F423630

General Info

Members Datasets Scaffolds Average Seq Length
365 189 730 256

Family's Representative Sequence

Representative Sequence 3300006847|Ga0075431_100036487|Ga0075431_1000364872
Length 300
Sequence LTDGAALRAEKRLRPERGAEPPSESERGWGPACKHTVPSLELRPLNVLGKFRLDGKVALVTGGARGLGRSMATALAEAGADVAITARTLASCQPAASEVGAATGRTCRAYQVDVTQAADVEQLVAAVEADFGRIDILVNNAGTNIRGPIEQLTEADWDTVVDTNLKGPFLCARAVGPRMVRRGWGRVINLGSVLGAIALAGRAPYASSKAGIINLTRVLALEWAGTGVTANVICPGAFGTEMNRQLLDDPVKYQEFVKRIPMGRWGEPDELGGAAVFLASDASTYVTGSALFVDGGWTAR

Samples

Sample ID Description Type Environment
1 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
44 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
45 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
46 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
47 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
102 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
103 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
105 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
106 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
107 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
108 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
109 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
110 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
111 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
112 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
113 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
114 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
115 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
116 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
117 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
118 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
119 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
120 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
121 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
122 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
123 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
124 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
125 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
126 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
127 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
128 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
129 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
130 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
131 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
132 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
133 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
134 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
149 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
150 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
151 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
152 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
153 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
154 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
155 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
156 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
157 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
158 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
159 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
160 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
161 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
162 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
163 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
166 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
167 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
168 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
169 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
170 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
171 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
172 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
173 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
174 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
175 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
176 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
177 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
178 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
179 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
180 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
