F423688

General Info

Members Datasets Scaffolds Average Seq Length
365 234 347 328

Family's Representative Sequence

Representative Sequence 3300014497|Ga0182008_10113306|Ga0182008_101133061
Length 344
Sequence MDPDVHHPSRRHTVPQASQHRRALLVRTCLIAWCATLPGLAGAQQSWPQKPVTIVVPFPPGGATDMVARALGESLTRSLGQPVLVESRPGAGTTVGADYVAKSKADGYTLLMGAVHHTIAPSVYKKLPYDFQKDLTPITTVAMVPNVLVVNAALTPAKTVAELVALAKTANPPLSYGSNGNGTAQHLIGTLFQLRTETTLLHVPYKGSAPLTTDLLGGQVTMSFDSVPPTVQHIKSGKLRALAVATKTRASMLPDVPTMEEAGLPDFTIETWYGVLAPTGTPRDVITKLNTEMLKVIKSSEFAQRMRDSGAEPLGGTPADMALRISEETAKFAKIVKDGKVALE

Samples

Sample ID Description Type Environment
1 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
2 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
3 2643221658 Variovorax sp. Root411 Isolate Unclassified
4 2643221660 Methylibium sp. Root1272 Isolate Unclassified
5 2643221672 Variovorax sp. Root434 Isolate Unclassified
6 2738541307 Variovorax sp. GV008 Isolate Unclassified
7 2831864461 Roseateles noduli HZ7 Isolate Nodule
8 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
9 2842733646 Variovorax sp. R-72446 Isolate Unclassified
10 2842747753 Variovorax sp. R-72060 Isolate Unclassified
11 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
12 2885198086 Variovorax sp. 679 Isolate Unclassified
13 2885211737 Variovorax sp. 553 Isolate Unclassified
14 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
15 2904456579 Variovorax sp. 2002 Isolate Unclassified
16 2928070936 Variovorax gossypii 1167 Isolate Unclassified
17 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
18 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
19 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
20 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
21 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
22 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
23 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
24 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
25 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
26 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
27 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
28 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
29 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
30 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
31 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
32 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
33 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
34 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
35 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
36 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
37 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
38 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
39 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
40 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
41 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
42 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
43 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
44 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
45 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
46 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
47 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
48 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
49 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
50 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
51 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
52 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
53 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
54 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
55 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
56 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
57 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
58 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
59 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
73 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
74 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
75 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
76 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
77 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
78 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
84 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
100 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
103 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
104 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
105 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
108 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
111 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
113 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
116 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
152 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
154 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
155 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
156 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
157 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
158 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
159 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
160 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
161 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
162 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
163 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
164 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
165 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
166 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
167 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
168 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
169 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
170 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
171 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
172 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
173 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
174 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
175 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
