F423632

General Info

Members Datasets Scaffolds Average Seq Length
365 167 730 303

Family's Representative Sequence

Representative Sequence 3300006847|Ga0075431_100302783|Ga0075431_1003027832
Length 331
Sequence MATQSYVYVGLAGETAPGRPVKSGFYRMAVGDDRWELATRGLPEAPTIRAIATHPDQPGTVYVGTQHGPYRSTDHGDHWEKVNIADHGLPVWSLLFDPRDSRVLYAGYENCEIFRSEDEGERWHQLPVTVRFPEITVAPGSNPAKRVLKMAVNPTNSDEIYGAIEVGGIIRSLDGGENWECVSHGQYLNDDTVDMHGVLVGRWRPGTVFAIARAGLFTSTDQGAHWSSARIESLNAKGQTYCRDIREVPGDPKTIWVAAGSNFQSDVGALFRSKDGGVSWTRAKMGFDPKTTMFALAFDPRQPRRMFCATNGGIERPLPAGATQVYAMGCA

Samples

Sample ID Description Type Environment
1 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
26 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
50 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
51 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
52 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
53 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
75 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
78 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
79 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
80 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
81 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
82 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
83 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
84 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
85 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
86 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
87 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
88 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
89 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
90 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
91 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
92 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
93 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
94 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
95 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
96 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
97 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
98 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
99 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
100 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
101 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
102 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
103 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
104 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
105 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
106 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
107 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
108 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
109 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
110 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
111 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
112 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
113 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
114 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
115 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
116 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
117 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
118 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
119 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
120 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
121 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
122 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
123 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
124 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
125 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
126 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
127 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
128 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
129 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
130 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
131 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
132 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
143 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
144 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