181 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
182 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
183 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
184 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
185 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
186 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
187 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
188 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
189 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.75
Nodule 0
Rhizoplane 3.56
Rhizosphere 90.68
Stem 0
Stem Tuber 0
Unclassified 3.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075431_100036487 3300006847 Bacteria 5062
2 Ga0065712_10071827 3300005290 Bacteria 5041
3 Ga0065712_10125834 3300005290 Bacteria 1609
4 Ga0065715_10109153 3300005293 Bacteria 2682
5 Ga0065715_10120823 3300005293 Bacteria 2247
6 Ga0070676_10083382 3300005328 Unclassified 1944
7 Ga0070683_100001890 3300005329 Bacteria 16358
8 Ga0070670_100023900 3300005331 Bacteria 5259
9 Ga0070666_10210676 3300005335 Bacteria 1369
10 Ga0070680_100568681 3300005336 Bacteria 972
11 Ga0068868_100015850 3300005338 Bacteria 5584
12 Ga0068868_100318108 3300005338 Bacteria 1325
13 Ga0070661_100094123 3300005344 Bacteria 2220
14 Ga0070668_100235181 3300005347 Bacteria 1516
15 Ga0070669_100001275 3300005353 Bacteria 18269
16 Ga0070675_100075643 3300005354 Unclassified 2799
17 Ga0070671_100029863 3300005355 Bacteria 4497
18 Ga0070674_100099756 3300005356 Bacteria 2113
19 Ga0070673_100092936 3300005364 Bacteria 2469
20 Ga0070667_100019498 3300005367 Bacteria 5627
21 Ga0070667_100091340 3300005367 Bacteria 2618
22 Ga0070667_100183400 3300005367 Bacteria 1852
23 Ga0070713_100054620 3300005436 Bacteria 3315
24 Ga0070701_10017966 3300005438 Bacteria 3317
25 Ga0070701_10234627 3300005438 Bacteria 1100
26 Ga0070708_100006585 3300005445 Bacteria 9246
27 Ga0070678_100119477 3300005456 Bacteria 2076
28 Ga0070662_100265130 3300005457 Bacteria 1385
29 Ga0068867_100056108 3300005459 Bacteria 2914
30 Ga0070685_10076412 3300005466 Bacteria 1997
31 Ga0070698_100151779 3300005471 Unclassified 2264
32 Ga0070698_100256409 3300005471 Bacteria 1681
33 Ga0070698_100382472 3300005471 Bacteria 1340
34 Ga0070698_100524728 3300005471 Bacteria 1123
35 Ga0070699_100087291 3300005518 Bacteria 2723
36 Ga0070679_100254886 3300005530 Bacteria 1710
37 Ga0070684_100003924 3300005535 Bacteria 11268
38 Ga0070684_100203867 3300005535 Bacteria 1802
39 Ga0070684_100519102 3300005535 Bacteria 1104
40 Ga0070672_100048986 3300005543 Bacteria 3285
41 Ga0070672_100107001 3300005543 Bacteria 2276
42 Ga0070672_100181752 3300005543 Unclassified 1753
43 Ga0070696_100515608 3300005546 Bacteria 953
44 Ga0070693_100090332 3300005547 Bacteria 1845
45 Ga0070665_100057683 3300005548 Bacteria 3893
46 Ga0068855_100183487 3300005563 Bacteria 2365
47 Ga0070664_100005435 3300005564 Bacteria 10227
48 Ga0070664_100153191 3300005564 Bacteria 2036
49 Ga0070664_100476480 3300005564 Unclassified 1148
50 Ga0068852_100610253 3300005616 Bacteria 1096
51 Ga0068859_100788510 3300005617 Bacteria 1038
52 Ga0068861_100016006 3300005719 Bacteria 5296
53 Ga0068870_10257033 3300005840 Bacteria 1085
54 Ga0068858_100073661 3300005842 Bacteria 3170
55 Ga0068858_100671936 3300005842 Bacteria 1007
56 Ga0068860_100125280 3300005843 Bacteria 2462
57 Ga0068862_100043295 3300005844 Bacteria 3838
58 Ga0081455_10280997 3300005937 Bacteria 1202
59 Ga0075365_10004128 3300006038 Bacteria 7636
60 Ga0075365_10013113 3300006038 Bacteria 4943
61 Ga0075363_100093509 3300006048 Bacteria 1657
62 Ga0075364_10004583 3300006051 Bacteria 7960
63 Ga0075364_10024819 3300006051 Bacteria 3810
64 Ga0075362_10005186 3300006177 Bacteria 4748
65 Ga0075367_10004688 3300006178 Bacteria 6712
66 Ga0075366_10000289 3300006195 Bacteria 22512
67 Ga0075366_10046971 3300006195 Bacteria 2559
68 Ga0075366_10123541 3300006195 Bacteria 1560
69 Ga0075428_100025916 3300006844 Bacteria 6494
70 Ga0075428_100201641 3300006844 Bacteria 2151
71 Ga0075428_100465520 3300006844 Bacteria 1353
72 Ga0075430_100009174 3300006846 Bacteria 8359
73 Ga0075430_100011538 3300006846 Bacteria 7511
74 Ga0075430_100012299 3300006846 Bacteria 7282
75 Ga0075430_100226131 3300006846 Bacteria 1552
76 Ga0075431_100011982 3300006847 Bacteria 8748
77 Ga0075431_100031542 3300006847 Bacteria 5459
78 Ga0075431_100090663 3300006847 Bacteria 3155
79 Ga0075433_10026855 3300006852 Bacteria 4879
