F423600

General Info

Members Datasets Scaffolds Average Seq Length
365 225 365 231

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_100000047|Ga0070699_10000004741
Length 261
Sequence VRSEISVTSAYSASSAVERSGDRGMAETLINLVQVTKHYRRDTIDIPVLDNIDLEISRGEFLALMGPSGSGKTTLLNLIAGIDKPNSGRVVIDGNDIAKFNEQQLAKWRARHVGFIFQLYNLIPVLSAFENVELPLLLTNLSKKKRRDHVMTALSVVGLEDREHHYPRQLSGGQEQRVAIARAIVTDPSLLVADEPTGDLDAKSAEEILDLIKRLNEEFHKTIIMVTHDPRAASHAHAVLHLEKGLLSKSGGVYEVPAAHH

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
88 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
140 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
141 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
142 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
143 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
144 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
145 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
146 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
147 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
148 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
149 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
153 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
154 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
155 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
156 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
157 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
158 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
159 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
160 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
161 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
162 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
163 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
164 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
165 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
166 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
167 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
168 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
169 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
170 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
171 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
172 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
173 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
174 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
175 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
176 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
177 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
180 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
181 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
196 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
197 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
198 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
199 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
200 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
201 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
202 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
203 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
204 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
205 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
208 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
209 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
210 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
211 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
212 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
213 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
214 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
215 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
216 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
217 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
218 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
219 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
220 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
221 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
222 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
223 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
224 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
225 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.55
Nodule 0
Rhizoplane 1.1
Rhizosphere 97.53
Stem 0
Stem Tuber 0
Unclassified 0.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10030931 3300003320 Bacteria 1307
2 Ga0065704_10100669 3300005289 Bacteria 2266
3 Ga0065707_10180229 3300005295 Bacteria 1421
4 Ga0070658_10024126 3300005327 Bacteria 4881
5 Ga0070658_10158069 3300005327 Bacteria 1900
6 Ga0070676_10054350 3300005328 Bacteria 2361
7 Ga0070690_100023631 3300005330 Bacteria 3771
8 Ga0070690_100713383 3300005330 Bacteria 771
9 Ga0070670_100001428 3300005331 Bacteria 19220
10 Ga0070670_100314527 3300005331 Bacteria 1371
11 Ga0068869_100232876 3300005334 Bacteria 1464
12 Ga0070666_10043683 3300005335 Bacteria 3001
13 Ga0070680_100296848 3300005336 Bacteria 1370
14 Ga0070682_100025618 3300005337 Bacteria 3521
15 Ga0068868_100003349 3300005338 Bacteria 11151
16 Ga0068868_100021836 3300005338 Bacteria 4824
17 Ga0070660_100004982 3300005339 Bacteria 9180
18 Ga0070687_100461161 3300005343 Bacteria 847
19 Ga0070661_100044411 3300005344 Bacteria 3247
20 Ga0070671_100003745 3300005355 Bacteria 11942
21 Ga0070671_100204923 3300005355 Bacteria 1673
22 Ga0070674_100057663 3300005356 Bacteria 2696
23 Ga0070673_100386503 3300005364 Bacteria 1249
24 Ga0070667_100044096 3300005367 Bacteria 3744
25 Ga0070703_10000019 3300005406 Bacteria 78652
26 Ga0070709_10000023 3300005434 Bacteria 132636
27 Ga0070709_10000160 3300005434 Bacteria 43304