145 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
146 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
147 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
148 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
149 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
150 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
151 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
152 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
153 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
154 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
155 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
156 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
157 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
158 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
159 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
160 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
161 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
162 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
163 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
164 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
165 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
166 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
167 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.73
Metatranscriptomes 0.27
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.82
Rhizosphere 98.08
Stem 0
Stem Tuber 0
Unclassified 18.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075431_100302783 3300006847 Bacteria 1615
2 JGI25406J46586_10001852 3300003203 Bacteria 9931
3 Ga0058860_10003606 3300004801 Bacteria 1178
4 Ga0065707_10120557 3300005295 Bacteria 2131
5 Ga0070680_100107255 3300005336 Bacteria 2323
6 Ga0070714_100073403 3300005435 Bacteria 2964
7 Ga0070713_100006002 3300005436 Bacteria 8361
8 Ga0070713_100211820 3300005436 Bacteria 1755
9 Ga0070713_100263390 3300005436 Bacteria 1576
10 Ga0070713_100310192 3300005436 Bacteria 1455
11 Ga0070711_100017667 3300005439 Bacteria 4544
12 Ga0070705_100067805 3300005440 Bacteria 2145
13 Ga0070705_100180699 3300005440 Bacteria 1429
14 Ga0070708_100317503 3300005445 Bacteria 1467
15 Ga0070708_100323706 3300005445 Bacteria 1452
16 Ga0068867_100101355 3300005459 Bacteria 2200
17 Ga0070706_100022300 3300005467 Bacteria 5830
18 Ga0070706_100149281 3300005467 Unclassified 2182
19 Ga0070706_100158161 3300005467 Bacteria 2115
20 Ga0070706_100394725 3300005467 Bacteria 1288
21 Ga0070707_100031102 3300005468 Bacteria 5083
22 Ga0070707_100035159 3300005468 Bacteria 4779
23 Ga0070707_100187316 3300005468 Bacteria 2018
24 Ga0070707_100230462 3300005468 Bacteria 1803
25 Ga0070698_100029322 3300005471 Bacteria 5711
26 Ga0070699_100018951 3300005518 Bacteria 5918
27 Ga0070699_100024035 3300005518 Bacteria 5251
28 Ga0070699_100030952 3300005518 Unclassified 4620
29 Ga0070679_100116811 3300005530 Bacteria 2653
30 Ga0070697_100021235 3300005536 Bacteria 5143
31 Ga0070697_100024829 3300005536 Unclassified 4773
32 Ga0070697_100100297 3300005536 Unclassified 2405
33 Ga0070697_100117835 3300005536 Bacteria 2218
34 Ga0070697_100279125 3300005536 Bacteria 1433
35 Ga0070696_100009327 3300005546 Bacteria 6570
36 Ga0070696_100035052 3300005546 Bacteria 3454
37 Ga0070704_100025030 3300005549 Unclassified 3925
38 Ga0070704_100070019 3300005549 Bacteria 2544
39 Ga0068859_100140110 3300005617 Bacteria 2492
40 Ga0068858_100203792 3300005842 Unclassified 1871
41 Ga0068860_100031813 3300005843 Bacteria 5072
42 Ga0068860_100296275 3300005843 Bacteria 1584
43 Ga0068862_100006457 3300005844 Bacteria 9744
44 Ga0081455_10000067 3300005937 Bacteria 112338
45 Ga0081455_10001746 3300005937 Bacteria 26275
46 Ga0081538_10000604 3300005981 Bacteria 39782
47 Ga0081538_10053288 3300005981 Bacteria 2406
48 Ga0081538_10055303 3300005981 Bacteria 2338
49 Ga0081540_1023290 3300005983 Bacteria 3626
50 Ga0081539_10000271 3300005985 Bacteria 118902
51 Ga0081539_10005552 3300005985 Bacteria 12782
52 Ga0070717_10218641 3300006028 Unclassified 1674
53 Ga0070717_10377455 3300006028 Bacteria 1271
54 Ga0075432_10014811 3300006058 Bacteria 2657
55 Ga0070712_100048704 3300006175 Bacteria 2939
56 Ga0070712_100103439 3300006175 Bacteria 2111