176 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
177 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
178 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
179 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
180 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
181 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
182 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
183 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
184 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
185 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
186 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
187 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
188 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
189 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
190 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
191 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
192 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
193 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
194 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
195 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
198 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
199 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
200 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
201 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
202 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
203 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
204 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
205 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
206 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
207 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
208 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
209 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
215 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
216 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
217 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
218 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
219 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
220 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
221 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
222 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
223 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
224 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
225 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
226 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
227 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
228 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
229 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
230 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
231 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
232 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
233 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
234 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.52
Metatranscriptomes 0.55
Isolates 4.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 29.86
Nodule 0.82
Rhizoplane 1.64
Rhizosphere 56.71
Stem 0
Stem Tuber 0
Unclassified 10.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10003055 3300001989 Bacteria 6392
2 JGI25150J39212_1000774 3300002774 Bacteria 11001
3 JGI25159J45721_1008727 3300002987 Bacteria 2753
4 JGI25151J46595_10032439 3300003187 Bacteria 2024
5 JGI25153J46596_10003295 3300003215 Bacteria 9072
6 JGI25153J46596_10032573 3300003215 Bacteria 1736
7 rootL2_10000045 3300003322 Bacteria 87911
8 rootL2_10030538 3300003322 Bacteria 1892
9 JGI25160J50197_1010977 3300003354 Bacteria 3243
10 JGI25161J50226_1006217 3300003374 Bacteria 2195
11 JGI25161J50226_1011737 3300003374 Bacteria 1086
12 Ga0006562J51391_1051819 3300003578 Bacteria 16990
13 Ga0006562J51391_1051821 3300003578 Bacteria 5720
14 Ga0055525_1000084 3300003759 Bacteria 155319
15 Ga0055526_1005428 3300003771 Bacteria 7331
16 Ga0055526_1008514 3300003771 Bacteria 5103
17 Ga0055526_1011310 3300003771 Bacteria 4039
18 Ga0055537_1000013 3300003773 Bacteria 133522
19 Ga0055524_1012406 3300003775 Bacteria 3272
20 Ga0055536_1000501 3300003781 Bacteria 27098
21 Ga0055536_1006926 3300003781 Bacteria 5165
22 Ga0055534_1000008 3300003784 Bacteria 211098
23 Ga0055534_1000438 3300003784 Bacteria 24605
24 Ga0055534_1008815 3300003784 Bacteria 2250
25 Ga0055528_1000202 3300003790 Bacteria 50260
26 Ga0055530_10006132 3300003791 Bacteria 5461
27 Ga0055540_1000683 3300003792 Bacteria 23509
28 Ga0055540_1006010 3300003792 Bacteria 4919
29 Ga0055531_10009765 3300003794 Bacteria 4866
30 Ga0055531_10024190 3300003794 Bacteria 2250
31 Ga0055531_10024298 3300003794 Bacteria 2241
32 Ga0055543_1001687 3300004625 Bacteria 8356
33 Ga0055543_1002669 3300004625 Bacteria 5729
34 Ga0065165_1000070 3300005262 Bacteria 168230
35 Ga0065165_1013689 3300005262 Bacteria 3205
36 Ga0065714_10003735 3300005288 Bacteria 13821
37 Ga0065712_10139830 3300005290 Bacteria 1460
38 Ga0065715_10097422 3300005293 Bacteria 3707
39 Ga0070658_10044651 3300005327 Bacteria 3581
40 Ga0070670_100000525 3300005331 Bacteria 30765
41 Ga0070670_100017751 3300005331 Bacteria 6106
42 Ga0070670_100046290 3300005331 Bacteria 3740
43 Ga0068869_100145039 3300005334 Bacteria 1837
44 Ga0070682_100359469 3300005337 Bacteria 1088
45 Ga0070661_100000641 3300005344 Bacteria 25944
46 Ga0070668_100217379 3300005347 Bacteria 1575
47 Ga0070668_100317904 3300005347 Bacteria 1310
48 Ga0070669_100005196 3300005353 Bacteria 9419
49 Ga0070669_100006496 3300005353 Bacteria 8419
50 Ga0070669_100008269 3300005353 Bacteria 7427
51 Ga0070669_100013864 3300005353 Bacteria 5730
52 Ga0070675_100001327 3300005354 Bacteria 18094
53 Ga0070675_100023424 3300005354 Bacteria 4937
54 Ga0070675_100335362 3300005354 Bacteria 1338
55 Ga0070671_100041906 3300005355 Bacteria 3805
56 Ga0070671_100106538 3300005355 Bacteria 2353
57 Ga0070674_100002887 3300005356 Bacteria 9511
58 Ga0070674_100003198 3300005356 Bacteria 9135
59 Ga0070674_100026815 3300005356 Bacteria 3768
60 Ga0070674_100173335 3300005356 Bacteria 1647
61 Ga0070673_100001093 3300005364 Bacteria 15509