28 Ga0070714_100004185 3300005435 Bacteria 10861
29 Ga0070713_100191980 3300005436 Bacteria 1841
30 Ga0070710_10053286 3300005437 Bacteria 2278
31 Ga0070710_10464858 3300005437 Bacteria 860
32 Ga0070711_100000003 3300005439 Bacteria 192172
33 Ga0070711_100210942 3300005439 Bacteria 1504
34 Ga0070705_100001088 3300005440 Bacteria 15092
35 Ga0070705_100003943 3300005440 Bacteria 7255
36 Ga0070694_100722604 3300005444 Bacteria 811
37 Ga0070708_100004792 3300005445 Bacteria 10668
38 Ga0070708_100181778 3300005445 Bacteria 1966
39 Ga0070708_100231703 3300005445 Bacteria 1733
40 Ga0070681_10016320 3300005458 Bacteria 7412
41 Ga0070681_10041191 3300005458 Bacteria 4628
42 Ga0070681_10069538 3300005458 Bacteria 3487
43 Ga0070681_10096467 3300005458 Bacteria 2905
44 Ga0070681_10450211 3300005458 Bacteria 1199
45 Ga0068867_100079163 3300005459 Bacteria 2473
46 Ga0070685_10210854 3300005466 Bacteria 1268
47 Ga0070706_100000163 3300005467 Bacteria 84827
48 Ga0070706_100124046 3300005467 Bacteria 2408
49 Ga0070706_100140979 3300005467 Bacteria 2250
50 Ga0070706_100444434 3300005467 Bacteria 1207
51 Ga0070707_100079372 3300005468 Bacteria 3167
52 Ga0070698_100063420 3300005471 Bacteria 3726
53 Ga0070699_100000047 3300005518 Bacteria 122138
54 Ga0070699_100009601 3300005518 Bacteria 8384
55 Ga0070699_100098040 3300005518 Bacteria 2568
56 Ga0070679_100009980 3300005530 Bacteria 8988
57 Ga0070679_100014860 3300005530 Bacteria 7479
58 Ga0070679_100078636 3300005530 Bacteria 3287
59 Ga0070684_100269429 3300005535 Bacteria 1558
60 Ga0068853_100029151 3300005539 Bacteria 4650
61 Ga0070672_100375293 3300005543 Bacteria 1216
62 Ga0070695_100019168 3300005545 Bacteria 4162
63 Ga0070695_100256589 3300005545 Bacteria 1275
64 Ga0070695_100511646 3300005545 Bacteria 930
65 Ga0070696_100000054 3300005546 Bacteria 53566
66 Ga0070696_100052921 3300005546 Bacteria 2825
67 Ga0070696_100110462 3300005546 Bacteria 1979
68 Ga0070693_100030883 3300005547 Bacteria 2932
69 Ga0070665_100425025 3300005548 Bacteria 1337
70 Ga0070665_100571661 3300005548 Bacteria 1143
71 Ga0070704_100005143 3300005549 Bacteria 7602
72 Ga0070704_100011357 3300005549 Bacteria 5456
73 Ga0070704_100017746 3300005549 Bacteria 4535
74 Ga0070704_100029112 3300005549 Bacteria 3683
75 Ga0070704_100327254 3300005549 Bacteria 1286
76 Ga0070704_100354093 3300005549 Bacteria 1240
77 Ga0068855_100007551 3300005563 Bacteria 13155
78 Ga0068855_100014514 3300005563 Bacteria 9488
79 Ga0070664_100098880 3300005564 Bacteria 2535
80 Ga0068856_100592193 3300005614 Bacteria 1130
81 Ga0070702_100044002 3300005615 Bacteria 2519
82 Ga0068859_101323525 3300005617 Bacteria 794
83 Ga0068864_100002006 3300005618 Bacteria 16766
84 Ga0068864_100053255 3300005618 Bacteria 3490
85 Ga0068861_100056369 3300005719 Bacteria 2999
86 Ga0068861_100281231 3300005719 Bacteria 1433
87 Ga0068861_100290741 3300005719 Bacteria 1411
88 Ga0068861_100365590 3300005719 Bacteria 1270
89 Ga0068851_10373859 3300005834 Bacteria 834
90 Ga0068870_10012323 3300005840 Bacteria 3993
91 Ga0068863_100006569 3300005841 Bacteria 11412
92 Ga0068858_100001426 3300005842 Bacteria 24563
93 Ga0068858_100026425 3300005842 Bacteria 5393
94 Ga0068860_100011993 3300005843 Bacteria 8537
95 Ga0068860_100024131 3300005843 Bacteria 5880
96 Ga0068860_100063731 3300005843 Bacteria 3500
97 Ga0068862_100257300 3300005844 Bacteria 1592
98 Ga0068862_100763471 3300005844 Bacteria 942
99 Ga0081455_10377982 3300005937 Bacteria 990
100 Ga0070716_100011417 3300006173 Bacteria 4471
101 Ga0070716_100031810 3300006173 Bacteria 2873
102 Ga0070716_100092961 3300006173 Bacteria 1830
103 Ga0070712_100655536 3300006175 Bacteria 892
104 Ga0068871_100258378 3300006358 Bacteria 1519
105 Ga0068871_100263914 3300006358 Bacteria 1503
106 Ga0068871_100370239 3300006358 Bacteria 1271
107 Ga0075428_100022893 3300006844 Bacteria 6914
108 Ga0075428_100075622 3300006844 Bacteria 3677
109 Ga0075430_100006633 3300006846 Bacteria 9758
110 Ga0075430_100061750 3300006846 Bacteria 3148
111 Ga0075431_100089542 3300006847 Bacteria 3176
112 Ga0075431_100106667 3300006847 Bacteria 2890
113 Ga0075431_100322036 3300006847 Bacteria 1559
114 Ga0075433_10141470 3300006852 Bacteria 2138
115 Ga0075433_10145506 3300006852 Bacteria 2107
116 Ga0075434_100031489 3300006871 Bacteria 5230
117 Ga0075434_100065833 3300006871 Bacteria 3609
118 Ga0075434_100467148 3300006871 Bacteria 1283
119 Ga0075429_100012811 3300006880 Bacteria 7275
120 Ga0075429_100124441 3300006880 Bacteria 2255
121 Ga0075429_100808121 3300006880 Bacteria 821
122 Ga0075436_100003042 3300006914 Bacteria 11494
123 Ga0075436_100164260 3300006914 Bacteria 1566
124 Ga0097620_101323915 3300006931 Bacteria 794
125 Ga0075435_100123053 3300007076 Bacteria 2166
126 Ga0075435_100336298 3300007076 Bacteria 1294
127 Ga0105240_10009647 3300009093 Bacteria 13651
128 Ga0105240_10022510 3300009093 Bacteria 8351
129 Ga0105240_10064997 3300009093 Bacteria 4530
130 Ga0105240_10275050 3300009093 Bacteria 1937
131 Ga0111539_10065329 3300009094 Bacteria 4299
132 Ga0111539_10093423 3300009094 Bacteria 3534
133 Ga0111539_10114707 3300009094 Bacteria 3160
134 Ga0111539_10269724 3300009094 Bacteria 1981
135 Ga0105247_10036213 3300009101 Bacteria 3009
136 Ga0114129_10000501 3300009147 Bacteria 47657
137 Ga0114129_10026282 3300009147 Bacteria 8245
138 Ga0114129_10062943 3300009147 Bacteria 5182
139 Ga0114129_10108005 3300009147 Bacteria 3843
140 Ga0114129_10148464 3300009147 Bacteria 3210
141 Ga0114129_10211567 3300009147 Bacteria 2621
142 Ga0105242_10205054 3300009176 Bacteria 1753
143 Ga0105248_10010835 3300009177 Bacteria 10066
144 Ga0105248_10297647 3300009177 Bacteria 1817
145 Ga0105248_10541661 3300009177 Bacteria 1313
146 Ga0105238_10015998 3300009551 Bacteria 7588
147 Ga0105238_10031650 3300009551 Bacteria 5385