80 Ga0075433_10038913 3300006852 Bacteria 4110
81 Ga0075433_10071478 3300006852 Bacteria 3050
82 Ga0075434_100002778 3300006871 Bacteria 15486
83 Ga0075434_100014870 3300006871 Bacteria 7445
84 Ga0075429_100008545 3300006880 Bacteria 8907
85 Ga0075429_100009059 3300006880 Bacteria 8644
86 Ga0075429_100342261 3300006880 Unclassified 1309
87 Ga0075436_100022125 3300006914 Bacteria 4366
88 Ga0097620_100788641 3300006931 Bacteria 1038
89 Ga0105240_10694567 3300009093 Bacteria 1111
90 Ga0111539_10000878 3300009094 Bacteria 39274
91 Ga0111539_10002291 3300009094 Bacteria 25481
92 Ga0111539_10023529 3300009094 Bacteria 7569
93 Ga0111539_10241982 3300009094 Bacteria 2101
94 Ga0111539_10325592 3300009094 Bacteria 1789
95 Ga0111539_10777516 3300009094 Bacteria 1114
96 Ga0105245_10133665 3300009098 Bacteria 2329
97 Ga0114129_10004224 3300009147 Bacteria 20296
98 Ga0114129_10016273 3300009147 Bacteria 10585
99 Ga0114129_10155768 3300009147 Bacteria 3124
100 Ga0114129_10245174 3300009147 Bacteria 2407
101 Ga0114129_10395010 3300009147 Bacteria 1823
102 Ga0114129_10409003 3300009147 Bacteria 1787
103 Ga0114129_10529634 3300009147 Bacteria 1535
104 Ga0105241_10280402 3300009174 Bacteria 1423
105 Ga0105248_10060087 3300009177 Bacteria 4267
106 Ga0105248_10370081 3300009177 Bacteria 1613
107 Ga0105237_10206516 3300009545 Bacteria 1964
108 Ga0105249_10206323 3300009553 Bacteria 1926
109 Ga0105249_11140664 3300009553 Bacteria 850
110 Ga0105239_10392999 3300010375 Bacteria 1569
111 Ga0157369_10254026 3300013105 Bacteria 1834
112 Ga0157369_10476094 3300013105 Bacteria 1292
113 Ga0157375_10295454 3300013308 Bacteria 1783
114 Ga0163163_10006453 3300014325 Bacteria 10260
115 Ga0157380_10057989 3300014326 Bacteria 3086
116 Ga0163161_10212050 3300017792 Bacteria 1496
117 Ga0207697_10004456 3300025315 Bacteria 6689
118 Ga0207697_10148531 3300025315 Bacteria 1019
119 Ga0207688_10003814 3300025901 Bacteria 8219
120 Ga0207680_10024680 3300025903 Bacteria 3304
121 Ga0207695_10480761 3300025913 Bacteria 1124
122 Ga0207662_10004899 3300025918 Bacteria 7082
123 Ga0207652_10239789 3300025921 Bacteria 1634
124 Ga0207646_10021316 3300025922 Bacteria 5989
125 Ga0207650_10006732 3300025925 Bacteria 7834
126 Ga0207650_10014198 3300025925 Bacteria 5533
127 Ga0207659_10016558 3300025926 Bacteria 4799
128 Ga0207659_10238604 3300025926 Bacteria 1470
129 Ga0207687_10395798 3300025927 Bacteria 1135
130 Ga0207700_10041123 3300025928 Bacteria 3380
131 Ga0207644_10114863 3300025931 Bacteria 2041
132 Ga0207644_10289413 3300025931 Bacteria 1317
133 Ga0207690_10078527 3300025932 Bacteria 2297
134 Ga0207706_10714682 3300025933 Bacteria 855
135 Ga0207709_10424927 3300025935 Bacteria 1021
136 Ga0207691_10099147 3300025940 Bacteria 2602
137 Ga0207691_10113475 3300025940 Bacteria 2408
138 Ga0207711_10040201 3300025941 Bacteria 3978
139 Ga0207711_10441432 3300025941 Bacteria 1211
140 Ga0207661_10005792 3300025944 Bacteria 8714
141 Ga0207661_10006864 3300025944 Bacteria 8072
142 Ga0207661_10195806 3300025944 Bacteria 1774
143 Ga0207679_10003717 3300025945 Bacteria 9461
144 Ga0207679_10140464 3300025945 Bacteria 1952
145 Ga0207667_10452004 3300025949 Bacteria 1305
146 Ga0207712_10056277 3300025961 Bacteria 2770
147 Ga0207668_10305514 3300025972 Bacteria 1314
148 Ga0207668_10492510 3300025972 Bacteria 1053
149 Ga0207658_10071046 3300025986 Bacteria 2635
150 Ga0207658_10283823 3300025986 Bacteria 1420
151 Ga0207677_10074740 3300026023 Bacteria 2406
152 Ga0207678_10641674 3300026067 Bacteria 932
153 Ga0207648_10071981 3300026089 Bacteria 3013
154 Ga0207676_10494419 3300026095 Bacteria 1161
155 Ga0207674_10006664 3300026116 Bacteria 13564
156 Ga0207674_10382315 3300026116 Bacteria 1361
157 Ga0207675_100022150 3300026118 Bacteria 5916
158 Ga0207675_100032670 3300026118 Bacteria 4847
159 Ga0207683_10514282 3300026121 Bacteria 1106
160 Ga0207698_10712238 3300026142 Bacteria 1000
161 Ga0209813_10006452 3300027866 Bacteria 2898
162 Ga0207428_10000258 3300027907 Bacteria 72616
163 Ga0207428_10001216 3300027907 Bacteria 27630
164 Ga0207428_10123250 3300027907 Bacteria 1986
165 Ga0268265_10140733 3300028380 Bacteria 2020
166 Ga0307408_100470791 3300031548 Bacteria 1094
167 Ga0307408_100617422 3300031548 Unclassified 965
168 Ga0307405_10022107 3300031731 Bacteria 3590
169 Ga0307405_10027562 3300031731 Bacteria 3296
170 Ga0307410_10595182 3300031852 Bacteria 922
171 Ga0307406_10231549 3300031901 Unclassified 1380
