 Unclassified 527
123 Ga0105240_10237223 3300009093 Unclassified 2116
124 Ga0111539_10002551 3300009094 Bacteria 24111
125 Ga0111539_12259218 3300009094 Bacteria 631
126 Ga0105245_11026188 3300009098 Unclassified 870
127 Ga0105247_10003791 3300009101 Bacteria 9804
128 Ga0114129_10176962 3300009147 Bacteria 2906
129 Ga0114129_10251934 3300009147 Unclassified 2370
130 Ga0114129_12118279 3300009147 Bacteria 678
131 Ga0105243_10140293 3300009148 Unclassified 2061
132 Ga0105243_11370609 3300009148 Unclassified 727
133 Ga0105241_10008531 3300009174 Bacteria 7536
134 Ga0105242_10090086 3300009176 Bacteria 2579
135 Ga0105242_11017400 3300009176 Bacteria 837
136 Ga0105248_10069373 3300009177 Unclassified 3958
137 Ga0105248_10277038 3300009177 Bacteria 1888
138 Ga0105248_10338545 3300009177 Unclassified 1694
139 Ga0105248_10908955 3300009177 Bacteria 994
140 Ga0105248_11254903 3300009177 Unclassified 838
141 Ga0105238_10005386 3300009551 Bacteria 12643
142 Ga0105249_10066020 3300009553 Bacteria 3330
143 Ga0105239_11878149 3300010375 Bacteria 694
144 Ga0105239_11960529 3300010375 Bacteria 680
145 Ga0105246_11164674 3300011119 Unclassified 708
146 Ga0157373_10005903 3300013100 Bacteria 9163
147 Ga0157373_10626343 3300013100 Bacteria 784
148 Ga0157374_10327503 3300013296 Viruses 1519
149 Ga0157378_10018754 3300013297 Bacteria 6081
150 Ga0157378_11418200 3300013297 Bacteria 738
151 Ga0163162_10004046 3300013306 Bacteria 14067
152 Ga0163162_10451664 3300013306 Unclassified 1417
153 Ga0157372_10464175 3300013307 Bacteria 1476
154 Ga0157375_10006029 3300013308 Bacteria 10570
155 Ga0157375_11202960 3300013308 Bacteria 889
156 Ga0157375_11636622 3300013308 Bacteria 762
157 Ga0163163_10000986 3300014325 Bacteria 24072
158 Ga0163163_10029228 3300014325 Bacteria 5301
159 Ga0163163_11051110 3300014325 Bacteria 877
160 Ga0157380_10005263 3300014326 Bacteria 9042
161 Ga0157380_10190650 3300014326 Bacteria 1809
162 Ga0157380_10335337 3300014326 Bacteria 1408
163 Ga0157380_10401870 3300014326 Bacteria 1300
164 Ga0157380_10885683 3300014326 Bacteria 917
165 Ga0157377_10717500 3300014745 Bacteria 728
166 Ga0157379_10122291 3300014968 Unclassified 2342
167 Ga0157379_10445928 3300014968 Bacteria 1194
168 Ga0157376_10947472 3300014969 Bacteria 881
169 Ga0157376_11023325 3300014969 Bacteria 849
170 Ga0163161_10036945 3300017792 Bacteria 3500
171 Ga0209437_101271 3300025233 Bacteria 6852
172 Ga0209233_1000044 3300025261 Bacteria 489783
173 Ga0207697_10082411 3300025315 Bacteria 1356
174 Ga0207713_1199019 3300025735 Unclassified 615
175 Ga0207682_10262589 3300025893 Unclassified 805
176 Ga0207710_10003697 3300025900 Bacteria 6785
177 Ga0207688_10209117 3300025901 Bacteria 1172
178 Ga0207680_10382757 3300025903 Unclassified 992
179 Ga0207647_10159489 3300025904 Bacteria 1316
180 Ga0207643_10107527 3300025908 Bacteria 1640
181 Ga0207654_10155306 3300025911 Bacteria 1473
182 Ga0207654_10992177 3300025911 Unclassified 611
183 Ga0207671_10310753 3300025914 Unclassified 1246
184 Ga0207660_10000004 3300025917 Bacteria 371608
185 Ga0207662_10072858 3300025918 Bacteria 2083
186 Ga0207649_10324730 3300025920 Unclassified 1132