148 Ga0105238_10213421 3300009551 Unclassified 1906
149 Ga0105238_10251059 3300009551 Bacteria 1747
150 Ga0105249_10155865 3300009553 Bacteria 2202
151 Ga0105249_10704226 3300009553 Bacteria 1070
152 Ga0105249_10841954 3300009553 Bacteria 983
153 Ga0157370_10062633 3300013104 Bacteria 3527
154 Ga0157370_10277234 3300013104 Bacteria 1549
155 Ga0157378_10413700 3300013297 Bacteria 1331
156 Ga0157372_10055738 3300013307 Bacteria 4415
157 Ga0157375_10002961 3300013308 Bacteria 14745
158 Ga0157375_10303789 3300013308 Bacteria 1759
159 Ga0157375_10447759 3300013308 Bacteria 1457
160 Ga0163163_10022236 3300014325 Bacteria 6000
161 Ga0163163_10064340 3300014325 Bacteria 3639
162 Ga0163163_10185423 3300014325 Bacteria 2128
163 Ga0157380_10004231 3300014326 Bacteria 9929
164 Ga0157379_10059368 3300014968 Bacteria 3420
165 Ga0157379_10289859 3300014968 Bacteria 1490
166 Ga0157376_10015523 3300014969 Bacteria 5755
167 Ga0157376_10237063 3300014969 Bacteria 1698
168 Ga0213872_10000369 3300021361 Bacteria 37812
169 Ga0207653_10000158 3300025885 Bacteria 48014
170 Ga0207653_10001889 3300025885 Bacteria 6703
171 Ga0207710_10035008 3300025900 Bacteria 2209
172 Ga0207680_10011510 3300025903 Bacteria 4474
173 Ga0207685_10344413 3300025905 Bacteria 750
174 Ga0207699_10000008 3300025906 Bacteria 358402
175 Ga0207699_10000118 3300025906 Bacteria 55994
176 Ga0207645_10028715 3300025907 Bacteria 3590
177 Ga0207705_10084940 3300025909 Bacteria 2312
178 Ga0207705_10231911 3300025909 Bacteria 1404
179 Ga0207684_10000048 3300025910 Bacteria 241098
180 Ga0207684_10007389 3300025910 Bacteria 9897
181 Ga0207684_10056813 3300025910 Bacteria 3321
182 Ga0207684_10311746 3300025910 Bacteria 1356
183 Ga0207684_10437307 3300025910 Bacteria 1124
184 Ga0207654_10216444 3300025911 Bacteria 1268
185 Ga0207707_10031315 3300025912 Bacteria 4654
186 Ga0207707_10041951 3300025912 Bacteria 3995
187 Ga0207707_10077124 3300025912 Bacteria 2908
188 Ga0207707_10429533 3300025912 Bacteria 1132
189 Ga0207695_10000680 3300025913 Bacteria 66673
190 Ga0207695_10007134 3300025913 Bacteria 14302
191 Ga0207695_10047613 3300025913 Bacteria 4535
192 Ga0207695_10090303 3300025913 Bacteria 3079
193 Ga0207695_10625936 3300025913 Bacteria 957
194 Ga0207695_10674953 3300025913 Bacteria 914
195 Ga0207671_10376382 3300025914 Bacteria 1128
196 Ga0207663_10000006 3300025916 Bacteria 253740
197 Ga0207663_10095779 3300025916 Bacteria 1981
198 Ga0207660_10384506 3300025917 Bacteria 1128
199 Ga0207662_10021516 3300025918 Bacteria 3687
200 Ga0207657_10004213 3300025919 Bacteria 15233
201 Ga0207649_10087051 3300025920 Bacteria 2037
202 Ga0207652_10127769 3300025921 Bacteria 2265
203 Ga0207652_10159853 3300025921 Bacteria 2019
204 Ga0207646_10003863 3300025922 Bacteria 16637
205 Ga0207646_10314331 3300025922 Bacteria 1415
206 Ga0207681_10042991 3300025923 Bacteria 3022
207 Ga0207681_10049813 3300025923 Bacteria 2833
208 Ga0207694_10102954 3300025924 Bacteria 2264
209 Ga0207687_10099118 3300025927 Bacteria 2141
210 Ga0207700_10146700 3300025928 Bacteria 1945
211 Ga0207664_10000024 3300025929 Bacteria 199974
212 Ga0207644_10253557 3300025931 Bacteria 1405
213 Ga0207690_10061148 3300025932 Bacteria 2559
214 Ga0207690_10109160 3300025932 Bacteria 1990
215 Ga0207669_10215409 3300025937 Bacteria 1405
216 Ga0207665_10032902 3300025939 Bacteria 3434
217 Ga0207691_10092948 3300025940 Bacteria 2701
218 Ga0207711_10016506 3300025941 Bacteria 6134
219 Ga0207711_10404429 3300025941 Bacteria 1269
220 Ga0207679_10024176 3300025945 Bacteria 4163
221 Ga0207667_10006536 3300025949 Bacteria 14097
222 Ga0207667_10063329 3300025949 Bacteria 3864
223 Ga0207651_10643883 3300025960 Bacteria 930
224 Ga0207712_10127917 3300025961 Bacteria 1931
225 Ga0207658_10860824 3300025986 Bacteria 824
226 Ga0207677_10053379 3300026023 Bacteria 2751
227 Ga0207703_10074504 3300026035 Bacteria 2811
228 Ga0207639_10010161 3300026041 Bacteria 6514
229 Ga0207702_10100724 3300026078 Bacteria 2549
230 Ga0207641_10029690 3300026088 Bacteria 4522
231 Ga0207648_10005963 3300026089 Bacteria 12184
232 Ga0207676_10026382 3300026095 Bacteria 4322
233 Ga0207675_100523147 3300026118 Bacteria 1183
234 Ga0207698_10244755 3300026142 Bacteria 1637
235 Ga0209983_1002983 3300027665 Bacteria 3655
236 Ga0209966_1010264 3300027695 Bacteria 1686
237 Ga0209974_10008994 3300027876 Bacteria 3398
238 Ga0207428_10027534 3300027907 Bacteria 4732
239 Ga0268266_10003796 3300028379 Bacteria 14776
240 Ga0268266_10078306 3300028379 Bacteria 2876
241 Ga0268265_10700682 3300028380 Bacteria 978
242 Ga0268264_10001058 3300028381 Bacteria 27342
243 Ga0268264_11200313 3300028381 Bacteria 768
244 Ga0265319_1012250 3300028563 Bacteria 3475
245 Ga0265338_10014504 3300028800 Bacteria 8767
246 Ga0265338_10133253 3300028800 Bacteria 1958
247 Ga0265324_10021929 3300029957 Bacteria 2288
248 Ga0265332_10156337 3300031238 Bacteria 953
249 Ga0265325_10010438 3300031241 Bacteria 5379
250 Ga0265339_10054792 3300031249 Bacteria 2165
251 Ga0265339_10177816 3300031249 Bacteria 1061
252 Ga0265313_10008751 3300031595 Bacteria 6681
253 Ga0265342_10176520 3300031712 Bacteria 1172
254 Ga0316576_10021345 3300031727 Bacteria 4477
255 Ga0316578_10126691 3300031728 Bacteria 1536
256 Ga0307406_10173174 3300031901 Bacteria 1564
257 Ga0307412_10388577 3300031911 Bacteria 1132
258 Ga0307416_100275874 3300032002 Bacteria 1654
259 Ga0307416_100362338 3300032002 Bacteria 1472
260 Ga0307415_100017311 3300032126 Bacteria 4319
261 Ga0307510_10000007 3300033180 Bacteria 558582
262 Ga0373939_0033474 3300035114 Bacteria 1501
263 Ga0373957_0033496 3300035120 Bacteria 1898
264 Ga0373955_0056360 3300035172 Bacteria 2156
265 Ga0395900_0277561 3300037418 Bacteria 1669
266 Ga0400483_029869 3300039062 Bacteria 6067