57 Ga0075427_10010431 3300006194 Unclassified 1390
58 Ga0097621_100282131 3300006237 Bacteria 1462
59 Ga0075428_100001003 3300006844 Bacteria 29930
60 Ga0075428_100002741 3300006844 Bacteria 19183
61 Ga0075428_100042915 3300006844 Bacteria 4973
62 Ga0075428_100126707 3300006844 Bacteria 2778
63 Ga0075428_100238167 3300006844 Unclassified 1964
64 Ga0075428_100356058 3300006844 Unclassified 1571
65 Ga0075430_100000034 3300006846 Bacteria 70046
66 Ga0075430_100000055 3300006846 Bacteria 59692
67 Ga0075430_100057769 3300006846 Bacteria 3263
68 Ga0075431_100000968 3300006847 Bacteria 25514
69 Ga0075431_100001235 3300006847 Bacteria 23185
70 Ga0075431_100003066 3300006847 Bacteria 16179
71 Ga0075431_100140373 3300006847 Bacteria 2490
72 Ga0075431_100241060 3300006847 Bacteria 1839
73 Ga0075433_10000291 3300006852 Bacteria 30003
74 Ga0075433_10023228 3300006852 Bacteria 5216
75 Ga0075433_10097640 3300006852 Unclassified 2600
76 Ga0075433_10234375 3300006852 Bacteria 1630
77 Ga0075434_100007950 3300006871 Bacteria 9829
78 Ga0075434_100103766 3300006871 Unclassified 2851
79 Ga0075434_100187184 3300006871 Bacteria 2090
80 Ga0075434_100203041 3300006871 Unclassified 2002
81 Ga0075429_100000331 3300006880 Bacteria 34231
82 Ga0075429_100017214 3300006880 Bacteria 6251
83 Ga0075429_100018487 3300006880 Bacteria 6038
84 Ga0075429_100022601 3300006880 Bacteria 5452
85 Ga0075429_100026673 3300006880 Bacteria 5016
86 Ga0075429_100031673 3300006880 Bacteria 4596
87 Ga0075429_100089422 3300006880 Bacteria 2684
88 Ga0075429_100158121 3300006880 Bacteria 1985
89 Ga0075429_100235527 3300006880 Unclassified 1604
90 Ga0075429_100331632 3300006880 Unclassified 1331
91 Ga0075436_100001280 3300006914 Bacteria 17074
92 Ga0075436_100056309 3300006914 Unclassified 2716
93 Ga0075436_100059838 3300006914 Bacteria 2631
94 Ga0097620_100140123 3300006931 Bacteria 2492
95 Ga0075435_100016469 3300007076 Bacteria 5574
96 Ga0075435_100111149 3300007076 Unclassified 2279
97 Ga0075435_100115237 3300007076 Unclassified 2238
98 Ga0075435_100123948 3300007076 Bacteria 2158
99 Ga0099794_10003209 3300007265 Bacteria 6200
100 Ga0099794_10020728 3300007265 Bacteria 2977
101 Ga0099794_10098156 3300007265 Unclassified 1460
102 Ga0099794_10151003 3300007265 Bacteria 1179
103 Ga0111539_10003807 3300009094 Bacteria 19850
104 Ga0111539_10013042 3300009094 Bacteria 10401
105 Ga0111539_10030039 3300009094 Bacteria 6612
106 Ga0111539_10335959 3300009094 Bacteria 1758
107 Ga0111539_10769987 3300009094 Bacteria 1120
108 Ga0105247_10054229 3300009101 Bacteria 2474
109 Ga0114129_10002732 3300009147 Bacteria 24600
110 Ga0114129_10004188 3300009147 Bacteria 20374
111 Ga0114129_10010125 3300009147 Bacteria 13439
112 Ga0114129_10032384 3300009147 Bacteria 7388
113 Ga0114129_10059682 3300009147 Bacteria 5332
114 Ga0114129_10067903 3300009147 Bacteria 4971
115 Ga0114129_10070252 3300009147 Bacteria 4882
116 Ga0114129_10089570 3300009147 Bacteria 4265
117 Ga0114129_10094720 3300009147 Bacteria 4135
118 Ga0114129_10206462 3300009147 Bacteria 2658
119 Ga0114129_10220569 3300009147 Bacteria 2558
120 Ga0114129_10245878 3300009147 Unclassified 2403
121 Ga0114129_10529866 3300009147 Bacteria 1535
122 Ga0114129_10584856 3300009147 Bacteria 1448
123 Ga0105248_10134779 3300009177 Bacteria 2786
124 Ga0105249_10018834 3300009553 Bacteria 6152
125 Ga0105249_10113234 3300009553 Unclassified 2567
126 Ga0105249_10377932 3300009553 Bacteria 1442
127 Ga0157378_10358104 3300013297 Unclassified 1427
128 Ga0157375_10070621 3300013308 Unclassified 3503
129 Ga0157380_10276708 3300014326 Bacteria 1533
130 Ga0157379_10241835 3300014968 Unclassified 1637
131 Ga0213873_10012775 3300021358 Bacteria 1827
132 Ga0213875_10089607 3300021388 Bacteria 1435
133 Ga0207710_10026743 3300025900 Bacteria 2494
134 Ga0207684_10006969 3300025910 Bacteria 10224
135 Ga0207684_10019122 3300025910 Bacteria 5859
136 Ga0207684_10030092 3300025910 Bacteria 4623
137 Ga0207707_10045512 3300025912 Unclassified 3823
138 Ga0207663_10031704 3300025916 Unclassified 3131
139 Ga0207662_10172551 3300025918 Bacteria 1387
140 Ga0207652_10078035 3300025921 Bacteria 2891
141 Ga0207646_10003121 3300025922 Bacteria 18999
142 Ga0207646_10006898 3300025922 Bacteria 11667
143 Ga0207646_10090113 3300025922 Bacteria 2745