187 Ga0207649_11316772 3300025920 Unclassified 571
188 Ga0207652_10514838 3300025921 Unclassified 1077
189 Ga0207646_10492314 3300025922 Bacteria 1105
190 Ga0207681_10029354 3300025923 Bacteria 3571
191 Ga0207681_10098916 3300025923 Bacteria 2099
192 Ga0207694_10023715 3300025924 Unclassified 4659
193 Ga0207650_10000001 3300025925 Bacteria 1545726
194 Ga0207650_10013351 3300025925 Bacteria 5686
195 Ga0207650_10104027 3300025925 Bacteria 2190
196 Ga0207650_10267379 3300025925 Unclassified 1389
197 Ga0207650_10353951 3300025925 Bacteria 1208
198 Ga0207659_10066129 3300025926 Bacteria 2622
199 Ga0207659_10387444 3300025926 Bacteria 1166
200 Ga0207687_10793104 3300025927 Unclassified 808
201 Ga0207644_10303996 3300025931 Unclassified 1286
202 Ga0207644_11595064 3300025931 Bacteria 547
203 Ga0207690_10193465 3300025932 Bacteria 1540
204 Ga0207706_10281622 3300025933 Unclassified 1450
205 Ga0207686_10069230 3300025934 Bacteria 2263
206 Ga0207686_11224592 3300025934 Bacteria 615
207 Ga0207709_10230988 3300025935 Unclassified 1340
208 Ga0207709_10633322 3300025935 Unclassified 850
209 Ga0207709_11268651 3300025935 Unclassified 608
210 Ga0207670_10015228 3300025936 Bacteria 4589
211 Ga0207670_10028542 3300025936 Bacteria 3544
212 Ga0207669_10302165 3300025937 Bacteria 1217
213 Ga0207704_10849212 3300025938 Unclassified 765
214 Ga0207691_10124340 3300025940 Bacteria 2283
215 Ga0207691_10200309 3300025940 Unclassified 1738
216 Ga0207691_10584548 3300025940 Bacteria 946
217 Ga0207711_10052923 3300025941 Bacteria 3481
218 Ga0207711_10324775 3300025941 Unclassified 1422
219 Ga0207711_10354008 3300025941 Unclassified 1360
220 Ga0207711_10614172 3300025941 Unclassified 1014
221 Ga0207689_10122456 3300025942 Bacteria 2139
222 Ga0207689_10293396 3300025942 Bacteria 1347
223 Ga0207661_10014677 3300025944 Bacteria 5747
224 Ga0207679_10027893 3300025945 Unclassified 3911
225 Ga0207651_10030116 3300025960 Bacteria 3451
226 Ga0207651_10105570 3300025960 Bacteria 2102
227 Ga0207640_10357517 3300025981 Bacteria 1175
228 Ga0207640_10731107 3300025981 Bacteria 851
229 Ga0207640_10898860 3300025981 Bacteria 773
230 Ga0207677_10264870 3300026023 Unclassified 1403
231 Ga0207677_10277095 3300026023 Bacteria 1375
232 Ga0207703_10000190 3300026035 Bacteria 72096
233 Ga0207703_10359080 3300026035 Unclassified 1343
234 Ga0207703_10847960 3300026035 Unclassified 874
235 Ga0207639_10651817 3300026041 Unclassified 974
236 Ga0207678_10111476 3300026067 Unclassified 2334
237 Ga0207708_10000078 3300026075 Bacteria 76470
238 Ga0207708_10016199 3300026075 Bacteria 5601
239 Ga0207702_11265582 3300026078 Bacteria 732
240 Ga0207641_10084441 3300026088 Unclassified 2764
241 Ga0207641_11603433 3300026088 Bacteria 653
242 Ga0207648_10191894 3300026089 Bacteria 1811
243 Ga0207676_10206053 3300026095 Bacteria 1741
244 Ga0207676_10217536 3300026095 Bacteria 1699
245 Ga0207676_11443408 3300026095 Bacteria 684
246 Ga0207676_11790094 3300026095 Unclassified 613
247 Ga0207674_10207454 3300026116 Bacteria 1909
248 Ga0207674_10919451 3300026116 Bacteria 843
249 Ga0207674_11465282 3300026116 Bacteria 652
250 Ga0207675_100064979 3300026118 Bacteria 3410