267 Ga0436361_0278308 3300039447 Bacteria 12964
268 Ga0451807_0101834 3300041486 Bacteria 976
269 Ga0439435_0074121 3300042436 Bacteria 1012
270 Ga0466961_0171336 3300044693 Bacteria 1350
271 Ga0466963_0019845 3300044694 Bacteria 4222
272 Ga0466963_0497359 3300044694 Bacteria 861
273 Ga0466970_0191313 3300044765 Bacteria 1137
274 Ga0451576_0005402 3300045051 Bacteria 16044
275 Ga0451576_0800297 3300045051 Bacteria 990
276 Ga0466967_0512591 3300045976 Bacteria 1178
277 Ga0495592_0077628 3300046454 Bacteria 2407
278 Ga0495603_0038807 3300046455 Bacteria 2855
279 Ga0495629_0137036 3300046459 Bacteria 1704
280 Ga0495650_0017121 3300046471 Bacteria 3645
281 Ga0495650_0033298 3300046471 Unclassified 2295
282 Ga0495628_0334170 3300046516 Bacteria 1116
283 Ga0495668_0046488 3300046616 Bacteria 2411
284 Ga0495625_0002247 3300046660 Bacteria 21278
285 Ga0495647_0044057 3300046681 Bacteria 1710
286 Ga0495647_0242955 3300046681 Bacteria 800
287 Ga0495658_0088117 3300046683 Bacteria 1834
288 Ga0495613_0419834 3300046689 Bacteria 910
289 Ga0495670_0003206 3300046691 Bacteria 8051
290 Ga0496102_0430920 3300048905 Bacteria 1238
291 Ga0496112_0013934 3300048915 Bacteria 7437
292 Ga0496114_0048013 3300048917 Bacteria 3550
293 Ga0501031_0007076 3300049568 Bacteria 7318
294 Ga0501031_0178101 3300049568 Bacteria 1389
295 Ga0501032_0004204 3300049569 Bacteria 10899
296 Ga0501033_0007384 3300049570 Bacteria 8561
297 Ga0501034_0007467 3300049571 Bacteria 11633
298 Ga0501034_0128805 3300049571 Bacteria 2515
299 Ga0501036_0006747 3300049572 Bacteria 9333
300 Ga0501037_0007653 3300049573 Bacteria 7909
301 Ga0501038_0010166 3300049574 Bacteria 8614
302 Ga0501039_0008826 3300049575 Bacteria 7677
303 Ga0501039_0415387 3300049575 Bacteria 1057
304 Ga0501040_0162150 3300049576 Bacteria 1581
305 Ga0501042_0489736 3300049578 Bacteria 892
306 Ga0501043_0025925 3300049579 Bacteria 4599
307 Ga0501046_0002968 3300049580 Bacteria 15688
308 Ga0501047_0000742 3300049581 Bacteria 33985
309 Ga0501047_0053577 3300049581 Bacteria 3901
310 Ga0501047_0270661 3300049581 Bacteria 1545
311 Ga0501048_0005325 3300049582 Bacteria 9794
312 Ga0501048_0247056 3300049582 Bacteria 1266
313 Ga0501067_0007688 3300049583 Bacteria 5995
314 Ga0501070_0003631 3300049586 Bacteria 13331
315 Ga0501071_0231934 3300049587 Bacteria 1391
316 Ga0501073_0021964 3300049589 Bacteria 4597
317 Ga0501074_0001025 3300049590 Bacteria 18170
318 Ga0501075_0145423 3300049591 Bacteria 1807
319 Ga0501079_0002275 3300049741 Bacteria 13868
320 Ga0501080_0056582 3300049742 Bacteria 3651
321 Ga0501081_0762039 3300049743 Bacteria 728
322 Ga0501083_0007830 3300049744 Bacteria 7571
323 Ga0501035_0174922 3300049822 Bacteria 1852
324 Ga0501044_0055982 3300049823 Bacteria 4048
325 Ga0501045_0304927 3300049824 Bacteria 1185
326 nmdc:mga05p37_117_c1 3300050507 Bacteria 71563
327 nmdc:mga05p37_306002_c1 3300050507 Bacteria 1886
328 nmdc:mga05p37_67565_c1 3300050507 Bacteria 4397
329 nmdc:mga05p37_900_c1 3300050507 Bacteria 33505
330 nmdc:mga09592_391258_c1 3300050508 Bacteria 1202
331 nmdc:mga0qj67_191360_c1 3300050509 Bacteria 1663
332 nmdc:mga0qj67_56819_c1 3300050509 Bacteria 3103
333 nmdc:mga06r32_17759_c1 3300050510 Bacteria 6500
334 nmdc:mga06r32_246825_c1 3300050510 Bacteria 1773
335 nmdc:mga06r32_376965_c1 3300050510 Bacteria 1402
336 nmdc:mga08y16_119646_c1 3300050511 Bacteria 2741
337 nmdc:mga08y16_130859_c1 3300050511 Bacteria 2609
338 nmdc:mga08y16_40981_c1 3300050511 Bacteria 4851
339 nmdc:mga08y16_488902_c1 3300050511 Bacteria 1252
340 nmdc:mga08y16_90036_c1 3300050511 Bacteria 3198
341 nmdc:mga0n895_271402_c1 3300050512 Bacteria 1721
342 nmdc:mga0n895_44272_c1 3300050512 Bacteria 4340
343 nmdc:mga0n895_76147_c1 3300050512 Bacteria 3336
344 nmdc:mga0n895_765788_c1 3300050512 Bacteria 957
345 nmdc:mga0rr50_137088_c1 3300050513 Bacteria 1965
346 nmdc:mga0rr50_160514_c1 3300050513 Bacteria 1824
347 nmdc:mga0rr50_771735_c1 3300050513 Bacteria 820
348 nmdc:mga08x19_152397_c1 3300050514 Bacteria 1566
349 nmdc:mga08x19_20618_c1 3300050514 Bacteria 4059
350 nmdc:mga08x19_215801_c1 3300050514 Bacteria 1318
351 nmdc:mga08x19_45_c1 3300050514 Bacteria 147507
352 nmdc:mga0a205_100293_c1 3300050515 Bacteria 2794
353 nmdc:mga0a205_135100_c1 3300050515 Bacteria 2367
354 nmdc:mga0a205_28951_c1 3300050515 Bacteria 5298
355 nmdc:mga0a205_62136_c1 3300050515 Bacteria 3608
356 Ga0495601_0015130 3300053077 Bacteria 4661
357 Ga0495601_0114550 3300053077 Bacteria 1748
358 Ga0500641_0009687 3300053096 Bacteria 3465
359 Ga0500562_000427 3300053108 Bacteria 10224
360 Ga0501084_0021784 3300054114 Bacteria 5344
361 Ga0590071_003161 3300059421 Bacteria 4069
362 Ga0590075_000502 3300059424 Bacteria 10620
363 Ga0590077_000459 3300059426 Bacteria 11420
364 Ga0501082_0524955 3300060353 Bacteria 1035
365 Ga0530510_0424909 3300061734 Bacteria 1003

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049743 Ga0501081_0762039 Ga0501081_0762039_16_669 191
2 3300037418 Ga0395900_0277561 Ga0395900_0277561_761_1414 192
3 3300005440 Ga0070705_100003943 Ga0070705_1000039439 198
4 3300005444 Ga0070694_100722604 Ga0070694_1007226041 198
5 3300005445 Ga0070708_100004792 Ga0070708_1000047923 198
6 3300005467 Ga0070706_100124046 Ga0070706_1001240462 198
7 3300005467 Ga0070706_100140979 Ga0070706_1001409791 198
8 3300005467 Ga0070706_100444434 Ga0070706_1004444342 198
9 3300005468 Ga0070707_100079372 Ga0070707_1000793722 198
10 3300005471 Ga0070698_100063420 Ga0070698_1000634203 198
11 3300005518 Ga0070699_100009601 Ga0070699_1000096011 198
12 3300005518 Ga0070699_100098040 Ga0070699_1000980403 198
13 3300005545 Ga0070695_100019168 Ga0070695_1000191682 198
14 3300005546 Ga0070696_100052921 Ga0070696_1000529212 198
15 3300005549 Ga0070704_100005143 Ga0070704_1000051432 198