144 Ga0207646_10273550 3300025922 Unclassified 1527
145 Ga0207646_10351127 3300025922 Bacteria 1333
146 Ga0207681_10015852 3300025923 Bacteria 4704
147 Ga0207681_10089468 3300025923 Bacteria 2195
148 Ga0207687_10056328 3300025927 Bacteria 2757
149 Ga0207700_10052364 3300025928 Bacteria 3052
150 Ga0207700_10107704 3300025928 Bacteria 2236
151 Ga0207700_10250477 3300025928 Bacteria 1513
152 Ga0207664_10292097 3300025929 Bacteria 1432
153 Ga0207706_10226761 3300025933 Bacteria 1635
154 Ga0207709_10162216 3300025935 Bacteria 1560
155 Ga0207665_10061343 3300025939 Bacteria 2548
156 Ga0207711_10050879 3300025941 Bacteria 3548
157 Ga0207711_10172754 3300025941 Bacteria 1962
158 Ga0207712_10029143 3300025961 Bacteria 3700
159 Ga0207712_10097727 3300025961 Unclassified 2176
160 Ga0207703_10377630 3300026035 Unclassified 1310
161 Ga0207708_10120254 3300026075 Bacteria 2046
162 Ga0207674_10268928 3300026116 Bacteria 1652
163 Ga0207675_100227177 3300026118 Bacteria 1800
164 Ga0209588_1031419 3300027671 Bacteria 1699
165 Ga0207428_10000991 3300027907 Bacteria 31462
166 Ga0207428_10053770 3300027907 Bacteria 3210
167 Ga0207428_10087831 3300027907 Bacteria 2419
168 Ga0207428_10128450 3300027907 Bacteria 1940
169 Ga0268265_10293940 3300028380 Bacteria 1459
170 Ga0268264_10033628 3300028381 Bacteria 4215
171 Ga0307408_100156582 3300031548 Bacteria 1805
172 Ga0373926_0025200 3300035083 Unclassified 2075
173 Ga0373940_0015800 3300035088 Bacteria 1861
174 Ga0373951_0016006 3300035091 Bacteria 1691
175 Ga0373923_0014416 3300035111 Bacteria 2969
176 Ga0373932_0014013 3300035112 Bacteria 2008
177 Ga0373932_0018400 3300035112 Unclassified 1806
178 Ga0373953_0009885 3300035117 Unclassified 3303
179 Ga0373957_0030571 3300035120 Bacteria 1974
180 Ga0373957_0054815 3300035120 Bacteria 1532
181 Ga0373955_0041744 3300035172 Bacteria 2460
182 Ga0373924_0010715 3300035410 Unclassified 3391
183 Ga0373924_0078474 3300035410 Bacteria 1402
184 Ga0373931_0066186 3300035691 Bacteria 1960
185 Ga0373931_0073300 3300035691 Bacteria 1874
186 Ga0373935_0027755 3300035692 Bacteria 3498
187 Ga0373935_0306516 3300035692 Unclassified 1124
188 Ga0373927_0173909 3300035695 Bacteria 1412
189 Ga0373927_0183901 3300035695 Unclassified 1371
190 Ga0373933_0061174 3300035724 Bacteria 2271
191 Ga0373933_0184025 3300035724 Bacteria 1333
192 Ga0373947_0027533 3300035725 Bacteria 3327
193 Ga0373937_0003852 3300036401 Bacteria 12685
194 Ga0373937_0006505 3300036401 Bacteria 10083
195 Ga0373937_0139079 3300036401 Bacteria 2271
196 Ga0373937_0252429 3300036401 Bacteria 1663
197 Ga0373925_0084802 3300037068 Unclassified 2414
198 Ga0373925_0113560 3300037068 Bacteria 2095
199 Ga0395899_0145701 3300037312 Bacteria 1682
200 Ga0395900_0009101 3300037418 Bacteria 10174
201 Ga0395900_0141969 3300037418 Bacteria 2459
202 Ga0395898_0017059 3300037466 Bacteria 7416
203 Ga0395898_0120401 3300037466 Bacteria 2515
204 Ga0436364_0304816 3300037853 Bacteria 2688
205 Ga0395901_0084273 3300038443 Bacteria 3322
206 Ga0436361_0568791 3300039447 Bacteria 1254
207 Ga0436363_0118661 3300039450 Unclassified 1873
208 Ga0436362_0840844 3300039453 Bacteria 1595
209 Ga0436362_0858673 3300039453 Bacteria 3534
210 Ga0436362_1156917 3300039453 Unclassified 3423
211 Ga0439450_016883 3300042008 Unclassified 1515
212 Ga0451577_0065344 3300042876 Unclassified 3245
213 Ga0451577_0178767 3300042876 Bacteria 1913
214 Ga0451577_0279261 3300042876 Bacteria 1513
215 Ga0453683_0155106 3300044673 Bacteria 1447
216 Ga0451576_0080620 3300045051 Bacteria 3386
217 Ga0451576_0150345 3300045051 Bacteria 2428
218 Ga0495603_0197484 3300046455 Bacteria 1163
219 Ga0495651_0045334 3300046462 Unclassified 3407
220 Ga0495580_0001539 3300046472 Bacteria 20289
221 Ga0495662_0076540 3300046476 Unclassified 1625
222 Ga0495664_0001926 3300046477 Bacteria 11053
223 Ga0495618_0061864 3300046514 Bacteria 2375
224 Ga0495642_0014048 3300046528 Bacteria 3104
225 Ga0495652_0192532 3300046529 Unclassified 1555
226 Ga0495640_0023874 3300046533 Bacteria 4449
227 Ga0495645_0002455 3300046543 Bacteria 12592
228 Ga0495667_0011298 3300046559 Bacteria 6043
229 Ga0495667_0115731 3300046559 Bacteria 1732
230 Ga0495635_0122072 3300046663 Bacteria 1777
231 Ga0495659_0033923 3300046664 Bacteria 1793