251 Ga0207675_100264510 3300026118 Viruses 1668
252 Ga0207675_100272138 3300026118 Bacteria 1644
253 Ga0207675_100497595 3300026118 Bacteria 1213
254 Ga0207675_100511942 3300026118 Unclassified 1196
255 Ga0209588_1000411 3300027671 Bacteria 11121
256 Ga0207428_10000915 3300027907 Bacteria 32988
257 Ga0268265_10327505 3300028380 Unclassified 1390
258 Ga0268265_10773454 3300028380 Bacteria 934
259 Ga0268264_10175016 3300028381 Unclassified 1944
260 Ga0307513_10011493 3300031456 Bacteria 10998
261 Ga0307513_10226301 3300031456 Bacteria 1687
262 Ga0307408_100233306 3300031548 Bacteria 1508
263 Ga0307408_100257609 3300031548 Bacteria 1442
264 Ga0307508_10024773 3300031616 Bacteria 5445
265 Ga0307405_10011647 3300031731 Bacteria 4623
266 Ga0307405_10666642 3300031731 Bacteria 857
267 Ga0307405_10903096 3300031731 Bacteria 747
268 Ga0307413_11190335 3300031824 Unclassified 662
269 Ga0307410_10674214 3300031852 Unclassified 869
270 Ga0307406_10000691 3300031901 Bacteria 19088
271 Ga0307406_10065090 3300031901 Bacteria 2368
272 Ga0307406_10074675 3300031901 Bacteria 2233
273 Ga0307406_10280155 3300031901 Unclassified 1271
274 Ga0307407_10138042 3300031903 Bacteria 1569
275 Ga0307407_10331226 3300031903 Unclassified 1072
276 Ga0307409_100041084 3300031995 Bacteria 3451
277 Ga0307409_100055419 3300031995 Unclassified 3061
278 Ga0307416_100007410 3300032002 Bacteria 6976
279 Ga0307416_100111853 3300032002 Unclassified 2409
280 Ga0307416_100178503 3300032002 Bacteria 1987
281 Ga0307411_10014803 3300032005 Bacteria 4355
282 Ga0307411_10804290 3300032005 Unclassified 828
283 Ga0307415_100039976 3300032126 Bacteria 3104
284 Ga0307415_101286216 3300032126 Unclassified 692
285 Ga0373944_0031037 3300035089 Bacteria 1606
286 Ga0373949_0089534 3300035090 Bacteria 830
287 Ga0373951_0003494 3300035091 Bacteria 3800
288 Ga0373951_0043332 3300035091 Bacteria 1091
289 Ga0373941_0290467 3300035115 Unclassified 650
290 Ga0373945_0041976 3300035116 Bacteria 1656
291 Ga0373956_0066720 3300035119 Bacteria 1637
292 Ga0373957_0522329 3300035120 Unclassified 518
293 Ga0373943_0043459 3300035170 Bacteria 2182
294 Ga0373946_0008490 3300035171 Unclassified 3769
295 Ga0373955_0029042 3300035172 Bacteria 2873
296 Ga0373924_0003891 3300035410 Bacteria 5176
297 Ga0373935_0031759 3300035692 Bacteria 3279
298 Ga0373947_0114719 3300035725 Bacteria 1706
299 Ga0373937_0288574 3300036401 Unclassified 1550
300 Ga0373925_0004777 3300037068 Bacteria 10205
301 Ga0395900_1492235 3300037418 Unclassified 588
302 Ga0395905_1291225 3300037471 Bacteria 634
303 Ga0436365_1302123 3300039437 Bacteria 24737
304 Ga0439436_0049975 3300041404 Bacteria 1184
305 Ga0439431_0150652 3300041997 Bacteria 661
306 Ga0439435_0056665 3300042436 Bacteria 1133
307 Ga0466965_0446582 3300044683 Bacteria 720
308 Ga0466963_0381000 3300044694 Bacteria 994
309 Ga0466960_0017944 3300044901 Bacteria 3095
310 Ga0451576_0637560 3300045051 Bacteria 1120
311 Ga0495592_0846023 3300046454 Bacteria 541
312 Ga0495580_0428436 3300046472 Bacteria 889
313 Ga0495662_0016458 3300046476 Unclassified 3582
314 Ga0495628_0944431 3300046516 Bacteria 596