16 3300005549 Ga0070704_100011357 Ga0070704_1000113572 198
17 3300005549 Ga0070704_100029112 Ga0070704_1000291122 198
18 3300005549 Ga0070704_100327254 Ga0070704_1003272542 198
19 3300006173 Ga0070716_100011417 Ga0070716_1000114173 198
20 3300006847 Ga0075431_100322036 Ga0075431_1003220362 198
21 3300006852 Ga0075433_10141470 Ga0075433_101414702 198
22 3300009147 Ga0114129_10000501 Ga0114129_1000050118 198
23 3300025885 Ga0207653_10001889 Ga0207653_100018895 198
24 3300025910 Ga0207684_10007389 Ga0207684_100073896 198
25 3300025910 Ga0207684_10056813 Ga0207684_100568132 198
26 3300025910 Ga0207684_10437307 Ga0207684_104373072 198
27 3300025922 Ga0207646_10003863 Ga0207646_100038638 198
28 3300025922 Ga0207646_10314331 Ga0207646_103143312 198
29 3300025923 Ga0207681_10049813 Ga0207681_100498132 198
30 3300045051 Ga0451576_0800297 Ga0451576_0800297_148_867 198
31 3300046471 Ga0495650_0033298 Ga0495650_0033298_666_1337 198
32 3300046681 Ga0495647_0242955 Ga0495647_0242955_88_762 198
33 3300050507 nmdc:mga05p37_117_c1 nmdc:mga05p37_117_c1_47210_47884 198
34 3300050510 nmdc:mga06r32_17759_c1 nmdc:mga06r32_17759_c1_528_1202 198
35 3300050515 nmdc:mga0a205_135100_c1 nmdc:mga0a205_135100_c1_1371_2045 198
36 3300050515 nmdc:mga0a205_62136_c1 nmdc:mga0a205_62136_c1_1060_1734 198
37 3300005330 Ga0070690_100713383 Ga0070690_1007133831 199
38 3300006844 Ga0075428_100022893 Ga0075428_1000228936 199
39 3300006880 Ga0075429_100012811 Ga0075429_1000128115 199
40 3300009093 Ga0105240_10275050 Ga0105240_102750501 199
41 3300009094 Ga0111539_10093423 Ga0111539_100934232 199
42 3300009147 Ga0114129_10062943 Ga0114129_100629434 199
43 3300009177 Ga0105248_10541661 Ga0105248_105416612 199
44 3300025910 Ga0207684_10311746 Ga0207684_103117462 199
45 3300025913 Ga0207695_10625936 Ga0207695_106259361 199
46 3300025923 Ga0207681_10042991 Ga0207681_100429913 199
47 3300046454 Ga0495592_0077628 Ga0495592_0077628_800_1474 199
48 3300046516 Ga0495628_0334170 Ga0495628_0334170_298_972 199
49 3300050511 nmdc:mga08y16_119646_c1 nmdc:mga08y16_119646_c1_1624_2325 199
50 3300050511 nmdc:mga08y16_130859_c1 nmdc:mga08y16_130859_c1_413_1087 199
51 3300005435 Ga0070714_100004185 Ga0070714_1000041857 200
52 3300005545 Ga0070695_100511646 Ga0070695_1005116461 200
53 3300005844 Ga0068862_100763471 Ga0068862_1007634712 200
54 3300014326 Ga0157380_10004231 Ga0157380_100042318 200
55 3300025929 Ga0207664_10000024 Ga0207664_1000002458 200
56 3300028563 Ga0265319_1012250 Ga0265319_10122503 200
57 3300028800 Ga0265338_10014504 Ga0265338_100145044 200
58 3300029957 Ga0265324_10021929 Ga0265324_100219291 200
59 3300031238 Ga0265332_10156337 Ga0265332_101563371 200
60 3300031241 Ga0265325_10010438 Ga0265325_100104384 200
61 3300031249 Ga0265339_10054792 Ga0265339_100547922 200
62 3300031595 Ga0265313_10008751 Ga0265313_100087515 200
63 3300046471 Ga0495650_0017121 Ga0495650_0017121_1826_2503 200
64 3300005331 Ga0070670_100314527 Ga0070670_1003145272 201
65 3300005617 Ga0068859_101323525 Ga0068859_1013235251 201
66 3300006931 Ga0097620_101323915 Ga0097620_1013239151 201
67 3300009094 Ga0111539_10269724 Ga0111539_102697242 201
68 3300027907 Ga0207428_10027534 Ga0207428_100275344 201
69 3300031728 Ga0316578_10126691 Ga0316578_101266912 201
70 3300039062 Ga0400483_029869 Ga0400483_029869_3602_4303 201
71 3300049568 Ga0501031_0178101 Ga0501031_0178101_696_1379 201
72 3300050511 nmdc:mga08y16_90036_c1 nmdc:mga08y16_90036_c1_811_1491 201
73 3300049575 Ga0501039_0415387 Ga0501039_0415387_277_960 202
74 3300005355 Ga0070671_100204923 Ga0070671_1002049232 203
75 3300005434 Ga0070709_10000160 Ga0070709_1000016030 203
76 3300005436 Ga0070713_100191980 Ga0070713_1001919802 203
77 3300005549 Ga0070704_100354093 Ga0070704_1003540932 203
78 3300005719 Ga0068861_100290741 Ga0068861_1002907412 203
79 3300005843 Ga0068860_100011993 Ga0068860_1000119938 203
80 3300006173 Ga0070716_100092961 Ga0070716_1000929612 203
81 3300006871 Ga0075434_100031489 Ga0075434_1000314893 203
82 3300006871 Ga0075434_100065833 Ga0075434_1000658333 203
83 3300007076 Ga0075435_100336298 Ga0075435_1003362982 203
84 3300009551 Ga0105238_10251059 Ga0105238_102510591 203
85 3300009553 Ga0105249_10155865 Ga0105249_101558652 203
86 3300013308 Ga0157375_10303789 Ga0157375_103037892 203
87 3300014325 Ga0163163_10185423 Ga0163163_101854232 203
88 3300025906 Ga0207699_10000118 Ga0207699_1000011838 203
89 3300025928 Ga0207700_10146700 Ga0207700_101467002 203
90 3300025931 Ga0207644_10253557 Ga0207644_102535572 203
91 3300025932 Ga0207690_10109160 Ga0207690_101091602 203
92 3300025961 Ga0207712_10127917 Ga0207712_101279172 203
93 3300028379 Ga0268266_10003796 Ga0268266_100037966 203
94 3300028380 Ga0268265_10700682 Ga0268265_107006822 203
95 3300028381 Ga0268264_10001058 Ga0268264_1000105820 203
96 3300031727 Ga0316576_10021345 Ga0316576_100213455 203
97 3300032002 Ga0307416_100275874 Ga0307416_1002758742 203
98 3300035114 Ga0373939_0033474 Ga0373939_0033474_499_1191 203
99 3300041486 Ga0451807_0101834 Ga0451807_0101834_254_946 203
100 3300042436 Ga0439435_0074121 Ga0439435_0074121_275_964 203
101 3300044694 Ga0466963_0019845 Ga0466963_0019845_1565_2260 203
102 3300046691 Ga0495670_0003206 Ga0495670_0003206_3072_3758 203
103 3300049591 Ga0501075_0145423 Ga0501075_0145423_420_1112 203
104 3300050512 nmdc:mga0n895_271402_c1 nmdc:mga0n895_271402_c1_323_1018 203
105 3300050512 nmdc:mga0n895_44272_c1 nmdc:mga0n895_44272_c1_1140_1835 203
106 3300050513 nmdc:mga0rr50_160514_c1 nmdc:mga0rr50_160514_c1_871_1569 203
107 3300050514 nmdc:mga08x19_20618_c1 nmdc:mga08x19_20618_c1_2127_2822 203
108 3300005327 Ga0070658_10024126 Ga0070658_100241262 204
109 3300005339 Ga0070660_100004982 Ga0070660_10000498210 204
110 3300005356 Ga0070674_100057663 Ga0070674_1000576633 204