232 Ga0495657_0314331 3300046675 Bacteria 932
233 Ga0495599_0023205 3300046678 Unclassified 3877
234 Ga0495623_0016230 3300046679 Bacteria 4810
235 Ga0495646_0089977 3300046680 Bacteria 1775
236 Ga0495613_0204786 3300046689 Bacteria 1390
237 Ga0495674_0021698 3300047319 Bacteria 5938
238 Ga0495674_0279215 3300047319 Bacteria 1369
239 Ga0495680_0120307 3300047322 Bacteria 1939
240 Ga0495675_0009856 3300047444 Bacteria 5957
241 Ga0495684_0078761 3300047471 Bacteria 2501
242 Ga0495602_0000654 3300048088 Bacteria 32531
243 Ga0496102_0055136 3300048905 Unclassified 3625
244 Ga0496103_0103545 3300048906 Bacteria 1803
245 Ga0496106_0439189 3300048909 Bacteria 1049
246 Ga0501031_0213206 3300049568 Unclassified 1258
247 Ga0501036_0144393 3300049572 Unclassified 2007
248 Ga0501038_0016149 3300049574 Bacteria 6775
249 Ga0501039_0016279 3300049575 Bacteria 5696
250 Ga0501040_0001123 3300049576 Bacteria 16956
251 Ga0501040_0095097 3300049576 Bacteria 2074
252 Ga0501040_0185972 3300049576 Unclassified 1473
253 Ga0501041_0007621 3300049577 Bacteria 6358
254 Ga0501042_0007312 3300049578 Bacteria 7227
255 Ga0501042_0095193 3300049578 Archaea 2139
256 Ga0501042_0141291 3300049578 Bacteria 1736
257 Ga0501043_0348730 3300049579 Bacteria 1125
258 Ga0501046_0013804 3300049580 Bacteria 6828
259 Ga0501046_0173253 3300049580 Unclassified 1618
260 Ga0501046_0291277 3300049580 Unclassified 1194
261 Ga0501048_0004701 3300049582 Bacteria 10396
262 Ga0501068_0079829 3300049584 Unclassified 2006
263 Ga0501071_0102113 3300049587 Bacteria 2115
264 Ga0501072_0001928 3300049588 Bacteria 15440
265 Ga0501072_0008788 3300049588 Bacteria 7670
266 Ga0501072_0086251 3300049588 Bacteria 2491
267 Ga0501074_0108177 3300049590 Unclassified 1990
268 Ga0501075_0020341 3300049591 Bacteria 4827
269 Ga0501075_0056995 3300049591 Bacteria 2941
270 Ga0501075_0077259 3300049591 Unclassified 2519
271 Ga0501075_0108585 3300049591 Bacteria 2109
272 Ga0501076_0001248 3300049592 Bacteria 16948
273 Ga0501076_0015521 3300049592 Bacteria 5759
274 Ga0501076_0078701 3300049592 Unclassified 2646
275 Ga0501076_0092036 3300049592 Bacteria 2439
276 Ga0501076_0183665 3300049592 Unclassified 1705
277 Ga0501077_0001018 3300049593 Bacteria 16926
278 Ga0501077_0014222 3300049593 Bacteria 4997
279 Ga0501077_0035893 3300049593 Bacteria 3157
280 Ga0501079_0006835 3300049741 Bacteria 8588
281 Ga0501079_0038991 3300049741 Bacteria 3664
282 Ga0501079_0080071 3300049741 Unclassified 2526
283 Ga0501079_0155639 3300049741 Bacteria 1782
284 Ga0501080_0005100 3300049742 Bacteria 11699
285 Ga0501080_0107942 3300049742 Bacteria 2580
286 Ga0501081_0001341 3300049743 Bacteria 15016
287 Ga0501081_0034198 3300049743 Bacteria 3456
288 Ga0501081_0188791 3300049743 Bacteria 1492
289 Ga0501045_0100283 3300049824 Unclassified 2143
290 Ga0501045_0251535 3300049824 Unclassified 1315
291 nmdc:mga05p37_122846_c1 3300050507 Bacteria 3189
292 nmdc:mga05p37_135620_c1 3300050507 Bacteria 3019
293 nmdc:mga05p37_138726_c1 3300050507 Bacteria 2980
294 nmdc:mga05p37_163203_c1 3300050507 Bacteria 2720
295 nmdc:mga05p37_21124_c1 3300050507 Bacteria 7881
296 nmdc:mga05p37_22110_c1 3300050507 Bacteria 7710
297 nmdc:mga05p37_24352_c1 3300050507 Bacteria 7355
298 nmdc:mga05p37_24803_c1 3300050507 Bacteria 7290
299 nmdc:mga05p37_334984_c1 3300050507 Bacteria 1786
300 nmdc:mga05p37_52044_c1 3300050507 Bacteria 5036
301 nmdc:mga05p37_5226_c1 3300050507 Bacteria 15236
302 nmdc:mga05p37_67525_c1 3300050507 Bacteria 4399
303 nmdc:mga05p37_95345_c1 3300050507 Bacteria 3666
304 nmdc:mga05p37_98343_c1 3300050507 Bacteria 3604
305 nmdc:mga09592_107516_c1 3300050508 Bacteria 2393
306 nmdc:mga09592_226739_c1 3300050508 Unclassified 1619
307 nmdc:mga09592_230868_c1 3300050508 Unclassified 1603
308 nmdc:mga09592_250243_c1 3300050508 Bacteria 1536
309 nmdc:mga09592_29571_c1 3300050508 Bacteria 4556
310 nmdc:mga09592_31550_c1 3300050508 Bacteria 4416
311 nmdc:mga09592_4788_c1 3300050508 Bacteria 10965
312 nmdc:mga09592_70117_c1 3300050508 Bacteria 2974
313 nmdc:mga09592_80519_c1 3300050508 Unclassified 2774
314 nmdc:mga09592_81_c1 3300050508 Bacteria 55948
315 nmdc:mga09592_8493_c1 3300050508 Bacteria 8352
316 nmdc:mga0qj67_12863_c1 3300050509 Bacteria 6316
317 nmdc:mga0qj67_1953_c1 3300050509 Bacteria 14681