62 Ga0070673_100004659 3300005364 Bacteria 8706
63 Ga0070673_100010342 3300005364 Bacteria 6313
64 Ga0070673_100116312 3300005364 Bacteria 2224
65 Ga0070667_100093062 3300005367 Bacteria 2595
66 Ga0070667_100128795 3300005367 Bacteria 2208
67 Ga0070663_100209526 3300005455 Bacteria 1525
68 Ga0070678_100023434 3300005456 Bacteria 4113
69 Ga0070678_100119285 3300005456 Bacteria 2077
70 Ga0070662_100055854 3300005457 Bacteria 2865
71 Ga0070662_100060133 3300005457 Bacteria 2769
72 Ga0070662_100095425 3300005457 Bacteria 2241
73 Ga0068867_100003837 3300005459 Bacteria 10561
74 Ga0068867_100004161 3300005459 Bacteria 10177
75 Ga0068867_100241182 3300005459 Bacteria 1466
76 Ga0070685_10093265 3300005466 Bacteria 1826
77 Ga0070672_100176373 3300005543 Bacteria 1779
78 Ga0070693_100019691 3300005547 Bacteria 3544
79 Ga0070665_100426036 3300005548 Bacteria 1336
80 Ga0068857_100003633 3300005577 Bacteria 12926
81 Ga0068854_100088920 3300005578 Bacteria 2294
82 Ga0068852_100017140 3300005616 Bacteria 5675
83 Ga0068852_100037656 3300005616 Bacteria 4058
84 Ga0068864_100044185 3300005618 Bacteria 3818
85 Ga0068864_100120673 3300005618 Bacteria 2344
86 Ga0068861_100005174 3300005719 Bacteria 8799
87 Ga0068851_10024368 3300005834 Bacteria 2962
88 Ga0068870_10013582 3300005840 Bacteria 3832
89 Ga0068870_10030450 3300005840 Bacteria 2727
90 Ga0068870_10158275 3300005840 Bacteria 1341
91 Ga0068863_100064881 3300005841 Bacteria 3454
92 Ga0068858_100017041 3300005842 Bacteria 6819
93 Ga0068858_100117046 3300005842 Bacteria 2491
94 Ga0075365_10011619 3300006038 Bacteria 5188
95 Ga0075365_10123156 3300006038 Bacteria 1790
96 Ga0075363_100019798 3300006048 Bacteria 3369
97 Ga0075363_100026518 3300006048 Bacteria 2965
98 Ga0075363_100037006 3300006048 Bacteria 2561
99 Ga0075364_10030489 3300006051 Bacteria 3461
100 Ga0075432_10009762 3300006058 Bacteria 3265
101 Ga0075362_10004746 3300006177 Bacteria 4908
102 Ga0075362_10013233 3300006177 Bacteria 3299
103 Ga0075367_10019631 3300006178 Bacteria 3750
104 Ga0075366_10001709 3300006195 Bacteria 11032
105 Ga0075366_10063178 3300006195 Bacteria 2200
106 Ga0075366_10132141 3300006195 Bacteria 1506
107 Ga0097621_100056406 3300006237 Bacteria 3210
108 Ga0097621_100111069 3300006237 Bacteria 2316
109 Ga0075370_10002998 3300006353 Bacteria 7950
110 Ga0075370_10004762 3300006353 Bacteria 6638
111 Ga0075429_100130999 3300006880 Bacteria 2193
112 Ga0068865_100054673 3300006881 Bacteria 2775
113 Ga0068865_100117864 3300006881 Bacteria 1969
114 Ga0099826_10011512 3300006948 Bacteria 6656
115 Ga0105244_10008617 3300009036 Bacteria 6350
116 Ga0105245_10018671 3300009098 Bacteria 6067
117 Ga0105243_10005295 3300009148 Bacteria 10084
118 Ga0105243_10024338 3300009148 Bacteria 4617
119 Ga0105241_10182873 3300009174 Bacteria 1740
120 Ga0105237_10014620 3300009545 Bacteria 8200
121 Ga0105249_10005435 3300009553 Bacteria 10999
122 Ga0105249_10354202 3300009553 Bacteria 1488
123 Ga0105239_10030308 3300010375 Bacteria 5947
124 Ga0105246_10043766 3300011119 Bacteria 3039
125 Ga0105246_10055765 3300011119 Bacteria 2729
126 Ga0105246_10083702 3300011119 Bacteria 2280
127 Ga0157373_10004080 3300013100 Bacteria 11001
128 Ga0157373_10071300 3300013100 Bacteria 2454
129 Ga0157370_10054014 3300013104 Bacteria 3830
130 Ga0157375_10057611 3300013308 Bacteria 3841
131 Ga0157375_10145519 3300013308 Bacteria 2500
132 Ga0157380_10030270 3300014326 Bacteria 4145
133 Ga0182008_10007352 3300014497 Bacteria 6087
134 Ga0182008_10008258 3300014497 Bacteria 5691
135 Ga0182008_10011292 3300014497 Bacteria 4758
136 Ga0182008_10113306 3300014497 Bacteria 1344
137 Ga0157377_10047682 3300014745 Bacteria 2401
138 Ga0157376_10099307 3300014969 Bacteria 2539
139 Ga0182006_1000688 3300015261 Bacteria 23576
140 Ga0182006_1005313 3300015261 Bacteria 6155
141 Ga0182007_10010974 3300015262 Bacteria 3549
142 Ga0163161_10001990 3300017792 Bacteria 14811
143 Ga0163161_10062685 3300017792 Bacteria 2709
144 Ga0209436_105458 3300025208 Bacteria 2924
145 Ga0207425_1000734 3300025245 Bacteria 17259
146 Ga0209129_1000391 3300025258 Bacteria 35251
147 Ga0209129_1003177 3300025258 Bacteria 7348
148 Ga0209565_1000042 3300025263 Bacteria 239712
149 Ga0209673_1000071 3300025273 Bacteria 239966
150 Ga0209673_1000556 3300025273 Bacteria 59978
151 Ga0209673_1004447 3300025273 Bacteria 7503
152 Ga0209673_1013105 3300025273 Bacteria 3297
153 Ga0209130_1000396 3300025284 Bacteria 47595
154 Ga0209675_1000041 3300025291 Bacteria 239712
155 Ga0209675_1000050 3300025291 Bacteria 212222
156 Ga0209675_1000728 3300025291 Bacteria 22383
157 Ga0209676_1000053 3300025292 Bacteria 370111
158 Ga0209676_1000074 3300025292 Bacteria 305770
159 Ga0209676_1001070 3300025292 Bacteria 31221
160 Ga0209025_1000093 3300025294 Bacteria 241788
161 Ga0209025_1000349 3300025294 Bacteria 100055
162 Ga0209025_1000402 3300025294 Bacteria 88054
163 Ga0209025_1026629 3300025294 Bacteria 2895
164 Ga0209025_1030114 3300025294 Bacteria 2606
165 Ga0209564_1000005 3300025295 Bacteria 1147192
166 Ga0209564_1000158 3300025295 Bacteria 164425
167 Ga0209564_1000224 3300025295 Bacteria 126345
168 Ga0209564_1000294 3300025295 Bacteria 100958
169 Ga0209758_1000039 3300025297 Bacteria 428951
170 Ga0209758_1000057 3300025297 Bacteria 333111
171 Ga0209050_1000015 3300025298 Bacteria 759102
172 Ga0209050_1001168 3300025298 Bacteria 31092
173 Ga0209256_1000230 3300025299 Bacteria 100958
174 Ga0207426_1000108 3300025302 Bacteria 242257
175 Ga0209051_1000010 3300025303 Bacteria 641298
176 Ga0209051_1000175 3300025303 Bacteria 116040
177 Ga0209051_1000370 3300025303 Bacteria 64642
178 Ga0209051_1000453 3300025303 Bacteria 54338
179 Ga0209051_1023348 3300025303 Bacteria 2574
180 Ga0209051_1026708 3300025303 Bacteria 2320
181 Ga0209257_1000026 3300025304 Bacteria 723225
182 Ga0209257_1000582 3300025304 Bacteria 61499
183 Ga0209257_1002309 3300025304 Bacteria 19281
184 Ga0207655_1007327 3300025728 Bacteria 7168
185 Ga0207682_10000503 3300025893 Bacteria 17981
186 Ga0207680_10013061 3300025903 Bacteria 4252
187 Ga0207645_10003708 3300025907 Bacteria 11507
188 Ga0207645_10006140 3300025907 Bacteria 8631