315 Ga0495630_0776127 3300046517 Unclassified 732
316 Ga0495663_0092466 3300046525 Bacteria 987
317 Ga0495666_0095058 3300046526 Unclassified 1405
318 Ga0495621_0091592 3300046539 Bacteria 1146
319 Ga0495668_0000559 3300046616 Bacteria 45758
320 Ga0495625_0000064 3300046660 Bacteria 174730
321 Ga0495635_0808919 3300046663 Unclassified 604
322 Ga0495658_0185752 3300046683 Unclassified 1291
323 Ga0495613_0041692 3300046689 Unclassified 3399
324 Ga0495613_0167455 3300046689 Bacteria 1561
325 Ga0495636_0288279 3300047318 Bacteria 766
326 Ga0495680_0752815 3300047322 Unclassified 640
327 Ga0495673_0000039 3300047469 Bacteria 301943
328 Ga0495686_0066222 3300047472 Bacteria 2232
329 Ga0495615_0159540 3300048090 Bacteria 676
330 Ga0496101_0424240 3300048904 Bacteria 1048
331 Ga0496104_0001279 3300048907 Bacteria 21682
332 Ga0496104_0267296 3300048907 Bacteria 1623
333 Ga0496105_0166520 3300048908 Unclassified 1808
334 Ga0496108_0001898 3300048911 Bacteria 16747
335 Ga0496108_0049031 3300048911 Unclassified 3532
336 Ga0496109_0002303 3300048912 Bacteria 15887
337 Ga0496109_0026491 3300048912 Bacteria 5171
338 Ga0496109_0640536 3300048912 Bacteria 1000
339 Ga0496110_0014175 3300048913 Bacteria 6613
340 Ga0496110_0098060 3300048913 Unclassified 2626
341 Ga0496111_0001557 3300048914 Bacteria 13223
342 Ga0496111_0226623 3300048914 Bacteria 1388
343 Ga0496112_0004205 3300048915 Bacteria 12137
344 Ga0496112_0421891 3300048915 Unclassified 1273
345 Ga0496112_0666220 3300048915 Bacteria 970
346 Ga0496113_0137352 3300048916 Bacteria 1922
347 Ga0496113_0332503 3300048916 Bacteria 1218
348 Ga0496114_0539986 3300048917 Bacteria 1031
349 Ga0496114_1380105 3300048917 Bacteria 592
350 Ga0496115_0674389 3300048918 Bacteria 815
351 Ga0501067_0366488 3300049583 Unclassified 803
352 Ga0501073_0133035 3300049589 Bacteria 1724
353 Ga0501257_044677 3300049686 Unclassified 1094
354 nmdc:mga05p37_10868_c1 3300050507 Bacteria 10809
355 nmdc:mga05p37_88811_c1 3300050507 Unclassified 3809
356 nmdc:mga08y16_12618_c1 3300050511 Bacteria 8889
357 nmdc:mga0a205_289644_c1 3300050515 Bacteria 1512
358 Ga0500595_117111 3300053119 Bacteria 754
359 Ga0500658_0009506 3300053134 Unclassified 3584
360 Ga0500559_0186131 3300053136 Bacteria 978
361 Ga0500568_0330120 3300053139 Bacteria 553
362 Ga0500577_0011056 3300053142 Bacteria 2680
363 Ga0590074_012329 3300059423 Bacteria 1438
364 2511123437 2510917020 Bacteria 5657507
365 2643925061 2643221583 Bacteria 5218014
366 Ga0495641_0099111
367 MRS1b_contig_2612244
368 LJQas_1000328
369 JGI24751J29686_10000009
370 JGI24751J29686_10000037
371 JGI25165J46597_1000010
372 rootH1_10384735
373 Ga0065714_10123262
374 Ga0065714_10212097
375 Ga0065712_10008068
376 Ga0065712_10026790
377 Ga0065712_10071969
378 Ga0065715_10009627
379 Ga0065715_10062092
380 Ga0065707_10208139
381 Ga0070683_100004045
382 Ga0070670_100001122
383 Ga0070670_100002674
384 Ga0070670_100031468
385 Ga0070670_100074534
386 Ga0070670_100462825
387 Ga0070666_10408006
388 Ga0070666_10599440
389 Ga0070680_100000022
390 Ga0070680_100352828
391 Ga0070689_100053645
392 Ga0070689_100203974
393 Ga0070687_100145565
394 Ga0070661_100013161