172 Ga0307407_10040692 3300031903 Bacteria 2594
173 Ga0307407_10195458 3300031903 Bacteria 1352
174 Ga0307409_100039062 3300031995 Bacteria 3518
175 Ga0307409_100253927 3300031995 Bacteria 1609
176 Ga0307416_100799971 3300032002 Bacteria 1038
177 Ga0307411_10528231 3300032005 Bacteria 1003
178 Ga0307415_100097658 3300032126 Bacteria 2145
179 Ga0373947_0087636 3300035725 Bacteria 1936
180 Ga0439462_0035669 3300042015 Bacteria 1323
181 Ga0453684_0182426 3300044712 Bacteria 2463
182 Ga0451576_0614545 3300045051 Bacteria 1142
183 Ga0495592_0096102 3300046454 Bacteria 2118
184 Ga0495580_0023344 3300046472 Bacteria 4544
185 Ga0495630_0009950 3300046517 Bacteria 6847
186 Ga0495665_0010809 3300046531 Bacteria 4941
187 Ga0495624_0014290 3300046690 Bacteria 5391
188 Ga0495581_0024552 3300047315 Bacteria 3494
189 Ga0495674_0092708 3300047319 Bacteria 2578
190 Ga0495684_0033690 3300047471 Bacteria 3928
191 Ga0496100_0319127 3300048903 Bacteria 1167
192 Ga0496102_0662006 3300048905 Bacteria 967
193 Ga0496104_0008452 3300048907 Bacteria 9153
194 Ga0496104_0734943 3300048907 Bacteria 894
195 Ga0496105_0018920 3300048908 Bacteria 5548
196 Ga0496108_0023883 3300048911 Bacteria 5032
197 Ga0496108_0505432 3300048911 Bacteria 1055
198 Ga0496109_0006031 3300048912 Bacteria 10183
199 Ga0496110_0009933 3300048913 Bacteria 7716
200 Ga0496110_0358678 3300048913 Bacteria 1328
201 Ga0496111_0067182 3300048914 Bacteria 2604
202 Ga0496112_0007929 3300048915 Bacteria 9464
203 Ga0496112_0870049 3300048915 Bacteria 824
204 Ga0501031_0003028 3300049568 Bacteria 10746
205 Ga0501031_0040022 3300049568 Bacteria 3060
206 Ga0501032_0008798 3300049569 Bacteria 7345
207 Ga0501032_0011810 3300049569 Bacteria 6257
208 Ga0501032_0027763 3300049569 Bacteria 3889
209 Ga0501032_0035864 3300049569 Bacteria 3388
210 Ga0501033_0003852 3300049570 Bacteria 12193
211 Ga0501033_0003998 3300049570 Bacteria 11929
212 Ga0501033_0004515 3300049570 Bacteria 11139
213 Ga0501034_0014115 3300049571 Bacteria 8231
214 Ga0501034_0016903 3300049571 Bacteria 7480
215 Ga0501034_0027369 3300049571 Bacteria 5798
216 Ga0501034_0063976 3300049571 Bacteria 3692
217 Ga0501034_0141951 3300049571 Bacteria 2380
218 Ga0501034_0155210 3300049571 Bacteria 2263
219 Ga0501034_0323904 3300049571 Bacteria 1473
220 Ga0501036_0006266 3300049572 Bacteria 9648
221 Ga0501036_0026929 3300049572 Bacteria 4858
222 Ga0501037_0004635 3300049573 Bacteria 9991
223 Ga0501037_0010712 3300049573 Bacteria 6737
224 Ga0501037_0066333 3300049573 Bacteria 2629
225 Ga0501038_0014515 3300049574 Bacteria 7178
226 Ga0501038_0022341 3300049574 Bacteria 5671
227 Ga0501038_0047825 3300049574 Bacteria 3704
228 Ga0501038_0064129 3300049574 Bacteria 3133
229 Ga0501038_0067002 3300049574 Bacteria 3055
230 Ga0501038_0072050 3300049574 Bacteria 2929
231 Ga0501039_0086909 3300049575 Bacteria 2435
232 Ga0501041_0100535 3300049577 Bacteria 1790
233 Ga0501041_0206134 3300049577 Bacteria 1233
234 Ga0501042_0002040 3300049578 Bacteria 12239
235 Ga0501042_0071851 3300049578 Bacteria 2476
236 Ga0501042_0242661 3300049578 Bacteria 1300
237 Ga0501042_0270341 3300049578 Bacteria 1227
238 Ga0501043_0001816 3300049579 Bacteria 18349
239 Ga0501043_0017784 3300049579 Bacteria 5573
240 Ga0501043_0018902 3300049579 Bacteria 5407
241 Ga0501043_0186551 3300049579 Bacteria 1614
242 Ga0501043_0295338 3300049579 Bacteria 1239
243 Ga0501046_0008783 3300049580 Bacteria 8776
244 Ga0501046_0048586 3300049580 Bacteria 3359
245 Ga0501046_0063879 3300049580 Bacteria 2874
246 Ga0501047_0001234 3300049581 Bacteria 25313
247 Ga0501047_0013047 3300049581 Bacteria 7870
248 Ga0501047_0108470 3300049581 Bacteria 2658
249 Ga0501047_0116415 3300049581 Bacteria 2554
250 Ga0501047_0173088 3300049581 Bacteria 2027
251 Ga0501048_0000829 3300049582 Bacteria 22820
252 Ga0501048_0012418 3300049582 Bacteria 6335
253 Ga0501048_0070393 3300049582 Bacteria 2470
254 Ga0501048_0127524 3300049582 Bacteria 1799
255 Ga0501048_0213277 3300049582 Bacteria 1369
256 Ga0501067_0005008 3300049583 Bacteria 7358
257 Ga0501067_0024986 3300049583 Bacteria 3313
258 Ga0501067_0060095 3300049583 Bacteria 2103
259 Ga0501067_0103443 3300049583 Bacteria 1582
260 Ga0501068_0012000 3300049584 Bacteria 4901
261 Ga0501068_0025132 3300049584 Bacteria 3502
262 Ga0501068_0027751 3300049584 Bacteria 3344
263 Ga0501068_0069805 3300049584 Bacteria 2142
264 Ga0501068_0222360 3300049584 Bacteria 1200
265 Ga0501069_0052515 3300049585 Bacteria 2269
266 Ga0501070_0064177 3300049586 Bacteria 3041