189 Ga0207645_10120437 3300025907 Bacteria 1703
190 Ga0207643_10018051 3300025908 Bacteria 3864
191 Ga0207643_10045587 3300025908 Bacteria 2477
192 Ga0207662_10039679 3300025918 Bacteria 2763
193 Ga0207657_10097660 3300025919 Bacteria 2442
194 Ga0207657_10100057 3300025919 Bacteria 2407
195 Ga0207649_10001339 3300025920 Bacteria 14649
196 Ga0207681_10009414 3300025923 Bacteria 5969
197 Ga0207681_10030754 3300025923 Bacteria 3502
198 Ga0207650_10000412 3300025925 Bacteria 38116
199 Ga0207659_10002853 3300025926 Bacteria 10298
200 Ga0207690_10277083 3300025932 Bacteria 1305
201 Ga0207706_10004383 3300025933 Bacteria 13264
202 Ga0207706_10123752 3300025933 Bacteria 2275
203 Ga0207706_10179722 3300025933 Bacteria 1858
204 Ga0207709_10005081 3300025935 Bacteria 7509
205 Ga0207709_10056798 3300025935 Bacteria 2424
206 Ga0207669_10042306 3300025937 Bacteria 2658
207 Ga0207691_10002289 3300025940 Bacteria 18742
208 Ga0207691_10017932 3300025940 Bacteria 6707
209 Ga0207689_10002337 3300025942 Bacteria 17752
210 Ga0207689_10082574 3300025942 Bacteria 2642
211 Ga0207679_10000168 3300025945 Bacteria 54187
212 Ga0207679_10021088 3300025945 Bacteria 4409
213 Ga0207679_10295164 3300025945 Bacteria 1395
214 Ga0207679_10295646 3300025945 Bacteria 1394
215 Ga0207651_10004206 3300025960 Bacteria 7211
216 Ga0207651_10075496 3300025960 Bacteria 2405
217 Ga0207651_10285589 3300025960 Bacteria 1366
218 Ga0207651_10318414 3300025960 Bacteria 1299
219 Ga0207712_10047421 3300025961 Bacteria 2983
220 Ga0207712_10243962 3300025961 Bacteria 1448
221 Ga0207668_10206925 3300025972 Bacteria 1567
222 Ga0207677_10019283 3300026023 Bacteria 4116
223 Ga0207677_10115094 3300026023 Bacteria 2011
224 Ga0207703_10096658 3300026035 Bacteria 2494
225 Ga0207678_10024090 3300026067 Bacteria 5318
226 Ga0207678_10229809 3300026067 Bacteria 1588
227 Ga0207708_10120009 3300026075 Bacteria 2048
228 Ga0207648_10008143 3300026089 Bacteria 10194
229 Ga0207648_10013904 3300026089 Bacteria 7464
230 Ga0207648_10255783 3300026089 Bacteria 1562
231 Ga0207676_10229599 3300026095 Bacteria 1658
232 Ga0207676_10336701 3300026095 Bacteria 1390
233 Ga0207674_10015077 3300026116 Bacteria 8508
234 Ga0207674_10555369 3300026116 Bacteria 1109
235 Ga0207675_100001054 3300026118 Bacteria 27326
236 Ga0207683_10101944 3300026121 Bacteria 2563
237 Ga0207683_10184600 3300026121 Bacteria 1892
238 Ga0207683_10322487 3300026121 Bacteria 1415
239 Ga0207698_10074370 3300026142 Bacteria 2710
240 Ga0209968_1000274 3300027526 Bacteria 8876
241 Ga0209970_1000271 3300027614 Bacteria 8541
242 Ga0209282_1013071 3300027666 Bacteria 5284
243 Ga0209966_1000126 3300027695 Bacteria 33281
244 Ga0207428_10057491 3300027907 Bacteria 3087
245 Ga0307517_10000122 3300028786 Bacteria 116429
246 Ga0307515_10000893 3300028794 Bacteria 68669
247 Ga0307515_10038072 3300028794 Bacteria 7708
248 Ga0307515_10310084 3300028794 Bacteria 1254
249 Ga0307512_10171014 3300030522 Bacteria 1246
250 Ga0316179_1084965 3300030734 Bacteria 2293
251 Ga0316178_1158591 3300030735 Bacteria 2719
252 Ga0316181_1011138 3300030744 Bacteria 3313
253 Ga0316182_1330503 3300030745 Bacteria 1799
254 Ga0307408_100002421 3300031548 Bacteria 13124
255 Ga0307408_100172916 3300031548 Bacteria 1726
256 Ga0307508_10006278 3300031616 Bacteria 11192
257 Ga0307516_10003774 3300031730 Bacteria 19253
258 Ga0307516_10008598 3300031730 Bacteria 11521
259 Ga0307516_10232750 3300031730 Bacteria 1545
260 Ga0307410_10008358 3300031852 Bacteria 5735
261 Ga0307410_10110063 3300031852 Bacteria 1992
262 Ga0307406_10000764 3300031901 Bacteria 18043
263 Ga0307406_10081038 3300031901 Bacteria 2157
264 Ga0307412_10008681 3300031911 Bacteria 5811
265 Ga0307412_10096747 3300031911 Bacteria 2078
266 Ga0307416_100028450 3300032002 Bacteria 4156
267 Ga0307416_100419413 3300032002 Bacteria 1382
268 Ga0307414_10008452 3300032004 Bacteria 5837
269 Ga0439449_0001607 3300042007 Bacteria 8856
270 Ga0450920_015800 3300042122 Bacteria 1437
271 Ga0450896_010863 3300042133 Bacteria 1279
272 Ga0450910_006733 3300042147 Bacteria 1592
273 Ga0450908_010914 3300042184 Bacteria 1668
274 Ga0439434_0001296 3300042435 Bacteria 7199
275 Ga0439464_0004504 3300042439 Bacteria 3567
276 Ga0439460_0037496 3300042461 Bacteria 1410
277 Ga0451577_0385957 3300042876 Bacteria 1271
278 Ga0453684_0120443 3300044712 Bacteria 3170
279 Ga0495638_0049753 3300046460 Bacteria 2619
280 Ga0495610_0040274 3300046512 Bacteria 2357
281 Ga0495616_0098686 3300046513 Bacteria 1372
282 Ga0495620_0041368 3300046515 Bacteria 2022
283 Ga0495631_0000499 3300046518 Bacteria 26211
284 Ga0495632_0027866 3300046519 Bacteria 2953
285 Ga0495632_0074598 3300046519 Bacteria 1625
286 Ga0495654_0078390 3300046530 Bacteria 1553
287 Ga0495621_0035931 3300046539 Bacteria 1717
288 Ga0495621_0059279 3300046539 Bacteria 1386
289 Ga0495597_0001779 3300046542 Bacteria 14802
290 Ga0495658_0017433 3300046683 Bacteria 3709
291 Ga0495670_0076745 3300046691 Bacteria 1698
292 Ga0495660_0044123 3300046810 Bacteria 2455
293 Ga0495676_0013707 3300047321 Bacteria 7273
294 Ga0495686_0002373 3300047472 Bacteria 17940
295 Ga0495614_0017332 3300048089 Bacteria 3129
296 Ga0496102_0008203 3300048905 Bacteria 8940
297 Ga0496103_0218498 3300048906 Bacteria 1226
298 Ga0496104_0192032 3300048907 Bacteria 1954
299 Ga0496107_0220513 3300048910 Bacteria 1411
300 Ga0496108_0085224 3300048911 Bacteria 2682
301 Ga0496114_0164961 3300048917 Bacteria 1928
302 Ga0496116_0017597 3300048919 Bacteria 5539
303 Ga0496117_0077404 3300048920 Bacteria 2201
304 Ga0496118_0014062 3300048921 Bacteria 7514
305 Ga0496118_0014566 3300048921 Bacteria 7352
306 Ga0496119_0084206 3300048922 Bacteria 1824
307 Ga0496121_0011410 3300048924 Bacteria 9871
308 Ga0496122_0000039 3300048925 Bacteria 295352
309 Ga0496122_0000450 3300048925 Bacteria 85686
310 Ga0496123_0000026 3300048926 Bacteria 318040
311 Ga0496123_0000176 3300048926 Bacteria 130010
312 Ga0496124_0022345 3300048927 Bacteria 5799
313 Ga0496124_0022429 3300048927 Bacteria 5787
314 Ga0496125_0026172 3300048928 Bacteria 5324
315 Ga0496125_0040431 3300048928 Bacteria 4001
316 Ga0501032_0120907 3300049569 Bacteria 1731
317 Ga0501043_0000009 3300049579 Bacteria 214823