395 Ga0070669_100005967
396 Ga0070669_100647629
397 Ga0070675_100064677
398 Ga0070675_101078615
399 Ga0070671_100433908
400 Ga0070671_100728828
401 Ga0070674_101780401
402 Ga0070673_100450689
403 Ga0070673_101375286
404 Ga0070667_101775864
405 Ga0070714_101048684
406 Ga0070701_10029212
407 Ga0070705_100007519
408 Ga0070705_100678516
409 Ga0070700_100000063
410 Ga0070700_100059112
411 Ga0070700_100532330
412 Ga0070694_100124326
413 Ga0070694_100437934
414 Ga0070694_100904165
415 Ga0070708_100003555
416 Ga0070662_100288287
417 Ga0070662_100732441
418 Ga0068867_100463271
419 Ga0070685_10160622
420 Ga0070685_10783106
421 Ga0070706_100012681
422 Ga0070707_100181922
423 Ga0070707_100567832
424 Ga0070698_100000325
425 Ga0070698_100019620
426 Ga0070698_100030991
427 Ga0070699_100223059
428 Ga0070699_100655707
429 Ga0070679_100569686
430 Ga0070684_100002136
431 Ga0068853_100811058
432 Ga0070672_100188460
433 Ga0070672_100242928
434 Ga0070672_101174923
435 Ga0070686_100758034
436 Ga0070695_100311779
437 Ga0070696_100072740
438 Ga0070693_100059454
439 Ga0070693_100341867
440 Ga0070664_100000607
441 Ga0068857_100164470
442 Ga0068857_100637043
443 Ga0068854_100247201
444 Ga0068854_100296028
445 Ga0068856_101351126
446 Ga0070702_100015359
447 Ga0068859_100059405
448 Ga0068859_100339062
449 Ga0068859_100884346
450 Ga0068859_100970743
451 Ga0068859_101157243
452 Ga0068859_101219862
453 Ga0068864_100191377
454 Ga0068864_100326094
455 Ga0068864_100745408
456 Ga0068864_100886168
457 Ga0068864_101278450
458 Ga0068861_100245680
459 Ga0068861_100286723
460 Ga0068863_100090432
461 Ga0068863_100385796
462 Ga0068858_100000102
463 Ga0068858_100198469
464 Ga0068858_100372636
465 Ga0068858_100502533
466 Ga0068860_100107188
467 Ga0068860_100121315
468 Ga0068860_100188515
469 Ga0068860_100387454
470 Ga0068860_100920874
471 Ga0068862_100352321
472 Ga0068862_100416276
473 Ga0068862_100794713
474 Ga0097621_100082946
475 Ga0075428_100846397
476 Ga0075431_101547305
477 Ga0075433_10326952
478 Ga0097620_100059405
479 Ga0097620_100339091
480 Ga0097620_100884315
481 Ga0097620_100970806
482 Ga0097620_101157244
483 Ga0097620_101219924
484 Ga0099794_10000018
485 Ga0099794_10179858
486 Ga0105251_10146490
487 Ga0105251_10587437
488 Ga0105240_10237223
489 Ga0111539_10002551
490 Ga0111539_12259218
491 Ga0105245_11026188
492 Ga0105247_10003791
493 Ga0114129_10176962
494 Ga0114129_10251934
495 Ga0114129_12118279
496 Ga0105243_10140293
497 Ga0105243_11370609
498 Ga0105241_10008531
499 Ga0105242_10090086
500 Ga0105242_11017400
501 Ga0105248_10069373
502 Ga0105248_10277038
503 Ga0105248_10338545
504 Ga0105248_10908955
505 Ga0105248_11254903
506 Ga0105238_10005386
507 Ga0105249_10066020
508 Ga0105239_11878149
509 Ga0105239_11960529
510 Ga0105246_11164674
511 Ga0157373_10005903
512 Ga0157373_10626343
513 Ga0157374_10327503
514 Ga0157378_10018754
515 Ga0157378_11418200
516 Ga0163162_10004046
517 Ga0163162_10451664
518 Ga0157372_10464175
519 Ga0157375_10006029
520 Ga0157375_11202960
521 Ga0157375_11636622
522 Ga0163163_10000986
523 Ga0163163_10029228
524 Ga0163163_11051110
525 Ga0157380_10005263
526 Ga0157380_10190650
527 Ga0157380_10335337