267 Ga0501070_0142945 3300049586 Bacteria 1975
268 Ga0501071_0001080 3300049587 Bacteria 15137
269 Ga0501072_0028726 3300049588 Bacteria 4342
270 Ga0501072_0030048 3300049588 Bacteria 4247
271 Ga0501072_0093305 3300049588 Bacteria 2391
272 Ga0501072_0188026 3300049588 Bacteria 1647
273 Ga0501072_0363187 3300049588 Bacteria 1149
274 Ga0501073_0004026 3300049589 Bacteria 11042
275 Ga0501073_0054561 3300049589 Bacteria 2797
276 Ga0501073_0075236 3300049589 Bacteria 2350
277 Ga0501073_0088378 3300049589 Bacteria 2154
278 Ga0501073_0128093 3300049589 Bacteria 1759
279 Ga0501074_0003533 3300049590 Bacteria 11089
280 Ga0501074_0040217 3300049590 Bacteria 3387
281 Ga0501074_0100841 3300049590 Bacteria 2066
282 Ga0501074_0477046 3300049590 Bacteria 884
283 Ga0501075_0098579 3300049591 Bacteria 2219
284 Ga0501076_0049313 3300049592 Bacteria 3330
285 Ga0501076_0173598 3300049592 Bacteria 1757
286 Ga0501076_0235302 3300049592 Bacteria 1498
287 Ga0501076_0284213 3300049592 Bacteria 1355
288 Ga0501076_0332356 3300049592 Bacteria 1247
289 Ga0501077_0037718 3300049593 Bacteria 3077
290 Ga0501077_0153062 3300049593 Bacteria 1463
291 Ga0501079_0010355 3300049741 Bacteria 7086
292 Ga0501079_0044458 3300049741 Bacteria 3427
293 Ga0501079_0086148 3300049741 Bacteria 2431
294 Ga0501079_0276321 3300049741 Bacteria 1313
295 Ga0501080_0003906 3300049742 Bacteria 13200
296 Ga0501080_0028763 3300049742 Bacteria 5174
297 Ga0501080_0076774 3300049742 Bacteria 3106
298 Ga0501081_0084048 3300049743 Bacteria 2232
299 Ga0501081_0155603 3300049743 Bacteria 1644
300 Ga0501081_0205492 3300049743 Unclassified 1429
301 Ga0501083_0002664 3300049744 Bacteria 12293
302 Ga0501083_0021181 3300049744 Bacteria 4518
303 Ga0501083_0163743 3300049744 Bacteria 1454
304 Ga0501035_0003325 3300049822 Bacteria 15403
305 Ga0501035_0003720 3300049822 Bacteria 14542
306 Ga0501035_0016193 3300049822 Bacteria 6880
307 Ga0501044_0017417 3300049823 Bacteria 7707
308 Ga0501044_0047561 3300049823 Bacteria 4436
309 Ga0501044_0299739 3300049823 Bacteria 1536
310 Ga0501044_0426539 3300049823 Bacteria 1235
311 Ga0501045_0000639 3300049824 Bacteria 22162
312 Ga0501045_0028668 3300049824 Bacteria 4017
313 Ga0501045_0048224 3300049824 Bacteria 3105
314 Ga0501045_0235028 3300049824 Bacteria 1364
315 nmdc:mga03683_63481_c1 3300050489 Bacteria 1268
316 nmdc:mga00v17_11834_c1 3300050491 Bacteria 4800
317 nmdc:mga00v17_5875_c1 3300050491 Bacteria 6483
318 nmdc:mga0k408_35231_c1 3300050493 Bacteria 2870
319 nmdc:mga06z11_102952_c1 3300050494 Bacteria 1569
320 nmdc:mga06z11_8996_c1 3300050494 Bacteria 4193
321 nmdc:mga07m45_16820_c1 3300050496 Bacteria 3918
322 nmdc:mga07m45_372622_c1 3300050496 Bacteria 829
323 nmdc:mga05p37_102361_c1 3300050507 Unclassified 3527
324 nmdc:mga05p37_137058_c1 3300050507 Bacteria 3000
325 nmdc:mga05p37_24914_c1 3300050507 Bacteria 7273
326 nmdc:mga05p37_309359_c1 3300050507 Bacteria 1873
327 nmdc:mga05p37_3178_c1 3300050507 Bacteria 19109
328 nmdc:mga05p37_58882_c1 3300050507 Bacteria 4731
329 nmdc:mga09592_283261_c1 3300050508 Unclassified 1437
330 nmdc:mga0qj67_127543_c1 3300050509 Bacteria 2059
331 nmdc:mga0qj67_291751_c1 3300050509 Bacteria 1322
332 nmdc:mga0qj67_406269_c1 3300050509 Bacteria 1099
333 nmdc:mga0qj67_86369_c1 3300050509 Bacteria 2517
334 nmdc:mga06r32_354366_c1 3300050510 Unclassified 1452
335 nmdc:mga06r32_78386_c1 3300050510 Bacteria 3211
336 nmdc:mga08y16_265510_c1 3300050511 Bacteria 1772
337 nmdc:mga08y16_615756_c1 3300050511 Bacteria 1093
338 nmdc:mga08y16_7098_c1 3300050511 Bacteria 11758
339 nmdc:mga08y16_769_c1 3300050511 Bacteria 30542
340 nmdc:mga08y16_920777_c1 3300050511 Bacteria 859
341 nmdc:mga0n895_142210_c1 3300050512 Bacteria 2428
342 nmdc:mga0n895_2025_c1 3300050512 Bacteria 15592
343 nmdc:mga0n895_79810_c1 3300050512 Bacteria 3259
344 nmdc:mga0rr50_388809_c1 3300050513 Bacteria 1177
345 nmdc:mga08x19_444558_c1 3300050514 Bacteria 912
346 nmdc:mga0a205_17784_c1 3300050515 Bacteria 6670
347 nmdc:mga0a205_237803_c1 3300050515 Bacteria 1703
348 nmdc:mga0a205_29481_c1 3300050515 Bacteria 5251
349 Ga0495619_0274215 3300053085 Bacteria 1169
350 Ga0500641_0119104 3300053096 Bacteria 1137
351 Ga0500628_058827 3300053129 Bacteria 933
352 Ga0501084_0009926 3300054114 Bacteria 7870
353 Ga0501084_0012702 3300054114 Bacteria 6977
354 Ga0501084_0246653 3300054114 Bacteria 1508
355 Ga0501084_0247096 3300054114 Bacteria 1506
356 Ga0501084_0454637 3300054114 Bacteria 1082