318 Ga0501046_0000022 3300049580 Bacteria 215451
319 Ga0501047_0000021 3300049581 Bacteria 254841
320 Ga0501048_0000955 3300049582 Bacteria 21344
321 Ga0501241_006351 3300049758 Bacteria 2176
322 Ga0501045_0010969 3300049824 Bacteria 6347
323 nmdc:mga03683_10560_c1 3300050489 Bacteria 3315
324 nmdc:mga03683_406_c1 3300050489 Bacteria 2015
325 nmdc:mga00v17_27413_c1 3300050491 Bacteria 3326
326 nmdc:mga00v17_29514_c1 3300050491 Bacteria 3219
327 nmdc:mga0yw44_29625_c1 3300050492 Bacteria 3162
328 nmdc:mga0k408_74524_c1 3300050493 Bacteria 1983
329 nmdc:mga0k408_908_c1 3300050493 Bacteria 16172
330 nmdc:mga0k408_99088_c1 3300050493 Bacteria 1718
331 nmdc:mga06z11_215725_c1 3300050494 Bacteria 1120
332 nmdc:mga07m45_1339_c1 3300050496 Bacteria 11235
333 nmdc:mga07m45_56765_c1 3300050496 Bacteria 2214
334 nmdc:mga07m45_6770_c1 3300050496 Bacteria 5820
335 Ga0500583_0180220 3300053092 Bacteria 1052
336 Ga0500641_0110234 3300053096 Bacteria 1185
337 Ga0500571_000401 3300053110 Bacteria 17186
338 Ga0500592_006148 3300053116 Bacteria 1911
339 Ga0500597_092233 3300053120 Bacteria 1316
340 Ga0500607_040553 3300053121 Bacteria 2522
341 Ga0500608_049475 3300053122 Bacteria 2021
342 Ga0500559_0074087 3300053136 Bacteria 1537
343 Ga0500564_058292 3300053138 Bacteria 1755
344 Ga0500573_0052103 3300053140 Bacteria 2353
345 Ga0500574_002775 3300053141 Bacteria 2960
346 Ga0500622_0010333 3300053156 Bacteria 5129
347 Ga0500638_054481 3300053162 Bacteria 1929

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053122 Ga0500608_049475 Ga0500608_049475_1076_1915 279
2 3300048928 Ga0496125_0040431 Ga0496125_0040431_623_1516 296
3 3300031730 Ga0307516_10003774 Ga0307516_100037749 298
4 3300026116 Ga0207674_10555369 Ga0207674_105553691 301
5 3300050494 nmdc:mga06z11_215725_c1 nmdc:mga06z11_215725_c1_192_1097 301
6 3300028794 Ga0307515_10310084 Ga0307515_103100841 307
7 3300046512 Ga0495610_0040274 Ga0495610_0040274_755_1750 307
8 3300046515 Ga0495620_0041368 Ga0495620_0041368_536_1531 307
9 3300046519 Ga0495632_0027866 Ga0495632_0027866_1075_2070 307
10 3300048905 Ga0496102_0008203 Ga0496102_0008203_4834_5826 311
11 3300009553 Ga0105249_10354202 Ga0105249_103542022 312
12 3300025961 Ga0207712_10243962 Ga0207712_102439621 312
13 3300027526 Ga0209968_1000274 Ga0209968_10002748 312
14 3300027695 Ga0209966_1000126 Ga0209966_100012614 312
15 3300030522 Ga0307512_10171014 Ga0307512_101710142 313
16 3300046810 Ga0495660_0044123 Ga0495660_0044123_748_1728 313
17 3300046530 Ga0495654_0078390 Ga0495654_0078390_126_1070 314
18 3300006038 Ga0075365_10123156 Ga0075365_101231562 315
19 3300006048 Ga0075363_100037006 Ga0075363_1000370062 315
20 3300006051 Ga0075364_10030489 Ga0075364_100304895 315
21 3300006058 Ga0075432_10009762 Ga0075432_100097622 315
22 3300006177 Ga0075362_10004746 Ga0075362_100047463 315
23 3300027907 Ga0207428_10057491 Ga0207428_100574915 315
24 3300050489 nmdc:mga03683_10560_c1 nmdc:mga03683_10560_c1_624_1571 315
25 3300050491 nmdc:mga00v17_27413_c1 nmdc:mga00v17_27413_c1_2016_2963 315
26 3300005364 Ga0070673_100116312 Ga0070673_1001163122 316
27 3300005547 Ga0070693_100019691 Ga0070693_1000196912 316
28 3300006353 Ga0075370_10004762 Ga0075370_100047627 316
29 3300013104 Ga0157370_10054014 Ga0157370_100540142 316
30 3300014745 Ga0157377_10047682 Ga0157377_100476822 316
31 3300025258 Ga0209129_1003177 Ga0209129_10031773 316
32 3300025294 Ga0209025_1000402 Ga0209025_100040241 316
33 3300025942 Ga0207689_10082574 Ga0207689_100825742 316
34 3300048907 Ga0496104_0192032 Ga0496104_0192032_16_966 316
35 3300048910 Ga0496107_0220513 Ga0496107_0220513_267_1217 316
36 3300048911 Ga0496108_0085224 Ga0496108_0085224_1392_2342 316
37 3300048917 Ga0496114_0164961 Ga0496114_0164961_322_1272 316
38 3300006195 Ga0075366_10001709 Ga0075366_100017099 317
39 3300013308 Ga0157375_10057611 Ga0157375_100576111 317
40 3300042461 Ga0439460_0037496 Ga0439460_0037496_422_1375 317
41 3300050493 nmdc:mga0k408_908_c1 nmdc:mga0k408_908_c1_538_1536 317
42 3300005457 Ga0070662_100055854 Ga0070662_1000558543 320
43 3300025933 Ga0207706_10179722 Ga0207706_101797223 320
44 3300031616 Ga0307508_10006278 Ga0307508_1000627810 320
45 3300009148 Ga0105243_10024338 Ga0105243_100243385 321
46 3300011119 Ga0105246_10043766 Ga0105246_100437663 321
47 3300025294 Ga0209025_1026629 Ga0209025_10266293 321
48 3300031730 Ga0307516_10232750 Ga0307516_102327502 321
49 3300046460 Ga0495638_0049753 Ga0495638_0049753_1345_2391 321
50 3300046513 Ga0495616_0098686 Ga0495616_0098686_298_1344 321
51 3300046518 Ga0495631_0000499 Ga0495631_0000499_18016_19062 321
52 3300046539 Ga0495621_0035931 Ga0495621_0035931_295_1305 321
53 3300046691 Ga0495670_0076745 Ga0495670_0076745_124_1170 321
54 3300048922 Ga0496119_0084206 Ga0496119_0084206_391_1437 321
55 3300048924 Ga0496121_0011410 Ga0496121_0011410_3469_4479 321
56 3300050496 nmdc:mga07m45_56765_c1 nmdc:mga07m45_56765_c1_200_1165 321
57 3300053092 Ga0500583_0180220 Ga0500583_0180220_22_996 321
58 3300053116 Ga0500592_006148 Ga0500592_006148_55_1020 321
59 3300003794 Ga0055531_10024298 Ga0055531_100242982 322
60 3300005459 Ga0068867_100241182 Ga0068867_1002411822 322
61 3300014326 Ga0157380_10030270 Ga0157380_100302702 322
62 3300025292 Ga0209676_1000074 Ga0209676_100007452 322
63 3300025298 Ga0209050_1000015 Ga0209050_1000015418 322
64 3300025303 Ga0209051_1000010 Ga0209051_1000010418 322
65 3300025303 Ga0209051_1000175 Ga0209051_100017539 322
66 3300025304 Ga0209257_1000026 Ga0209257_1000026259 322
67 3300025304 Ga0209257_1002309 Ga0209257_100230918 322
68 3300026089 Ga0207648_10255783 Ga0207648_102557832 322
69 3300046683 Ga0495658_0017433 Ga0495658_0017433_1244_2254 322
70 3300047321 Ga0495676_0013707 Ga0495676_0013707_2740_3750 322
71 3300048089 Ga0495614_0017332 Ga0495614_0017332_1872_2882 322
72 3300049569 Ga0501032_0120907 Ga0501032_0120907_366_1334 322
73 3300049579 Ga0501043_0000009 Ga0501043_0000009_187310_188278 322
74 3300049580 Ga0501046_0000022 Ga0501046_0000022_187299_188267 322
75 3300049581 Ga0501047_0000021 Ga0501047_0000021_187357_188325 322
76 3300049582 Ga0501048_0000955 Ga0501048_0000955_5139_6107 322
77 3300049824 Ga0501045_0010969 Ga0501045_0010969_375_1343 322