318 nmdc:mga0qj67_44287_c1 3300050509 Unclassified 3506
319 nmdc:mga06r32_102275_c1 3300050510 Bacteria 2813
320 nmdc:mga06r32_105408_c1 3300050510 Bacteria 2770
321 nmdc:mga06r32_15296_c1 3300050510 Bacteria 6970
322 nmdc:mga06r32_1998_c1 3300050510 Bacteria 18233
323 nmdc:mga08y16_20367_c1 3300050511 Bacteria 7001
324 nmdc:mga08y16_30529_c1 3300050511 Bacteria 5672
325 nmdc:mga0n895_124901_c1 3300050512 Unclassified 2597
326 nmdc:mga0n895_151278_c1 3300050512 Unclassified 2351
327 nmdc:mga0n895_155513_c1 3300050512 Bacteria 2317
328 nmdc:mga0n895_281449_c1 3300050512 Bacteria 1686
329 nmdc:mga0n895_348108_c1 3300050512 Bacteria 1501
330 nmdc:mga0n895_564_c1 3300050512 Bacteria 25427
331 nmdc:mga0n895_667_c1 3300050512 Bacteria 24029
332 nmdc:mga0n895_8826_c2 3300050512 Bacteria 6949
333 nmdc:mga0rr50_10845_c1 3300050513 Bacteria 5809
334 nmdc:mga0rr50_123419_c1 3300050513 Unclassified 2065
335 nmdc:mga0rr50_185883_c1 3300050513 Unclassified 1701
336 nmdc:mga0rr50_2092_c1 3300050513 Bacteria 11154
337 nmdc:mga0rr50_21398_c1 3300050513 Bacteria 4415
338 nmdc:mga0rr50_26596_c1 3300050513 Bacteria 4039
339 nmdc:mga0rr50_278720_c1 3300050513 Bacteria 1395
340 nmdc:mga0rr50_768_c1 3300050513 Bacteria 17272
341 nmdc:mga0rr50_95124_c1 3300050513 Unclassified 2328
342 nmdc:mga08x19_22807_c1 3300050514 Bacteria 3879
343 nmdc:mga08x19_24554_c1 3300050514 Bacteria 3748
344 nmdc:mga08x19_367_c1 3300050514 Bacteria 31883
345 nmdc:mga0a205_10704_c1 3300050515 Bacteria 8435
346 nmdc:mga0a205_125879_c1 3300050515 Bacteria 2462
347 nmdc:mga0a205_170609_c1 3300050515 Bacteria 2072
348 nmdc:mga0a205_47236_c1 3300050515 Bacteria 4153
349 nmdc:mga0a205_52136_c1 3300050515 Bacteria 3949
350 nmdc:mga0a205_66785_c1 3300050515 Bacteria 3475
351 nmdc:mga0a205_69177_c1 3300050515 Bacteria 3409
352 nmdc:mga0a205_7313_c1 3300050515 Bacteria 9991
353 Ga0495601_0004189 3300053077 Bacteria 8318
354 Ga0495612_0002912 3300053078 Bacteria 7094
355 Ga0495619_0021902 3300053085 Bacteria 4085
356 Ga0501084_0062359 3300054114 Bacteria 3121
357 Ga0501084_0063106 3300054114 Bacteria 3101
358 Ga0501084_0091083 3300054114 Bacteria 2560
359 Ga0501082_0023452 3300060353 Bacteria 5324
360 Ga0501082_0066426 3300060353 Bacteria 3106
361 Ga0501082_0251634 3300060353 Unclassified 1537
362 Ga0530510_0001170 3300061734 Bacteria 17428
363 Ga0530510_0020955 3300061734 Bacteria 4648
364 Ga0530510_0092754 3300061734 Bacteria 2204
365 Ga0530510_0129160 3300061734 Unclassified 1858
366 Ga0075431_100302783
367 JGI25406J46586_10001852
368 Ga0058860_10003606
369 Ga0065707_10120557
370 Ga0070680_100107255
371 Ga0070714_100073403
372 Ga0070713_100006002
373 Ga0070713_100211820
374 Ga0070713_100263390
375 Ga0070713_100310192
376 Ga0070711_100017667
377 Ga0070705_100067805
378 Ga0070705_100180699
379 Ga0070708_100317503
380 Ga0070708_100323706
381 Ga0068867_100101355
382 Ga0070706_100022300
383 Ga0070706_100149281
384 Ga0070706_100158161
385 Ga0070706_100394725
386 Ga0070707_100031102
387 Ga0070707_100035159
388 Ga0070707_100187316
389 Ga0070707_100230462
390 Ga0070698_100029322
391 Ga0070699_100018951
392 Ga0070699_100024035
393 Ga0070699_100030952
394 Ga0070679_100116811
395 Ga0070697_100021235
396 Ga0070697_100024829
397 Ga0070697_100100297
398 Ga0070697_100117835
399 Ga0070697_100279125
400 Ga0070696_100009327
401 Ga0070696_100035052
402 Ga0070704_100025030
403 Ga0070704_100070019
404 Ga0068859_100140110
405 Ga0068858_100203792
406 Ga0068860_100031813
407 Ga0068860_100296275
408 Ga0068862_100006457
409 Ga0081455_10000067
410 Ga0081455_10001746
411 Ga0081538_10000604
412 Ga0081538_10053288
413 Ga0081538_10055303
414 Ga0081540_1023290
415 Ga0081539_10000271
416 Ga0081539_10005552
417 Ga0070717_10218641
418 Ga0070717_10377455
419 Ga0075432_10014811
420 Ga0070712_100048704
421 Ga0070712_100103439
422 Ga0075427_10010431
423 Ga0097621_100282131
424 Ga0075428_100001003
425 Ga0075428_100002741
426 Ga0075428_100042915
427 Ga0075428_100126707
428 Ga0075428_100238167
429 Ga0075428_100356058
430 Ga0075430_100000034
431 Ga0075430_100000055
432 Ga0075430_100057769
433 Ga0075431_100000968
434 Ga0075431_100001235
435 Ga0075431_100003066
436 Ga0075431_100140373
437 Ga0075431_100241060
438 Ga0075433_10000291
439 Ga0075433_10023228