528 Ga0157380_10401870
529 Ga0157380_10885683
530 Ga0157377_10717500
531 Ga0157379_10122291
532 Ga0157379_10445928
533 Ga0157376_10947472
534 Ga0157376_11023325
535 Ga0163161_10036945
536 Ga0209437_101271
537 Ga0209233_1000044
538 Ga0207697_10082411
539 Ga0207713_1199019
540 Ga0207682_10262589
541 Ga0207710_10003697
542 Ga0207688_10209117
543 Ga0207680_10382757
544 Ga0207647_10159489
545 Ga0207643_10107527
546 Ga0207654_10155306
547 Ga0207654_10992177
548 Ga0207671_10310753
549 Ga0207660_10000004
550 Ga0207662_10072858
551 Ga0207649_10324730
552 Ga0207649_11316772
553 Ga0207652_10514838
554 Ga0207646_10492314
555 Ga0207681_10029354
556 Ga0207681_10098916
557 Ga0207694_10023715
558 Ga0207650_10000001
559 Ga0207650_10013351
560 Ga0207650_10104027
561 Ga0207650_10267379
562 Ga0207650_10353951
563 Ga0207659_10066129
564 Ga0207659_10387444
565 Ga0207687_10793104
566 Ga0207644_10303996
567 Ga0207644_11595064
568 Ga0207690_10193465
569 Ga0207706_10281622
570 Ga0207686_10069230
571 Ga0207686_11224592
572 Ga0207709_10230988
573 Ga0207709_10633322
574 Ga0207709_11268651
575 Ga0207670_10015228
576 Ga0207670_10028542
577 Ga0207669_10302165
578 Ga0207704_10849212
579 Ga0207691_10124340
580 Ga0207691_10200309
581 Ga0207691_10584548
582 Ga0207711_10052923
583 Ga0207711_10324775
584 Ga0207711_10354008
585 Ga0207711_10614172
586 Ga0207689_10122456
587 Ga0207689_10293396
588 Ga0207661_10014677
589 Ga0207679_10027893
590 Ga0207651_10030116
591 Ga0207651_10105570
592 Ga0207640_10357517
593 Ga0207640_10731107
594 Ga0207640_10898860
595 Ga0207677_10264870
596 Ga0207677_10277095
597 Ga0207703_10000190
598 Ga0207703_10359080
599 Ga0207703_10847960
600 Ga0207639_10651817
601 Ga0207678_10111476
602 Ga0207708_10000078
603 Ga0207708_10016199
604 Ga0207702_11265582
605 Ga0207641_10084441
606 Ga0207641_11603433
607 Ga0207648_10191894
608 Ga0207676_10206053
609 Ga0207676_10217536
610 Ga0207676_11443408
611 Ga0207676_11790094
612 Ga0207674_10207454
613 Ga0207674_10919451
614 Ga0207674_11465282
615 Ga0207675_100064979
616 Ga0207675_100264510
617 Ga0207675_100272138
618 Ga0207675_100497595
619 Ga0207675_100511942
620 Ga0209588_1000411
621 Ga0207428_10000915
622 Ga0268265_10327505
623 Ga0268265_10773454
624 Ga0268264_10175016
625 Ga0307513_10011493
626 Ga0307513_10226301
627 Ga0307408_100233306
628 Ga0307408_100257609
629 Ga0307508_10024773
630 Ga0307405_10011647
631 Ga0307405_10666642
632 Ga0307405_10903096
633 Ga0307413_11190335
634 Ga0307410_10674214
635 Ga0307406_10000691
636 Ga0307406_10065090
637 Ga0307406_10074675
638 Ga0307406_10280155
639 Ga0307407_10138042
640 Ga0307407_10331226
641 Ga0307409_100041084
642 Ga0307409_100055419
643 Ga0307416_100007410
644 Ga0307416_100111853
645 Ga0307416_100178503
646 Ga0307411_10014803
647 Ga0307411_10804290
648 Ga0307415_100039976
649 Ga0307415_101286216
650 Ga0373944_0031037
651 Ga0373949_0089534
652 Ga0373951_0003494
653 Ga0373951_0043332
654 Ga0373941_0290467
655 Ga0373945_0041976
656 Ga0373956_0066720
657 Ga0373957_0522329
658 Ga0373943_0043459
659 Ga0373946_0008490
660 Ga0373955_0029042
661 Ga0373924_0003891
662 Ga0373935_0031759
663 Ga0373947_0114719
664 Ga0373937_0288574