111 3300005530 Ga0070679_100009980 Ga0070679_1000099805 204
112 3300005614 Ga0068856_100592193 Ga0068856_1005921932 204
113 3300005844 Ga0068862_100257300 Ga0068862_1002573002 204
114 3300006358 Ga0068871_100258378 Ga0068871_1002583782 204
115 3300009093 Ga0105240_10022510 Ga0105240_100225106 204
116 3300009177 Ga0105248_10297647 Ga0105248_102976472 204
117 3300009553 Ga0105249_10704226 Ga0105249_107042262 204
118 3300021361 Ga0213872_10000369 Ga0213872_1000036918 204
119 3300025909 Ga0207705_10084940 Ga0207705_100849402 204
120 3300025912 Ga0207707_10041951 Ga0207707_100419515 204
121 3300025913 Ga0207695_10047613 Ga0207695_100476135 204
122 3300025919 Ga0207657_10004213 Ga0207657_1000421314 204
123 3300025921 Ga0207652_10159853 Ga0207652_101598532 204
124 3300025941 Ga0207711_10404429 Ga0207711_104044291 204
125 3300026078 Ga0207702_10100724 Ga0207702_101007242 204
126 3300028800 Ga0265338_10133253 Ga0265338_101332531 204
127 3300031249 Ga0265339_10177816 Ga0265339_101778162 204
128 3300031712 Ga0265342_10176520 Ga0265342_101765201 204
129 3300039447 Ga0436361_0278308 Ga0436361_0278308_10929_11618 204
130 3300044693 Ga0466961_0171336 Ga0466961_0171336_651_1340 204
131 3300044765 Ga0466970_0191313 Ga0466970_0191313_279_968 204
132 3300005445 Ga0070708_100181778 Ga0070708_1001817782 205
133 3300005458 Ga0070681_10096467 Ga0070681_100964672 205
134 3300005458 Ga0070681_10450211 Ga0070681_104502112 205
135 3300005563 Ga0068855_100014514 Ga0068855_1000145147 205
136 3300006871 Ga0075434_100467148 Ga0075434_1004671482 205
137 3300013104 Ga0157370_10062633 Ga0157370_100626332 205
138 3300025912 Ga0207707_10077124 Ga0207707_100771243 205
139 3300025912 Ga0207707_10429533 Ga0207707_104295331 205
140 3300025932 Ga0207690_10061148 Ga0207690_100611483 205
141 3300025949 Ga0207667_10063329 Ga0207667_100633294 205
142 3300032002 Ga0307416_100362338 Ga0307416_1003623382 205
143 3300032126 Ga0307415_100017311 Ga0307415_1000173112 205
144 3300044694 Ga0466963_0497359 Ga0466963_0497359_70_777 205
145 3300045051 Ga0451576_0005402 Ga0451576_0005402_6358_7053 205
146 3300049568 Ga0501031_0007076 Ga0501031_0007076_3457_4149 205
147 3300049569 Ga0501032_0004204 Ga0501032_0004204_7612_8304 205
148 3300049570 Ga0501033_0007384 Ga0501033_0007384_4253_4945 205
149 3300049571 Ga0501034_0007467 Ga0501034_0007467_4287_4979 205
150 3300049572 Ga0501036_0006747 Ga0501036_0006747_4490_5182 205
151 3300049573 Ga0501037_0007653 Ga0501037_0007653_5388_6080 205
152 3300049574 Ga0501038_0010166 Ga0501038_0010166_2762_3454 205
153 3300049575 Ga0501039_0008826 Ga0501039_0008826_104_796 205
154 3300049576 Ga0501040_0162150 Ga0501040_0162150_785_1477 205
155 3300049578 Ga0501042_0489736 Ga0501042_0489736_110_802 205
156 3300049579 Ga0501043_0025925 Ga0501043_0025925_812_1504 205
157 3300049580 Ga0501046_0002968 Ga0501046_0002968_5972_6664 205
158 3300049581 Ga0501047_0053577 Ga0501047_0053577_2155_2847 205
159 3300049582 Ga0501048_0005325 Ga0501048_0005325_5046_5738 205
160 3300049583 Ga0501067_0007688 Ga0501067_0007688_559_1251 205
161 3300049586 Ga0501070_0003631 Ga0501070_0003631_3096_3788 205
162 3300049589 Ga0501073_0021964 Ga0501073_0021964_3094_3786 205
163 3300049590 Ga0501074_0001025 Ga0501074_0001025_16055_16747 205
164 3300049741 Ga0501079_0002275 Ga0501079_0002275_12118_12810 205
165 3300049742 Ga0501080_0056582 Ga0501080_0056582_1433_2125 205
166 3300049744 Ga0501083_0007830 Ga0501083_0007830_6405_7097 205
167 3300049822 Ga0501035_0174922 Ga0501035_0174922_940_1632 205
168 3300049823 Ga0501044_0055982 Ga0501044_0055982_1830_2522 205
169 3300049824 Ga0501045_0304927 Ga0501045_0304927_393_1085 205
170 3300050512 nmdc:mga0n895_765788_c1 nmdc:mga0n895_765788_c1_100_807 205
171 3300054114 Ga0501084_0021784 Ga0501084_0021784_212_904 205
172 3300059421 Ga0590071_003161 Ga0590071_003161_1236_1934 205
173 3300059424 Ga0590075_000502 Ga0590075_000502_2181_2879 205
174 3300059426 Ga0590077_000459 Ga0590077_000459_4406_5104 205
175 3300005289 Ga0065704_10100669 Ga0065704_101006692 206
176 3300005295 Ga0065707_10180229 Ga0065707_101802291 206
177 3300005327 Ga0070658_10158069 Ga0070658_101580692 206
178 3300005328 Ga0070676_10054350 Ga0070676_100543502 206
179 3300005330 Ga0070690_100023631 Ga0070690_1000236312 206
180 3300005331 Ga0070670_100001428 Ga0070670_1000014282 206
181 3300005334 Ga0068869_100232876 Ga0068869_1002328762 206
182 3300005335 Ga0070666_10043683 Ga0070666_100436831 206
183 3300005336 Ga0070680_100296848 Ga0070680_1002968482 206
184 3300005337 Ga0070682_100025618 Ga0070682_1000256183 206
185 3300005338 Ga0068868_100003349 Ga0068868_1000033499 206
186 3300005338 Ga0068868_100021836 Ga0068868_1000218361 206
187 3300005343 Ga0070687_100461161 Ga0070687_1004611611 206
188 3300005344 Ga0070661_100044411 Ga0070661_1000444114 206
189 3300005355 Ga0070671_100003745 Ga0070671_10000374514 206
190 3300005364 Ga0070673_100386503 Ga0070673_1003865032 206
191 3300005367 Ga0070667_100044096 Ga0070667_1000440962 206
192 3300005406 Ga0070703_10000019 Ga0070703_100000197 206
193 3300005434 Ga0070709_10000023 Ga0070709_1000002349 206
194 3300005437 Ga0070710_10053286 Ga0070710_100532862 206
195 3300005437 Ga0070710_10464858 Ga0070710_104648581 206
196 3300005439 Ga0070711_100000003 Ga0070711_10000000352 206
197 3300005439 Ga0070711_100210942 Ga0070711_1002109422 206
198 3300005440 Ga0070705_100001088 Ga0070705_1000010884 206
199 3300005445 Ga0070708_100231703 Ga0070708_1002317032 206
200 3300005458 Ga0070681_10016320 Ga0070681_100163206 206
201 3300005458 Ga0070681_10041191 Ga0070681_100411914 206
202 3300005458 Ga0070681_10069538 Ga0070681_100695382 206
203 3300005459 Ga0068867_100079163 Ga0068867_1000791633 206
204 3300005466 Ga0070685_10210854 Ga0070685_102108542 206