440 Ga0075433_10097640
441 Ga0075433_10234375
442 Ga0075434_100007950
443 Ga0075434_100103766
444 Ga0075434_100187184
445 Ga0075434_100203041
446 Ga0075429_100000331
447 Ga0075429_100017214
448 Ga0075429_100018487
449 Ga0075429_100022601
450 Ga0075429_100026673
451 Ga0075429_100031673
452 Ga0075429_100089422
453 Ga0075429_100158121
454 Ga0075429_100235527
455 Ga0075429_100331632
456 Ga0075436_100001280
457 Ga0075436_100056309
458 Ga0075436_100059838
459 Ga0097620_100140123
460 Ga0075435_100016469
461 Ga0075435_100111149
462 Ga0075435_100115237
463 Ga0075435_100123948
464 Ga0099794_10003209
465 Ga0099794_10020728
466 Ga0099794_10098156
467 Ga0099794_10151003
468 Ga0111539_10003807
469 Ga0111539_10013042
470 Ga0111539_10030039
471 Ga0111539_10335959
472 Ga0111539_10769987
473 Ga0105247_10054229
474 Ga0114129_10002732
475 Ga0114129_10004188
476 Ga0114129_10010125
477 Ga0114129_10032384
478 Ga0114129_10059682
479 Ga0114129_10067903
480 Ga0114129_10070252
481 Ga0114129_10089570
482 Ga0114129_10094720
483 Ga0114129_10206462
484 Ga0114129_10220569
485 Ga0114129_10245878
486 Ga0114129_10529866
487 Ga0114129_10584856
488 Ga0105248_10134779
489 Ga0105249_10018834
490 Ga0105249_10113234
491 Ga0105249_10377932
492 Ga0157378_10358104
493 Ga0157375_10070621
494 Ga0157380_10276708
495 Ga0157379_10241835
496 Ga0213873_10012775
497 Ga0213875_10089607
498 Ga0207710_10026743
499 Ga0207684_10006969
500 Ga0207684_10019122
501 Ga0207684_10030092
502 Ga0207707_10045512
503 Ga0207663_10031704
504 Ga0207662_10172551
505 Ga0207652_10078035
506 Ga0207646_10003121
507 Ga0207646_10006898
508 Ga0207646_10090113
509 Ga0207646_10273550
510 Ga0207646_10351127
511 Ga0207681_10015852
512 Ga0207681_10089468
513 Ga0207687_10056328
514 Ga0207700_10052364
515 Ga0207700_10107704
516 Ga0207700_10250477
517 Ga0207664_10292097
518 Ga0207706_10226761
519 Ga0207709_10162216
520 Ga0207665_10061343
521 Ga0207711_10050879
522 Ga0207711_10172754
523 Ga0207712_10029143
524 Ga0207712_10097727
525 Ga0207703_10377630
526 Ga0207708_10120254
527 Ga0207674_10268928
528 Ga0207675_100227177
529 Ga0209588_1031419
530 Ga0207428_10000991
531 Ga0207428_10053770
532 Ga0207428_10087831
533 Ga0207428_10128450
534 Ga0268265_10293940
535 Ga0268264_10033628
536 Ga0307408_100156582
537 Ga0373926_0025200
538 Ga0373940_0015800
539 Ga0373951_0016006
540 Ga0373923_0014416
541 Ga0373932_0014013
542 Ga0373932_0018400
543 Ga0373953_0009885
544 Ga0373957_0030571
545 Ga0373957_0054815
546 Ga0373955_0041744
547 Ga0373924_0010715
548 Ga0373924_0078474
549 Ga0373931_0066186
550 Ga0373931_0073300
551 Ga0373935_0027755
552 Ga0373935_0306516
553 Ga0373927_0173909
554 Ga0373927_0183901
555 Ga0373933_0061174
556 Ga0373933_0184025
557 Ga0373947_0027533
558 Ga0373937_0003852
559 Ga0373937_0006505
560 Ga0373937_0139079
561 Ga0373937_0252429
562 Ga0373925_0084802
563 Ga0373925_0113560
564 Ga0395899_0145701
565 Ga0395900_0009101
566 Ga0395900_0141969
567 Ga0395898_0017059
568 Ga0395898_0120401
569 Ga0436364_0304816
570 Ga0395901_0084273
571 Ga0436361_0568791
572 Ga0436363_0118661
573 Ga0436362_0840844
574 Ga0436362_0858673
575 Ga0436362_1156917
576 Ga0439450_016883
577 Ga0451577_0065344
578 Ga0451577_0178767
579 Ga0451577_0279261
580 Ga0453683_0155106
581 Ga0451576_0080620
582 Ga0451576_0150345
583 Ga0495603_0197484
584 Ga0495651_0045334
585 Ga0495580_0001539
586 Ga0495662_0076540
587 Ga0495664_0001926
588 Ga0495618_0061864
589 Ga0495642_0014048
590 Ga0495652_0192532
591 Ga0495640_0023874
592 Ga0495645_0002455
593 Ga0495667_0011298
594 Ga0495667_0115731
595 Ga0495635_0122072
596 Ga0495659_0033923
597 Ga0495657_0314331
598 Ga0495599_0023205
599 Ga0495623_0016230
600 Ga0495646_0089977
601 Ga0495613_0204786
602 Ga0495674_0021698
603 Ga0495674_0279215
604 Ga0495680_0120307
605 Ga0495675_0009856
606 Ga0495684_0078761
607 Ga0495602_0000654
608 Ga0496102_0055136
609 Ga0496103_0103545
610 Ga0496106_0439189
611 Ga0501031_0213206
612 Ga0501036_0144393
613 Ga0501038_0016149
614 Ga0501039_0016279
615 Ga0501040_0001123
616 Ga0501040_0095097
617 Ga0501040_0185972
618 Ga0501041_0007621
619 Ga0501042_0007312
620 Ga0501042_0095193
621 Ga0501042_0141291
622 Ga0501043_0348730
623 Ga0501046_0013804
624 Ga0501046_0173253
625 Ga0501046_0291277
626 Ga0501048_0004701
627 Ga0501068_0079829