78 3300053110 Ga0500571_000401 Ga0500571_000401_7241_8251 322
79 3300053120 Ga0500597_092233 Ga0500597_092233_241_1251 322
80 3300053121 Ga0500607_040553 Ga0500607_040553_1192_2160 322
81 3300053138 Ga0500564_058292 Ga0500564_058292_510_1520 322
82 3300053141 Ga0500574_002775 Ga0500574_002775_749_1759 322
83 3300053162 Ga0500638_054481 Ga0500638_054481_730_1740 322
84 3300053096 Ga0500641_0110234 Ga0500641_0110234_127_1113 323
85 3300053136 Ga0500559_0074087 Ga0500559_0074087_332_1342 323
86 3300025935 Ga0207709_10056798 Ga0207709_100567982 324
87 3300050493 nmdc:mga0k408_99088_c1 nmdc:mga0k408_99088_c1_344_1354 324
88 iso_pu_bacteria 2643221660 2644337543 324
89 3300003215 JGI25153J46596_10003295 JGI25153J46596_100032955 325
90 3300025297 Ga0209758_1000057 Ga0209758_100005741 325
91 3300046542 Ga0495597_0001779 Ga0495597_0001779_2276_3280 325
92 iso_pu_bacteria 2842733646 2842737111 325
93 iso_pu_bacteria 2842747753 2842750361 325
94 3300003322 rootL2_10030538 rootL2_100305382 326
95 3300005353 Ga0070669_100006496 Ga0070669_1000064965 326
96 3300025923 Ga0207681_10009414 Ga0207681_100094145 326
97 3300028794 Ga0307515_10038072 Ga0307515_100380724 326
98 iso_pu_bacteria 2831864461 2831866950 326
99 iso_pu_bacteria 2885192300 2885194915 326
100 3300003771 Ga0055526_1008514 Ga0055526_10085142 327
101 3300005337 Ga0070682_100359469 Ga0070682_1003594691 327
102 3300005543 Ga0070672_100176373 Ga0070672_1001763732 327
103 3300025273 Ga0209673_1013105 Ga0209673_10131051 327
104 3300025295 Ga0209564_1000005 Ga0209564_1000005959 327
105 3300025972 Ga0207668_10206925 Ga0207668_102069252 327
106 3300026121 Ga0207683_10184600 Ga0207683_101846002 327
107 3300027614 Ga0209970_1000271 Ga0209970_10002718 327
108 3300044712 Ga0453684_0120443 Ga0453684_0120443_64_1089 327
109 3300046539 Ga0495621_0059279 Ga0495621_0059279_53_1039 327
110 iso_pu_bacteria 2945945610 2945947371 327
111 3300005290 Ga0065712_10139830 Ga0065712_101398302 328
112 3300005293 Ga0065715_10097422 Ga0065715_100974222 328
113 3300005327 Ga0070658_10044651 Ga0070658_100446513 328
114 3300005331 Ga0070670_100000525 Ga0070670_10000052511 328
115 3300005331 Ga0070670_100017751 Ga0070670_1000177514 328
116 3300005331 Ga0070670_100046290 Ga0070670_1000462903 328
117 3300005334 Ga0068869_100145039 Ga0068869_1001450392 328
118 3300005344 Ga0070661_100000641 Ga0070661_1000006412 328
119 3300005347 Ga0070668_100217379 Ga0070668_1002173792 328
120 3300005347 Ga0070668_100317904 Ga0070668_1003179041 328
121 3300005353 Ga0070669_100008269 Ga0070669_1000082696 328
122 3300005353 Ga0070669_100013864 Ga0070669_1000138649 328
123 3300005354 Ga0070675_100001327 Ga0070675_1000013273 328
124 3300005354 Ga0070675_100023424 Ga0070675_1000234243 328
125 3300005354 Ga0070675_100335362 Ga0070675_1003353621 328
126 3300005355 Ga0070671_100041906 Ga0070671_1000419064 328
127 3300005355 Ga0070671_100106538 Ga0070671_1001065382 328
128 3300005356 Ga0070674_100002887 Ga0070674_1000028873 328
129 3300005356 Ga0070674_100003198 Ga0070674_1000031983 328
130 3300005356 Ga0070674_100026815 Ga0070674_1000268154 328
131 3300005356 Ga0070674_100173335 Ga0070674_1001733351 328
132 3300005364 Ga0070673_100001093 Ga0070673_10000109314 328
133 3300005364 Ga0070673_100004659 Ga0070673_1000046593 328
134 3300005364 Ga0070673_100010342 Ga0070673_1000103422 328
135 3300005367 Ga0070667_100093062 Ga0070667_1000930621 328
136 3300005367 Ga0070667_100128795 Ga0070667_1001287952 328
137 3300005455 Ga0070663_100209526 Ga0070663_1002095261 328
138 3300005456 Ga0070678_100023434 Ga0070678_1000234344 328
139 3300005456 Ga0070678_100119285 Ga0070678_1001192853 328
140 3300005457 Ga0070662_100060133 Ga0070662_1000601333 328
141 3300005459 Ga0068867_100003837 Ga0068867_1000038376 328
142 3300005459 Ga0068867_100004161 Ga0068867_10000416113 328
143 3300005466 Ga0070685_10093265 Ga0070685_100932652 328
144 3300005577 Ga0068857_100003633 Ga0068857_1000036332 328
145 3300005616 Ga0068852_100017140 Ga0068852_1000171402 328
146 3300005618 Ga0068864_100044185 Ga0068864_1000441852 328
147 3300005618 Ga0068864_100120673 Ga0068864_1001206732 328
148 3300005719 Ga0068861_100005174 Ga0068861_1000051746 328
149 3300005834 Ga0068851_10024368 Ga0068851_100243682 328
150 3300005840 Ga0068870_10013582 Ga0068870_100135822 328
151 3300005840 Ga0068870_10030450 Ga0068870_100304502 328
152 3300005840 Ga0068870_10158275 Ga0068870_101582752 328
153 3300005841 Ga0068863_100064881 Ga0068863_1000648812 328
154 3300005842 Ga0068858_100017041 Ga0068858_1000170415 328
155 3300005842 Ga0068858_100117046 Ga0068858_1001170462 328
156 3300006048 Ga0075363_100019798 Ga0075363_1000197983 328
157 3300006195 Ga0075366_10063178 Ga0075366_100631783 328
158 3300006237 Ga0097621_100056406 Ga0097621_1000564063 328
159 3300006237 Ga0097621_100111069 Ga0097621_1001110692 328
160 3300006880 Ga0075429_100130999 Ga0075429_1001309992 328
161 3300006881 Ga0068865_100054673 Ga0068865_1000546732 328
162 3300006881 Ga0068865_100117864 Ga0068865_1001178642 328
163 3300009098 Ga0105245_10018671 Ga0105245_100186712 328
164 3300009148 Ga0105243_10005295 Ga0105243_100052952 328
165 3300009545 Ga0105237_10014620 Ga0105237_100146209 328
166 3300009553 Ga0105249_10005435 Ga0105249_1000543510 328
167 3300010375 Ga0105239_10030308 Ga0105239_100303083 328
168 3300011119 Ga0105246_10055765 Ga0105246_100557653 328
169 3300013308 Ga0157375_10145519 Ga0157375_101455192 328
170 3300014969 Ga0157376_10099307 Ga0157376_100993073 328
171 3300017792 Ga0163161_10062685 Ga0163161_100626854 328
172 3300025303 Ga0209051_1026708 Ga0209051_10267082 328
173 3300025893 Ga0207682_10000503 Ga0207682_100005037 328
174 3300025903 Ga0207680_10013061 Ga0207680_100130614 328
175 3300025907 Ga0207645_10003708 Ga0207645_100037087 328
176 3300025907 Ga0207645_10006140 Ga0207645_100061404 328
177 3300025907 Ga0207645_10120437 Ga0207645_101204372 328
178 3300025908 Ga0207643_10018051 Ga0207643_100180515 328
179 3300025908 Ga0207643_10045587 Ga0207643_100455872 328
180 3300025918 Ga0207662_10039679 Ga0207662_100396792 328
181 3300025919 Ga0207657_10097660 Ga0207657_100976602 328