357 Ga0590071_000234 3300059421 Bacteria 16221
358 Ga0590074_005875 3300059423 Bacteria 2037
359 Ga0590075_000039 3300059424 Bacteria 33839
360 Ga0590077_000687 3300059426 Bacteria 8987
361 Ga0501082_0002988 3300060353 Bacteria 14764
362 Ga0501082_0020698 3300060353 Bacteria 5670
363 Ga0501082_0021120 3300060353 Bacteria 5614
364 Ga0501082_0071991 3300060353 Bacteria 2977
365 Ga0530510_0459932 3300061734 Bacteria 963
366 Ga0075431_100036487
367 Ga0065712_10071827
368 Ga0065712_10125834
369 Ga0065715_10109153
370 Ga0065715_10120823
371 Ga0070676_10083382
372 Ga0070683_100001890
373 Ga0070670_100023900
374 Ga0070666_10210676
375 Ga0070680_100568681
376 Ga0068868_100015850
377 Ga0068868_100318108
378 Ga0070661_100094123
379 Ga0070668_100235181
380 Ga0070669_100001275
381 Ga0070675_100075643
382 Ga0070671_100029863
383 Ga0070674_100099756
384 Ga0070673_100092936
385 Ga0070667_100019498
386 Ga0070667_100091340
387 Ga0070667_100183400
388 Ga0070713_100054620
389 Ga0070701_10017966
390 Ga0070701_10234627
391 Ga0070708_100006585
392 Ga0070678_100119477
393 Ga0070662_100265130
394 Ga0068867_100056108
395 Ga0070685_10076412
396 Ga0070698_100151779
397 Ga0070698_100256409
398 Ga0070698_100382472
399 Ga0070698_100524728
400 Ga0070699_100087291
401 Ga0070679_100254886
402 Ga0070684_100003924
403 Ga0070684_100203867
404 Ga0070684_100519102
405 Ga0070672_100048986
406 Ga0070672_100107001
407 Ga0070672_100181752
408 Ga0070696_100515608
409 Ga0070693_100090332
410 Ga0070665_100057683
411 Ga0068855_100183487
412 Ga0070664_100005435
413 Ga0070664_100153191
414 Ga0070664_100476480
415 Ga0068852_100610253
416 Ga0068859_100788510
417 Ga0068861_100016006
418 Ga0068870_10257033
419 Ga0068858_100073661
420 Ga0068858_100671936
421 Ga0068860_100125280
422 Ga0068862_100043295
423 Ga0081455_10280997
424 Ga0075365_10004128
425 Ga0075365_10013113
426 Ga0075363_100093509
427 Ga0075364_10004583
428 Ga0075364_10024819
429 Ga0075362_10005186
430 Ga0075367_10004688
431 Ga0075366_10000289
432 Ga0075366_10046971
433 Ga0075366_10123541
434 Ga0075428_100025916
435 Ga0075428_100201641
436 Ga0075428_100465520
437 Ga0075430_100009174
438 Ga0075430_100011538
439 Ga0075430_100012299
440 Ga0075430_100226131
441 Ga0075431_100011982
442 Ga0075431_100031542
443 Ga0075431_100090663
444 Ga0075433_10026855
445 Ga0075433_10038913
446 Ga0075433_10071478
447 Ga0075434_100002778
448 Ga0075434_100014870
449 Ga0075429_100008545
450 Ga0075429_100009059
451 Ga0075429_100342261
452 Ga0075436_100022125
453 Ga0097620_100788641
454 Ga0105240_10694567
455 Ga0111539_10000878
456 Ga0111539_10002291
457 Ga0111539_10023529
458 Ga0111539_10241982
459 Ga0111539_10325592
460 Ga0111539_10777516
461 Ga0105245_10133665
462 Ga0114129_10004224
463 Ga0114129_10016273
464 Ga0114129_10155768
465 Ga0114129_10245174
466 Ga0114129_10395010
467 Ga0114129_10409003
468 Ga0114129_10529634
469 Ga0105241_10280402
470 Ga0105248_10060087
471 Ga0105248_10370081
472 Ga0105237_10206516
473 Ga0105249_10206323
474 Ga0105249_11140664
475 Ga0105239_10392999
476 Ga0157369_10254026
477 Ga0157369_10476094
478 Ga0157375_10295454
479 Ga0163163_10006453
480 Ga0157380_10057989
481 Ga0163161_10212050
482 Ga0207697_10004456
483 Ga0207697_10148531
484 Ga0207688_10003814
485 Ga0207680_10024680
486 Ga0207695_10480761
487 Ga0207662_10004899
488 Ga0207652_10239789
489 Ga0207646_10021316
490 Ga0207650_10006732
491 Ga0207650_10014198
492 Ga0207659_10016558
493 Ga0207659_10238604
494 Ga0207687_10395798
495 Ga0207700_10041123
496 Ga0207644_10114863
497 Ga0207644_10289413
498 Ga0207690_10078527
499 Ga0207706_10714682
500 Ga0207709_10424927
501 Ga0207691_10099147
502 Ga0207691_10113475
503 Ga0207711_10040201
504 Ga0207711_10441432
505 Ga0207661_10005792
506 Ga0207661_10006864
507 Ga0207661_10195806
508 Ga0207679_10003717
509 Ga0207679_10140464
510 Ga0207667_10452004
511 Ga0207712_10056277
512 Ga0207668_10305514
513 Ga0207668_10492510
514 Ga0207658_10071046
515 Ga0207658_10283823
516 Ga0207677_10074740
517 Ga0207678_10641674
518 Ga0207648_10071981
519 Ga0207676_10494419
520 Ga0207674_10006664
521 Ga0207674_10382315
522 Ga0207675_100022150
523 Ga0207675_100032670
524 Ga0207683_10514282
525 Ga0207698_10712238
526 Ga0209813_10006452
527 Ga0207428_10000258
528 Ga0207428_10001216
529 Ga0207428_10123250
530 Ga0268265_10140733
531 Ga0307408_100470791
532 Ga0307408_100617422
533 Ga0307405_10022107
534 Ga0307405_10027562
535 Ga0307410_10595182
536 Ga0307406_10231549
537 Ga0307407_10040692