628 Ga0501071_0102113
629 Ga0501072_0001928
630 Ga0501072_0008788
631 Ga0501072_0086251
632 Ga0501074_0108177
633 Ga0501075_0020341
634 Ga0501075_0056995
635 Ga0501075_0077259
636 Ga0501075_0108585
637 Ga0501076_0001248
638 Ga0501076_0015521
639 Ga0501076_0078701
640 Ga0501076_0092036
641 Ga0501076_0183665
642 Ga0501077_0001018
643 Ga0501077_0014222
644 Ga0501077_0035893
645 Ga0501079_0006835
646 Ga0501079_0038991
647 Ga0501079_0080071
648 Ga0501079_0155639
649 Ga0501080_0005100
650 Ga0501080_0107942
651 Ga0501081_0001341
652 Ga0501081_0034198
653 Ga0501081_0188791
654 Ga0501045_0100283
655 Ga0501045_0251535
656 nmdc:mga05p37_122846_c1
657 nmdc:mga05p37_135620_c1
658 nmdc:mga05p37_138726_c1
659 nmdc:mga05p37_163203_c1
660 nmdc:mga05p37_21124_c1
661 nmdc:mga05p37_22110_c1
662 nmdc:mga05p37_24352_c1
663 nmdc:mga05p37_24803_c1
664 nmdc:mga05p37_334984_c1
665 nmdc:mga05p37_52044_c1
666 nmdc:mga05p37_5226_c1
667 nmdc:mga05p37_67525_c1
668 nmdc:mga05p37_95345_c1
669 nmdc:mga05p37_98343_c1
670 nmdc:mga09592_107516_c1
671 nmdc:mga09592_226739_c1
672 nmdc:mga09592_230868_c1
673 nmdc:mga09592_250243_c1
674 nmdc:mga09592_29571_c1
675 nmdc:mga09592_31550_c1
676 nmdc:mga09592_4788_c1
677 nmdc:mga09592_70117_c1
678 nmdc:mga09592_80519_c1
679 nmdc:mga09592_81_c1
680 nmdc:mga09592_8493_c1
681 nmdc:mga0qj67_12863_c1
682 nmdc:mga0qj67_1953_c1
683 nmdc:mga0qj67_44287_c1
684 nmdc:mga06r32_102275_c1
685 nmdc:mga06r32_105408_c1
686 nmdc:mga06r32_15296_c1
687 nmdc:mga06r32_1998_c1
688 nmdc:mga08y16_20367_c1
689 nmdc:mga08y16_30529_c1
690 nmdc:mga0n895_124901_c1
691 nmdc:mga0n895_151278_c1
692 nmdc:mga0n895_155513_c1
693 nmdc:mga0n895_281449_c1
694 nmdc:mga0n895_348108_c1
695 nmdc:mga0n895_564_c1
696 nmdc:mga0n895_667_c1
697 nmdc:mga0n895_8826_c2
698 nmdc:mga0rr50_10845_c1
699 nmdc:mga0rr50_123419_c1
700 nmdc:mga0rr50_185883_c1
701 nmdc:mga0rr50_2092_c1
702 nmdc:mga0rr50_21398_c1
703 nmdc:mga0rr50_26596_c1
704 nmdc:mga0rr50_278720_c1
705 nmdc:mga0rr50_768_c1
706 nmdc:mga0rr50_95124_c1
707 nmdc:mga08x19_22807_c1
708 nmdc:mga08x19_24554_c1
709 nmdc:mga08x19_367_c1
710 nmdc:mga0a205_10704_c1
711 nmdc:mga0a205_125879_c1
712 nmdc:mga0a205_170609_c1
713 nmdc:mga0a205_47236_c1
714 nmdc:mga0a205_52136_c1
715 nmdc:mga0a205_66785_c1
716 nmdc:mga0a205_69177_c1
717 nmdc:mga0a205_7313_c1
718 Ga0495601_0004189
719 Ga0495612_0002912
720 Ga0495619_0021902
721 Ga0501084_0062359
722 Ga0501084_0063106
723 Ga0501084_0091083
724 Ga0501082_0023452
725 Ga0501082_0066426
726 Ga0501082_0251634
727 Ga0530510_0001170
728 Ga0530510_0020955
729 Ga0530510_0092754
730 Ga0530510_0129160

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3jb9-assembly1.cif.gz_U cryo-em structure of the yeast spliceosome at 3.6 angstrom resolution 0.7465 33 274
6p2k-assembly1.cif.gz_B crystal structure of afv00434, an ancestral gh74 enzyme 0.742 5 287
1erj-assembly2.cif.gz_B crystal structure of the c-terminal wd40 domain of tup1 0.7392 50 282
8ewx-assembly2.cif.gz_B n-terminal wd40 domain of beta'-copi subunit with two chains in the asymmetric unit 0.7319 23 269
5yzv-assembly1.cif.gz_B biophysical and structural characterization of the thermostable wd40 domain of a prokaryotic protein, thermomonospora curvata pkwa 0.7297 25 283
ID Description Score Start End Superfamily
af_K7M5A1_178_386_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7815 123 247 2.130.10.10
3ottB01 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7751 7 283 2.130.10.10
af_Q5SQM0_19_321_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7634 26 282 2.130.10.10
af_Q4E4S0_27_142_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7629 120 191 2.130.10.10
af_Q9U0J4_195_468_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7566 50 284 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A6N8YWK6-F1-model_v4 Photosynthesis system II assembly factor Ycf48/Hcf136-like domain-containing protein 0.9295 124 302 GO:0000272
GO:0010411
GO:0016798
AF-A0A432HXV2-F1-model_v4 Sortilin N-terminal domain-containing protein 0.9288 2 154 GO:0010411
AF-A0A2V6WRV0-F1-model_v4 Glycosyl hydrolase 0.9133 123 246
AF-A0A7C7G872-F1-model_v4 Sortilin N-terminal domain-containing protein 0.9075 1 156 GO:0000272
GO:0010411
GO:0016798
AF-A0A537QL35-F1-model_v4 Uncharacterized protein 0.9042 3 83

Map