665 Ga0373925_0004777
666 Ga0395900_1492235
667 Ga0395905_1291225
668 Ga0436365_1302123
669 Ga0439436_0049975
670 Ga0439431_0150652
671 Ga0439435_0056665
672 Ga0466965_0446582
673 Ga0466963_0381000
674 Ga0466960_0017944
675 Ga0451576_0637560
676 Ga0495592_0846023
677 Ga0495580_0428436
678 Ga0495662_0016458
679 Ga0495628_0944431
680 Ga0495630_0776127
681 Ga0495663_0092466
682 Ga0495666_0095058
683 Ga0495621_0091592
684 Ga0495668_0000559
685 Ga0495625_0000064
686 Ga0495635_0808919
687 Ga0495658_0185752
688 Ga0495613_0041692
689 Ga0495613_0167455
690 Ga0495636_0288279
691 Ga0495680_0752815
692 Ga0495673_0000039
693 Ga0495686_0066222
694 Ga0495615_0159540
695 Ga0496101_0424240
696 Ga0496104_0001279
697 Ga0496104_0267296
698 Ga0496105_0166520
699 Ga0496108_0001898
700 Ga0496108_0049031
701 Ga0496109_0002303
702 Ga0496109_0026491
703 Ga0496109_0640536
704 Ga0496110_0014175
705 Ga0496110_0098060
706 Ga0496111_0001557
707 Ga0496111_0226623
708 Ga0496112_0004205
709 Ga0496112_0421891
710 Ga0496112_0666220
711 Ga0496113_0137352
712 Ga0496113_0332503
713 Ga0496114_0539986
714 Ga0496114_1380105
715 Ga0496115_0674389
716 Ga0501067_0366488
717 Ga0501073_0133035
718 Ga0501257_044677
719 nmdc:mga05p37_10868_c1
720 nmdc:mga05p37_88811_c1
721 nmdc:mga08y16_12618_c1
722 nmdc:mga0a205_289644_c1
723 Ga0500595_117111
724 Ga0500658_0009506
725 Ga0500559_0186131
726 Ga0500568_0330120
727 Ga0500577_0011056
728 Ga0590074_012329
729 2511123437
730 2643925061

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06841

Phage_T4_gp19

T4-like virus tail tube protein gp19

32

174

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hkh-assembly4.cif.gz_E structure of the hcp1 protein from e. coli eaec 042 pathovar, mutants n93w-s158w 0.6329 15 153
5xeu-assembly1.cif.gz_B crystal structure of hcp2 from salmonella typhimurium 0.6119 20 152
4hkh-assembly2.cif.gz_B structure of the hcp1 protein from e. coli eaec 042 pathovar, mutants n93w-s158w 0.5955 17 153
8gra-assembly1.cif.gz_E structure of type vi secretion system cargo delivery vehicle hcp-vgrg-paar 0.5909 18 155
4hkh-assembly5.cif.gz_F structure of the hcp1 protein from e. coli eaec 042 pathovar, mutants n93w-s158w 0.5845 15 153
ID Description Score Start End Superfamily
af_Q9VF86_1_117_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.7546 100 119 3.30.420.40
af_A0A1D6PYJ6_120_236_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.6648 98 119 3.30.420.10
4e1jB01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.659 100 130 3.30.420.40
af_D3ZII5_690_773_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6584 10 118 2.60.40.10
af_F4JL70_85_367_3.90.70.10 Alpha Beta;Alpha-Beta Complex;Cathepsin B; Chain A;Cysteine proteinases 0.6463 13 37 3.90.70.10
ID Description Score Start End GO Terms
AF-A0A4Q3J232-F1-model_v4 Phage tail protein 0.7248 70 152 GO:0005198
AF-A0A426U0G8-F1-model_v4 Phage tail protein 0.7195 16 153 GO:0005198
AF-A0A3B8ITL9-F1-model_v4 Phage tail protein 0.7123 68 153 GO:0005198
AF-A0A352X8L7-F1-model_v4 Phage tail protein 0.7083 71 153 GO:0005198
AF-A0A843S3J5-F1-model_v4 Phage tail protein 0.7082 6 155 GO:0005198

Map