205 3300005467 Ga0070706_100000163 Ga0070706_10000016313 206
206 3300005530 Ga0070679_100014860 Ga0070679_1000148607 206
207 3300005530 Ga0070679_100078636 Ga0070679_1000786363 206
208 3300005535 Ga0070684_100269429 Ga0070684_1002694292 206
209 3300005539 Ga0068853_100029151 Ga0068853_1000291511 206
210 3300005545 Ga0070695_100256589 Ga0070695_1002565891 206
211 3300005546 Ga0070696_100000054 Ga0070696_10000005440 206
212 3300005546 Ga0070696_100110462 Ga0070696_1001104622 206
213 3300005547 Ga0070693_100030883 Ga0070693_1000308832 206
214 3300005548 Ga0070665_100425025 Ga0070665_1004250251 206
215 3300005548 Ga0070665_100571661 Ga0070665_1005716612 206
216 3300005549 Ga0070704_100017746 Ga0070704_1000177463 206
217 3300005563 Ga0068855_100007551 Ga0068855_10000755113 206
218 3300005564 Ga0070664_100098880 Ga0070664_1000988803 206
219 3300005615 Ga0070702_100044002 Ga0070702_1000440023 206
220 3300005618 Ga0068864_100002006 Ga0068864_1000020065 206
221 3300005618 Ga0068864_100053255 Ga0068864_1000532553 206
222 3300005719 Ga0068861_100056369 Ga0068861_1000563692 206
223 3300005719 Ga0068861_100281231 Ga0068861_1002812311 206
224 3300005719 Ga0068861_100365590 Ga0068861_1003655902 206
225 3300005834 Ga0068851_10373859 Ga0068851_103738591 206
226 3300005840 Ga0068870_10012323 Ga0068870_100123233 206
227 3300005841 Ga0068863_100006569 Ga0068863_10000656914 206
228 3300005842 Ga0068858_100001426 Ga0068858_1000014266 206
229 3300005842 Ga0068858_100026425 Ga0068858_1000264253 206
230 3300005843 Ga0068860_100024131 Ga0068860_1000241316 206
231 3300005843 Ga0068860_100063731 Ga0068860_1000637313 206
232 3300005937 Ga0081455_10377982 Ga0081455_103779822 206
233 3300006173 Ga0070716_100031810 Ga0070716_1000318101 206
234 3300006175 Ga0070712_100655536 Ga0070712_1006555362 206
235 3300006358 Ga0068871_100263914 Ga0068871_1002639143 206
236 3300006358 Ga0068871_100370239 Ga0068871_1003702392 206
237 3300006844 Ga0075428_100075622 Ga0075428_1000756222 206
238 3300006846 Ga0075430_100006633 Ga0075430_1000066338 206
239 3300006846 Ga0075430_100061750 Ga0075430_1000617503 206
240 3300006847 Ga0075431_100089542 Ga0075431_1000895423 206
241 3300006847 Ga0075431_100106667 Ga0075431_1001066673 206
242 3300006852 Ga0075433_10145506 Ga0075433_101455062 206
243 3300006880 Ga0075429_100124441 Ga0075429_1001244412 206
244 3300006880 Ga0075429_100808121 Ga0075429_1008081212 206
245 3300006914 Ga0075436_100003042 Ga0075436_1000030426 206
246 3300006914 Ga0075436_100164260 Ga0075436_1001642602 206
247 3300007076 Ga0075435_100123053 Ga0075435_1001230532 206
248 3300009093 Ga0105240_10009647 Ga0105240_100096476 206
249 3300009093 Ga0105240_10064997 Ga0105240_100649976 206
250 3300009094 Ga0111539_10065329 Ga0111539_100653292 206
251 3300009094 Ga0111539_10114707 Ga0111539_101147072 206
252 3300009101 Ga0105247_10036213 Ga0105247_100362132 206
253 3300009147 Ga0114129_10026282 Ga0114129_100262822 206
254 3300009147 Ga0114129_10108005 Ga0114129_101080054 206
255 3300009147 Ga0114129_10148464 Ga0114129_101484642 206
256 3300009147 Ga0114129_10211567 Ga0114129_102115672 206
257 3300009176 Ga0105242_10205054 Ga0105242_102050541 206
258 3300009177 Ga0105248_10010835 Ga0105248_100108356 206
259 3300009551 Ga0105238_10015998 Ga0105238_100159982 206
260 3300009551 Ga0105238_10031650 Ga0105238_100316502 206
261 3300009553 Ga0105249_10841954 Ga0105249_108419541 206
262 3300013104 Ga0157370_10277234 Ga0157370_102772342 206
263 3300013297 Ga0157378_10413700 Ga0157378_104137002 206
264 3300013307 Ga0157372_10055738 Ga0157372_100557383 206
265 3300013308 Ga0157375_10002961 Ga0157375_100029614 206
266 3300013308 Ga0157375_10447759 Ga0157375_104477592 206
267 3300014325 Ga0163163_10064340 Ga0163163_100643404 206
268 3300014968 Ga0157379_10059368 Ga0157379_100593686 206
269 3300014968 Ga0157379_10289859 Ga0157379_102898592 206
270 3300014969 Ga0157376_10015523 Ga0157376_100155233 206
271 3300014969 Ga0157376_10237063 Ga0157376_102370632 206
272 3300025885 Ga0207653_10000158 Ga0207653_100001588 206
273 3300025900 Ga0207710_10035008 Ga0207710_100350082 206
274 3300025903 Ga0207680_10011510 Ga0207680_100115105 206
275 3300025905 Ga0207685_10344413 Ga0207685_103444131 206
276 3300025906 Ga0207699_10000008 Ga0207699_10000008242 206
277 3300025907 Ga0207645_10028715 Ga0207645_100287152 206
278 3300025909 Ga0207705_10231911 Ga0207705_102319112 206
279 3300025910 Ga0207684_10000048 Ga0207684_10000048154 206
280 3300025911 Ga0207654_10216444 Ga0207654_102164441 206
281 3300025912 Ga0207707_10031315 Ga0207707_100313154 206
282 3300025913 Ga0207695_10000680 Ga0207695_1000068050 206
283 3300025913 Ga0207695_10007134 Ga0207695_100071346 206
284 3300025913 Ga0207695_10090303 Ga0207695_100903033 206
285 3300025913 Ga0207695_10674953 Ga0207695_106749531 206
286 3300025914 Ga0207671_10376382 Ga0207671_103763821 206
287 3300025916 Ga0207663_10000006 Ga0207663_10000006212 206
288 3300025916 Ga0207663_10095779 Ga0207663_100957792 206
289 3300025917 Ga0207660_10384506 Ga0207660_103845061 206
290 3300025918 Ga0207662_10021516 Ga0207662_100215162 206
291 3300025920 Ga0207649_10087051 Ga0207649_100870511 206
292 3300025921 Ga0207652_10127769 Ga0207652_101277692 206
293 3300025924 Ga0207694_10102954 Ga0207694_101029542 206
294 3300025927 Ga0207687_10099118 Ga0207687_100991182 206
295 3300025937 Ga0207669_10215409 Ga0207669_102154092 206
296 3300025939 Ga0207665_10032902 Ga0207665_100329021 206
297 3300025941 Ga0207711_10016506 Ga0207711_100165063 206
298 3300025945 Ga0207679_10024176 Ga0207679_100241762 206
299 3300025949 Ga0207667_10006536 Ga0207667_100065367 206
300 3300025960 Ga0207651_10643883 Ga0207651_106438831 206
301 3300025986 Ga0207658_10860824 Ga0207658_108608242 206
302 3300026023 Ga0207677_10053379 Ga0207677_100533794 206