538 Ga0307407_10195458
539 Ga0307409_100039062
540 Ga0307409_100253927
541 Ga0307416_100799971
542 Ga0307411_10528231
543 Ga0307415_100097658
544 Ga0373947_0087636
545 Ga0439462_0035669
546 Ga0453684_0182426
547 Ga0451576_0614545
548 Ga0495592_0096102
549 Ga0495580_0023344
550 Ga0495630_0009950
551 Ga0495665_0010809
552 Ga0495624_0014290
553 Ga0495581_0024552
554 Ga0495674_0092708
555 Ga0495684_0033690
556 Ga0496100_0319127
557 Ga0496102_0662006
558 Ga0496104_0008452
559 Ga0496104_0734943
560 Ga0496105_0018920
561 Ga0496108_0023883
562 Ga0496108_0505432
563 Ga0496109_0006031
564 Ga0496110_0009933
565 Ga0496110_0358678
566 Ga0496111_0067182
567 Ga0496112_0007929
568 Ga0496112_0870049
569 Ga0501031_0003028
570 Ga0501031_0040022
571 Ga0501032_0008798
572 Ga0501032_0011810
573 Ga0501032_0027763
574 Ga0501032_0035864
575 Ga0501033_0003852
576 Ga0501033_0003998
577 Ga0501033_0004515
578 Ga0501034_0014115
579 Ga0501034_0016903
580 Ga0501034_0027369
581 Ga0501034_0063976
582 Ga0501034_0141951
583 Ga0501034_0155210
584 Ga0501034_0323904
585 Ga0501036_0006266
586 Ga0501036_0026929
587 Ga0501037_0004635
588 Ga0501037_0010712
589 Ga0501037_0066333
590 Ga0501038_0014515
591 Ga0501038_0022341
592 Ga0501038_0047825
593 Ga0501038_0064129
594 Ga0501038_0067002
595 Ga0501038_0072050
596 Ga0501039_0086909
597 Ga0501041_0100535
598 Ga0501041_0206134
599 Ga0501042_0002040
600 Ga0501042_0071851
601 Ga0501042_0242661
602 Ga0501042_0270341
603 Ga0501043_0001816
604 Ga0501043_0017784
605 Ga0501043_0018902
606 Ga0501043_0186551
607 Ga0501043_0295338
608 Ga0501046_0008783
609 Ga0501046_0048586
610 Ga0501046_0063879
611 Ga0501047_0001234
612 Ga0501047_0013047
613 Ga0501047_0108470
614 Ga0501047_0116415
615 Ga0501047_0173088
616 Ga0501048_0000829
617 Ga0501048_0012418
618 Ga0501048_0070393
619 Ga0501048_0127524
620 Ga0501048_0213277
621 Ga0501067_0005008
622 Ga0501067_0024986
623 Ga0501067_0060095
624 Ga0501067_0103443
625 Ga0501068_0012000
626 Ga0501068_0025132
627 Ga0501068_0027751
628 Ga0501068_0069805
629 Ga0501068_0222360
630 Ga0501069_0052515
631 Ga0501070_0064177
632 Ga0501070_0142945
633 Ga0501071_0001080
634 Ga0501072_0028726
635 Ga0501072_0030048
636 Ga0501072_0093305
637 Ga0501072_0188026
638 Ga0501072_0363187
639 Ga0501073_0004026
640 Ga0501073_0054561
641 Ga0501073_0075236
642 Ga0501073_0088378
643 Ga0501073_0128093
644 Ga0501074_0003533
645 Ga0501074_0040217
646 Ga0501074_0100841
647 Ga0501074_0477046
648 Ga0501075_0098579
649 Ga0501076_0049313
650 Ga0501076_0173598
651 Ga0501076_0235302
652 Ga0501076_0284213
653 Ga0501076_0332356
654 Ga0501077_0037718
655 Ga0501077_0153062
656 Ga0501079_0010355
657 Ga0501079_0044458
658 Ga0501079_0086148
659 Ga0501079_0276321
660 Ga0501080_0003906
661 Ga0501080_0028763
662 Ga0501080_0076774
663 Ga0501081_0084048
664 Ga0501081_0155603
665 Ga0501081_0205492
666 Ga0501083_0002664
667 Ga0501083_0021181
668 Ga0501083_0163743
669 Ga0501035_0003325
670 Ga0501035_0003720
671 Ga0501035_0016193
672 Ga0501044_0017417
673 Ga0501044_0047561
674 Ga0501044_0299739
675 Ga0501044_0426539
676 Ga0501045_0000639
677 Ga0501045_0028668
678 Ga0501045_0048224
679 Ga0501045_0235028
680 nmdc:mga03683_63481_c1
681 nmdc:mga00v17_11834_c1
682 nmdc:mga00v17_5875_c1
683 nmdc:mga0k408_35231_c1
684 nmdc:mga06z11_102952_c1
685 nmdc:mga06z11_8996_c1
686 nmdc:mga07m45_16820_c1
687 nmdc:mga07m45_372622_c1
688 nmdc:mga05p37_102361_c1
689 nmdc:mga05p37_137058_c1
690 nmdc:mga05p37_24914_c1
691 nmdc:mga05p37_309359_c1
692 nmdc:mga05p37_3178_c1
693 nmdc:mga05p37_58882_c1
694 nmdc:mga09592_283261_c1
695 nmdc:mga0qj67_127543_c1
696 nmdc:mga0qj67_291751_c1
697 nmdc:mga0qj67_406269_c1
698 nmdc:mga0qj67_86369_c1
699 nmdc:mga06r32_354366_c1
700 nmdc:mga06r32_78386_c1
701 nmdc:mga08y16_265510_c1
702 nmdc:mga08y16_615756_c1
703 nmdc:mga08y16_7098_c1
704 nmdc:mga08y16_769_c1
705 nmdc:mga08y16_920777_c1
706 nmdc:mga0n895_142210_c1
707 nmdc:mga0n895_2025_c1
708 nmdc:mga0n895_79810_c1
709 nmdc:mga0rr50_388809_c1
710 nmdc:mga08x19_444558_c1
711 nmdc:mga0a205_17784_c1
712 nmdc:mga0a205_237803_c1
713 nmdc:mga0a205_29481_c1
714 Ga0495619_0274215
715 Ga0500641_0119104
716 Ga0500628_058827
717 Ga0501084_0009926
718 Ga0501084_0012702
719 Ga0501084_0246653
720 Ga0501084_0247096
721 Ga0501084_0454637
722 Ga0590071_000234
723 Ga0590074_005875
724 Ga0590075_000039
725 Ga0590077_000687
726 Ga0501082_0002988
727 Ga0501082_0020698
728 Ga0501082_0021120
729 Ga0501082_0071991
730 Ga0530510_0459932