182 3300025919 Ga0207657_10100057 Ga0207657_101000571 328
183 3300025920 Ga0207649_10001339 Ga0207649_100013392 328
184 3300025925 Ga0207650_10000412 Ga0207650_1000041220 328
185 3300025926 Ga0207659_10002853 Ga0207659_1000285313 328
186 3300025932 Ga0207690_10277083 Ga0207690_102770832 328
187 3300025933 Ga0207706_10004383 Ga0207706_100043836 328
188 3300025933 Ga0207706_10123752 Ga0207706_101237522 328
189 3300025935 Ga0207709_10005081 Ga0207709_100050812 328
190 3300025937 Ga0207669_10042306 Ga0207669_100423062 328
191 3300025940 Ga0207691_10002289 Ga0207691_100022892 328
192 3300025940 Ga0207691_10017932 Ga0207691_100179325 328
193 3300025942 Ga0207689_10002337 Ga0207689_100023376 328
194 3300025945 Ga0207679_10000168 Ga0207679_1000016846 328
195 3300025945 Ga0207679_10295164 Ga0207679_102951642 328
196 3300025945 Ga0207679_10295646 Ga0207679_102956462 328
197 3300025960 Ga0207651_10004206 Ga0207651_1000420610 328
198 3300025960 Ga0207651_10075496 Ga0207651_100754962 328
199 3300025960 Ga0207651_10285589 Ga0207651_102855891 328
200 3300025960 Ga0207651_10318414 Ga0207651_103184142 328
201 3300025961 Ga0207712_10047421 Ga0207712_100474213 328
202 3300026023 Ga0207677_10019283 Ga0207677_100192833 328
203 3300026023 Ga0207677_10115094 Ga0207677_101150942 328
204 3300026035 Ga0207703_10096658 Ga0207703_100966582 328
205 3300026067 Ga0207678_10024090 Ga0207678_100240902 328
206 3300026075 Ga0207708_10120009 Ga0207708_101200092 328
207 3300026089 Ga0207648_10008143 Ga0207648_100081434 328
208 3300026089 Ga0207648_10013904 Ga0207648_100139046 328
209 3300026095 Ga0207676_10229599 Ga0207676_102295992 328
210 3300026095 Ga0207676_10336701 Ga0207676_103367011 328
211 3300026116 Ga0207674_10015077 Ga0207674_100150772 328
212 3300026118 Ga0207675_100001054 Ga0207675_10000105413 328
213 3300026121 Ga0207683_10322487 Ga0207683_103224872 328
214 3300028794 Ga0307515_10000893 Ga0307515_1000089330 328
215 3300031548 Ga0307408_100172916 Ga0307408_1001729162 328
216 3300031730 Ga0307516_10008598 Ga0307516_100085987 328
217 3300031852 Ga0307410_10008358 Ga0307410_100083583 328
218 3300031911 Ga0307412_10008681 Ga0307412_100086814 328
219 3300032002 Ga0307416_100028450 Ga0307416_1000284505 328
220 3300032004 Ga0307414_10008452 Ga0307414_100084525 328
221 3300042876 Ga0451577_0385957 Ga0451577_0385957_163_1149 328
222 3300046519 Ga0495632_0074598 Ga0495632_0074598_119_1105 328
223 3300047472 Ga0495686_0002373 Ga0495686_0002373_15248_16234 328
224 3300048919 Ga0496116_0017597 Ga0496116_0017597_1032_2018 328
225 iso_pu_bacteria 2643221628 2644160218 328
226 iso_pu_bacteria 2904449895 2904450916 328
227 iso_pu_bacteria 2904456579 2904459581 328
228 3300003759 Ga0055525_1000084 Ga0055525_1000084137 329
229 3300005353 Ga0070669_100005196 Ga0070669_10000519611 329
230 3300006195 Ga0075366_10132141 Ga0075366_101321411 329
231 3300014497 Ga0182008_10008258 Ga0182008_100082585 329
232 3300025923 Ga0207681_10030754 Ga0207681_100307542 329
233 3300028786 Ga0307517_10000122 Ga0307517_1000012270 329
234 3300042439 Ga0439464_0004504 Ga0439464_0004504_1793_2782 329
235 3300048925 Ga0496122_0000039 Ga0496122_0000039_90533_91522 329
236 3300048926 Ga0496123_0000026 Ga0496123_0000026_90629_91618 329
237 3300048927 Ga0496124_0022429 Ga0496124_0022429_654_1643 329
238 3300053140 Ga0500573_0052103 Ga0500573_0052103_291_1280 329
239 3300003322 rootL2_10000045 rootL2_1000004511 330
240 3300003374 JGI25161J50226_1011737 JGI25161J50226_10117371 330
241 3300003771 Ga0055526_1005428 Ga0055526_10054285 330
242 3300003771 Ga0055526_1011310 Ga0055526_10113102 330
243 3300003781 Ga0055536_1000501 Ga0055536_100050114 330
244 3300003784 Ga0055534_1000438 Ga0055534_10004382 330
245 3300004625 Ga0055543_1002669 Ga0055543_10026697 330
246 3300005262 Ga0065165_1000070 Ga0065165_100007079 330
247 3300005548 Ga0070665_100426036 Ga0070665_1004260362 330
248 3300025291 Ga0209675_1000050 Ga0209675_1000050139 330
249 3300025292 Ga0209676_1000053 Ga0209676_1000053109 330
250 3300025294 Ga0209025_1000093 Ga0209025_1000093167 330
251 3300025294 Ga0209025_1030114 Ga0209025_10301142 330
252 3300025295 Ga0209564_1000158 Ga0209564_100015844 330
253 3300025295 Ga0209564_1000224 Ga0209564_100022426 330
254 3300026121 Ga0207683_10101944 Ga0207683_101019442 330
255 3300042007 Ga0439449_0001607 Ga0439449_0001607_5069_6061 330
256 iso_pu_bacteria 2513020051 2513226821 330
257 iso_pu_bacteria 2643221658 2644327205 330
258 iso_pu_bacteria 2643221672 2644399443 330
259 3300030745 Ga0316182_1330503 Ga0316182_13305032 331
260 3300053156 Ga0500622_0010333 Ga0500622_0010333_348_1361 331
261 iso_pu_bacteria 2738541307 2738883488 331
262 iso_pu_bacteria 2842718218 2842721957 331
263 iso_pu_bacteria 2885198086 2885204066 331
264 iso_pu_bacteria 2885211737 2885217600 331
265 3300003773 Ga0055537_1000013 Ga0055537_100001339 332
266 3300003784 Ga0055534_1000008 Ga0055534_1000008161 332
267 3300003790 Ga0055528_1000202 Ga0055528_100020218 332
268 3300003792 Ga0055540_1000683 Ga0055540_100068321 332
269 3300005288 Ga0065714_10003735 Ga0065714_1000373510 332
270 3300006038 Ga0075365_10011619 Ga0075365_100116192 332
271 3300006048 Ga0075363_100026518 Ga0075363_1000265182 332
272 3300006177 Ga0075362_10013233 Ga0075362_100132333 332
273 3300006178 Ga0075367_10019631 Ga0075367_100196313 332
274 3300006948 Ga0099826_10011512 Ga0099826_100115125 332
275 3300017792 Ga0163161_10001990 Ga0163161_100019905 332
276 3300025263 Ga0209565_1000042 Ga0209565_1000042160 332
277 3300025273 Ga0209673_1000071 Ga0209673_100007168 332
278 3300025273 Ga0209673_1004447 Ga0209673_100444711 332
279 3300025291 Ga0209675_1000041 Ga0209675_100004167 332
280 3300025303 Ga0209051_1000370 Ga0209051_100037044 332
281 3300027666 Ga0209282_1013071 Ga0209282_10130714 332
282 3300030734 Ga0316179_1084965 Ga0316179_10849651 332
283 3300030735 Ga0316178_1158591 Ga0316178_11585912 332
284 3300030744 Ga0316181_1011138 Ga0316181_10111383 332
285 3300031548 Ga0307408_100002421 Ga0307408_1000024217 332
286 3300031852 Ga0307410_10110063 Ga0307410_101100632 332
287 3300031901 Ga0307406_10000764 Ga0307406_100007644 332
288 3300031901 Ga0307406_10081038 Ga0307406_100810383 332