303 3300026035 Ga0207703_10074504 Ga0207703_100745041 206
304 3300026041 Ga0207639_10010161 Ga0207639_100101612 206
305 3300026088 Ga0207641_10029690 Ga0207641_100296901 206
306 3300026089 Ga0207648_10005963 Ga0207648_100059634 206
307 3300026095 Ga0207676_10026382 Ga0207676_100263822 206
308 3300026118 Ga0207675_100523147 Ga0207675_1005231472 206
309 3300026142 Ga0207698_10244755 Ga0207698_102447552 206
310 3300027665 Ga0209983_1002983 Ga0209983_10029832 206
311 3300027695 Ga0209966_1010264 Ga0209966_10102642 206
312 3300027876 Ga0209974_10008994 Ga0209974_100089941 206
313 3300028379 Ga0268266_10078306 Ga0268266_100783062 206
314 3300028381 Ga0268264_11200313 Ga0268264_112003131 206
315 3300031901 Ga0307406_10173174 Ga0307406_101731742 206
316 3300031911 Ga0307412_10388577 Ga0307412_103885772 206
317 3300033180 Ga0307510_10000007 Ga0307510_10000007296 206
318 3300035120 Ga0373957_0033496 Ga0373957_0033496_962_1660 206
319 3300035172 Ga0373955_0056360 Ga0373955_0056360_447_1142 206
320 3300045976 Ga0466967_0512591 Ga0466967_0512591_299_994 206
321 3300046455 Ga0495603_0038807 Ga0495603_0038807_1806_2501 206
322 3300046459 Ga0495629_0137036 Ga0495629_0137036_79_777 206
323 3300046616 Ga0495668_0046488 Ga0495668_0046488_315_1010 206
324 3300046660 Ga0495625_0002247 Ga0495625_0002247_1881_2600 206
325 3300046681 Ga0495647_0044057 Ga0495647_0044057_451_1146 206
326 3300046683 Ga0495658_0088117 Ga0495658_0088117_520_1215 206
327 3300046689 Ga0495613_0419834 Ga0495613_0419834_64_759 206
328 3300048905 Ga0496102_0430920 Ga0496102_0430920_476_1171 206
329 3300048915 Ga0496112_0013934 Ga0496112_0013934_3929_4624 206
330 3300048917 Ga0496114_0048013 Ga0496114_0048013_1979_2674 206
331 3300049581 Ga0501047_0000742 Ga0501047_0000742_15677_16372 206
332 3300049581 Ga0501047_0270661 Ga0501047_0270661_125_829 206
333 3300049582 Ga0501048_0247056 Ga0501048_0247056_141_836 206
334 3300049587 Ga0501071_0231934 Ga0501071_0231934_440_1135 206
335 3300050507 nmdc:mga05p37_306002_c1 nmdc:mga05p37_306002_c1_126_839 206
336 3300050507 nmdc:mga05p37_67565_c1 nmdc:mga05p37_67565_c1_3251_3964 206
337 3300050507 nmdc:mga05p37_900_c1 nmdc:mga05p37_900_c1_25533_26246 206
338 3300050508 nmdc:mga09592_391258_c1 nmdc:mga09592_391258_c1_360_1055 206
339 3300050509 nmdc:mga0qj67_191360_c1 nmdc:mga0qj67_191360_c1_121_816 206
340 3300050509 nmdc:mga0qj67_56819_c1 nmdc:mga0qj67_56819_c1_291_986 206
341 3300050510 nmdc:mga06r32_246825_c1 nmdc:mga06r32_246825_c1_334_1029 206
342 3300050510 nmdc:mga06r32_376965_c1 nmdc:mga06r32_376965_c1_487_1182 206
343 3300050511 nmdc:mga08y16_40981_c1 nmdc:mga08y16_40981_c1_2440_3153 206
344 3300050511 nmdc:mga08y16_488902_c1 nmdc:mga08y16_488902_c1_539_1234 206
345 3300050512 nmdc:mga0n895_76147_c1 nmdc:mga0n895_76147_c1_1714_2427 206
346 3300050513 nmdc:mga0rr50_137088_c1 nmdc:mga0rr50_137088_c1_947_1660 206
347 3300050513 nmdc:mga0rr50_771735_c1 nmdc:mga0rr50_771735_c1_106_801 206
348 3300050514 nmdc:mga08x19_152397_c1 nmdc:mga08x19_152397_c1_575_1288 206
349 3300050514 nmdc:mga08x19_215801_c1 nmdc:mga08x19_215801_c1_182_895 206
350 3300050514 nmdc:mga08x19_45_c1 nmdc:mga08x19_45_c1_16989_17702 206
351 3300050515 nmdc:mga0a205_100293_c1 nmdc:mga0a205_100293_c1_361_1056 206
352 3300050515 nmdc:mga0a205_28951_c1 nmdc:mga0a205_28951_c1_1415_2128 206
353 3300053077 Ga0495601_0015130 Ga0495601_0015130_3356_4051 206
354 3300053077 Ga0495601_0114550 Ga0495601_0114550_617_1315 206
355 3300053096 Ga0500641_0009687 Ga0500641_0009687_731_1426 206
356 3300053108 Ga0500562_000427 Ga0500562_000427_5652_6347 206
357 3300060353 Ga0501082_0524955 Ga0501082_0524955_136_864 206
358 3300061734 Ga0530510_0424909 Ga0530510_0424909_49_777 206
359 3300014325 Ga0163163_10022236 Ga0163163_100222365 208
360 3300049571 Ga0501034_0128805 Ga0501034_0128805_1716_2450 209
361 3300005543 Ga0070672_100375293 Ga0070672_1003752931 212
362 3300025940 Ga0207691_10092948 Ga0207691_100929482 212
363 3300005518 Ga0070699_100000047 Ga0070699_10000004741 215
364 3300003320 rootH2_10030931 rootH2_100309311 216
365 3300009551 Ga0105238_10213421 Ga0105238_102134212 216

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

49

198

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2awo-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) 0.8927 15 212
2awn-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with atp-mg) 0.8784 15 212
1l2t-assembly1.cif.gz_B dimeric structure of mj0796, a bacterial abc transporter cassette 0.8585 15 209
1f3o-assembly1.cif.gz_A-2 crystal structure of mj0796 atp-binding cassette 0.8536 15 209
3tif-assembly1.cif.gz_B dimeric structure of a post-hydrolysis state of the atp-binding cassette mj0796 bound to adp and pi 0.853 15 209
ID Description Score Start End Superfamily
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9084 15 209 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8785 15 209 3.40.50.300
af_Q8T664_36_360_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8652 13 209 3.40.50.300
af_A0A1D6Q2V7_231_304_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8572 13 81 3.40.50.300
af_Q4CYV3_7_289_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8535 12 209 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A4U7CR65-F1-model_v4 ATP-binding cassette domain-containing protein 0.973 15 94 GO:0005524
GO:0016887
AF-A0A4U7CR65-F1-model_v4 ATP-binding cassette domain-containing protein 0.9387 15 94 GO:0005524
GO:0016887
AF-A0A417H0F8-F1-model_v4 deleted 0.9254 13 107
AF-A0A7Y3DL80-F1-model_v4 ATP-binding cassette domain-containing protein 0.9219 12 109 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A417H0F8-F1-model_v4 deleted 0.8894 13 107

Feature Viewer

pLDDT pTM Quality
80.48 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map