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

56

250

0.99

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

62

298

0.97

PF08659

KR

KR domain

56

237

0.86

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

58

249

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
5u9p-assembly1.cif.gz_C crystal structure of a gluconate 5-dehydrogenase from burkholderia cenocepacia j2315 in complex with nadp and tartrate 0.9678 5 241
4g81-assembly1.cif.gz_D error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9658 10 241
3awd-assembly1.cif.gz_D crystal structure of gox2181 0.9642 9 241
3osu-assembly1.cif.gz_A crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus 0.9637 15 238
4ibo-assembly1.cif.gz_C crystal structure of a putative gluconate dehydrogenase from agrobacterium tumefaciens (target efi-506446) 0.9626 9 241
ID Description Score Start End Superfamily
af_P76633_10_261_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9746 7 241 3.40.50.720
4iboB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9743 9 241 3.40.50.720
af_Q0JDU3_1_168_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9616 73 238 3.40.50.720
2cfcD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9609 15 241 3.40.50.720
af_B7FAC8_69_312_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9586 15 238 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A852YH60-F1-model_v4 Gluconate 5-dehydrogenase (EC 1.1.1.69) 0.9834 52 241 GO:0016616
AF-A0A2D9K2I8-F1-model_v4 Short-chain dehydrogenase 0.9824 10 240 GO:0016616
AF-A0A1V5ZM83-F1-model_v4 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase (EC 1.1.1.127) 0.9816 4 241 GO:0006633
GO:0047001
GO:0048038
AF-A0A1F7LDS5-F1-model_v4 2-deoxy-D-gluconate 3-dehydrogenase 0.9812 11 241 GO:0016616
AF-A0A2E1RRM8-F1-model_v4 Short-chain dehydrogenase 0.9812 10 238

Map