289 3300031911 Ga0307412_10096747 Ga0307412_100967472 332
290 3300032002 Ga0307416_100419413 Ga0307416_1004194132 332
291 3300042122 Ga0450920_015800 Ga0450920_015800_69_1067 332
292 3300042133 Ga0450896_010863 Ga0450896_010863_259_1257 332
293 3300042147 Ga0450910_006733 Ga0450910_006733_487_1485 332
294 3300042184 Ga0450908_010914 Ga0450908_010914_363_1361 332
295 3300042435 Ga0439434_0001296 Ga0439434_0001296_539_1537 332
296 3300050489 nmdc:mga03683_406_c1 nmdc:mga03683_406_c1_242_1240 332
297 3300050491 nmdc:mga00v17_29514_c1 nmdc:mga00v17_29514_c1_1883_2881 332
298 3300050492 nmdc:mga0yw44_29625_c1 nmdc:mga0yw44_29625_c1_75_1073 332
299 3300050493 nmdc:mga0k408_74524_c1 nmdc:mga0k408_74524_c1_677_1675 332
300 iso_pu_bacteria 2928084124 2928085466 332
301 3300003578 Ga0006562J51391_1051819 Ga0006562J51391_10518194 333
302 3300003578 Ga0006562J51391_1051821 Ga0006562J51391_10518212 333
303 3300006353 Ga0075370_10002998 Ga0075370_100029987 333
304 3300013100 Ga0157373_10004080 Ga0157373_100040809 333
305 3300014497 Ga0182008_10011292 Ga0182008_100112924 333
306 3300014497 Ga0182008_10113306 Ga0182008_101133061 333
307 3300015261 Ga0182006_1000688 Ga0182006_10006885 333
308 3300048925 Ga0496122_0000450 Ga0496122_0000450_4925_5959 333
309 3300048926 Ga0496123_0000176 Ga0496123_0000176_38547_39581 333
310 3300048927 Ga0496124_0022345 Ga0496124_0022345_105_1139 333
311 3300049758 Ga0501241_006351 Ga0501241_006351_563_1597 333
312 3300050496 nmdc:mga07m45_6770_c1 nmdc:mga07m45_6770_c1_4069_5070 333
313 iso_pu_bacteria 2928070936 2928072278 333
314 3300003781 Ga0055536_1006926 Ga0055536_10069266 334
315 3300003791 Ga0055530_10006132 Ga0055530_100061326 334
316 3300003792 Ga0055540_1006010 Ga0055540_10060103 334
317 3300003794 Ga0055531_10009765 Ga0055531_100097653 334
318 3300005457 Ga0070662_100095425 Ga0070662_1000954252 334
319 3300005578 Ga0068854_100088920 Ga0068854_1000889202 334
320 3300005616 Ga0068852_100037656 Ga0068852_1000376564 334
321 3300009036 Ga0105244_10008617 Ga0105244_100086176 334
322 3300009174 Ga0105241_10182873 Ga0105241_101828731 334
323 3300011119 Ga0105246_10083702 Ga0105246_100837022 334
324 3300013100 Ga0157373_10071300 Ga0157373_100713003 334
325 3300014497 Ga0182008_10007352 Ga0182008_100073525 334
326 3300015261 Ga0182006_1005313 Ga0182006_10053136 334
327 3300015262 Ga0182007_10010974 Ga0182007_100109742 334
328 3300025292 Ga0209676_1001070 Ga0209676_10010706 334
329 3300025298 Ga0209050_1001168 Ga0209050_10011686 334
330 3300025303 Ga0209051_1000453 Ga0209051_100045352 334
331 3300025304 Ga0209257_1000582 Ga0209257_100058260 334
332 3300025728 Ga0207655_1007327 Ga0207655_10073276 334
333 3300025945 Ga0207679_10021088 Ga0207679_100210883 334
334 3300026067 Ga0207678_10229809 Ga0207678_102298091 334
335 3300026142 Ga0207698_10074370 Ga0207698_100743701 334
336 3300048906 Ga0496103_0218498 Ga0496103_0218498_58_1065 334
337 3300048920 Ga0496117_0077404 Ga0496117_0077404_21_1028 334
338 3300048921 Ga0496118_0014062 Ga0496118_0014062_3100_4107 334
339 3300050496 nmdc:mga07m45_1339_c1 nmdc:mga07m45_1339_c1_797_1804 334
340 3300001989 JGI24739J22299_10003055 JGI24739J22299_100030554 338
341 3300002774 JGI25150J39212_1000774 JGI25150J39212_10007742 338
342 3300002987 JGI25159J45721_1008727 JGI25159J45721_10087273 338
343 3300003187 JGI25151J46595_10032439 JGI25151J46595_100324393 338
344 3300003215 JGI25153J46596_10032573 JGI25153J46596_100325732 338
345 3300003354 JGI25160J50197_1010977 JGI25160J50197_10109772 338
346 3300003374 JGI25161J50226_1006217 JGI25161J50226_10062172 338
347 3300003775 Ga0055524_1012406 Ga0055524_10124063 338
348 3300003784 Ga0055534_1008815 Ga0055534_10088152 338
349 3300003794 Ga0055531_10024190 Ga0055531_100241902 338
350 3300004625 Ga0055543_1001687 Ga0055543_10016872 338
351 3300005262 Ga0065165_1013689 Ga0065165_10136892 338
352 3300025208 Ga0209436_105458 Ga0209436_1054583 338
353 3300025245 Ga0207425_1000734 Ga0207425_100073410 338
354 3300025258 Ga0209129_1000391 Ga0209129_100039110 338
355 3300025273 Ga0209673_1000556 Ga0209673_10005566 338
356 3300025284 Ga0209130_1000396 Ga0209130_100039612 338
357 3300025291 Ga0209675_1000728 Ga0209675_100072822 338
358 3300025294 Ga0209025_1000349 Ga0209025_100034966 338
359 3300025295 Ga0209564_1000294 Ga0209564_100029466 338
360 3300025297 Ga0209758_1000039 Ga0209758_1000039270 338
361 3300025299 Ga0209256_1000230 Ga0209256_100023066 338
362 3300025302 Ga0207426_1000108 Ga0207426_10001088 338
363 3300025303 Ga0209051_1023348 Ga0209051_10233482 338
364 3300048921 Ga0496118_0014566 Ga0496118_0014566_2315_3331 338
365 3300048928 Ga0496125_0026172 Ga0496125_0026172_3779_4795 338

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

67

341

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5oku-assembly1.cif.gz_A r. palustris rpa4515 with adipate 0.9497 41 336
8hkb-assembly1.cif.gz_A tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d 0.9478 42 338
5oku-assembly1.cif.gz_A r. palustris rpa4515 with adipate 0.9374 41 336
2f5x-assembly3.cif.gz_C structure of periplasmic binding protein bugd 0.9354 41 338
2f5x-assembly3.cif.gz_C structure of periplasmic binding protein bugd 0.9294 41 338
ID Description Score Start End Superfamily
2f5xC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.908 141 263 3.40.190.10
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9052 139 263 3.40.190.10
2dvzA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9044 41 338 3.40.190.150
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9044 139 260 3.40.190.10
2f5xC01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9012 41 338 3.40.190.150
ID Description Score Start End GO Terms
AF-A0A4Q7NH98-F1-model_v4 Tripartite-type tricarboxylate transporter receptor subunit TctC 0.9635 41 338
AF-A0A537DML3-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9581 48 338
AF-A0A259CY24-F1-model_v4 ABC transporter substrate-binding protein 0.9561 129 338
AF-A0A5C8CF86-F1-model_v4 deleted 0.9553 51 338
AF-A0A537DML3-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9549 48 338

Feature Viewer

pLDDT pTM Quality
83.23 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map