F423592

General Info

Members Datasets Scaffolds Average Seq Length
365 221 730 126

Family's Representative Sequence

Representative Sequence 3300005455|Ga0070663_100650541|Ga0070663_1006505412
Length 149
Sequence MTPAVGRGSVLLSRRGAAERRHGMTRLLSICLAGAIGTGTRYLVALWAAQRLGSVFPYGTLIVNGAGCFVIAVLMEAGMTLGWSPSVRAALTIGFVGGLTTYSSFNYETLRLLEEGSPSLAIANVAFTVGGCAVAGWIGQVIARAVIAR

Samples

Sample ID Description Type Environment
1 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
143 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
146 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
147 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
148 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
149 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
150 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
151 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
152 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
155 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
156 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
157 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
158 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
159 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
160 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
161 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
162 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
163 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
164 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
165 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
166 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
167 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
168 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
169 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
170 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
171 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
172 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
173 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
174 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
175 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
176 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
177 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
178 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
179 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
180 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
181 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
182 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
183 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
184 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
185 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
186 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
187 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
188 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
189 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
190 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
191 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
192 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
193 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
198 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
199 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
200 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
201 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
202 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
203 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
204 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
205 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
207 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
208 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
209 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
210 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
211 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
212 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
213 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
214 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
215 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
216 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
217 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
218 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
219 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
220 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
221 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.01
Rhizosphere 95.89
Stem 0
Stem Tuber 0
Unclassified 26.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070663_100650541 3300005455 Unclassified 891
2 JGI24746J21847_1005634 3300001977 Bacteria 1951
3 JGI24034J26672_10017824 3300002239 Unclassified 1101
4 Ga0065712_10075340 3300005290 Bacteria 3882
5 Ga0065715_10128110 3300005293 Bacteria 2072
6 Ga0070676_10002464 3300005328 Bacteria 9476
7 Ga0070676_11107996 3300005328 Bacteria 598
8 Ga0070683_101193363 3300005329 Bacteria 731
9 Ga0070690_100007511 3300005330 Bacteria 6241
10 Ga0070690_100049120 3300005330 Bacteria 2688
11 Ga0070670_100010701 3300005331 Bacteria 7838
12 Ga0070677_10001505 3300005333 Bacteria 7374
13 Ga0068869_100009468 3300005334 Bacteria 6322
14 Ga0068869_100882630 3300005334 Unclassified 773
15 Ga0070666_10037180 3300005335 Bacteria 3236
16 Ga0070680_100033147 3300005336 Bacteria 4161
17 Ga0068868_100026216 3300005338 Bacteria 4439
18 Ga0068868_100327193 3300005338 Bacteria 1307
19 Ga0068868_100816513 3300005338 Bacteria 842
20 Ga0070689_100061741 3300005340 Bacteria 2915
21 Ga0070691_10513115 3300005341 Bacteria 695
22 Ga0070687_100009437 3300005343 Bacteria 4181
23 Ga0070661_100027208 3300005344 Bacteria 4117
24 Ga0070661_100091959 3300005344 Unclassified 2247
25 Ga0070668_100025077 3300005347 Bacteria 4520
26 Ga0070668_100324421 3300005347 Bacteria 1297
27 Ga0070668_100718499 3300005347 Unclassified 882
28 Ga0070669_100017040 3300005353 Bacteria 5186
29 Ga0070669_100091038 3300005353 Bacteria 2287
30 Ga0070669_100998223 3300005353 Unclassified 718
31 Ga0070675_100002786 3300005354 Bacteria 13160
32 Ga0070675_100667046 3300005354 Bacteria 946
33 Ga0070671_100296073 3300005355 Bacteria 1377
34 Ga0070671_100331020 3300005355 Bacteria 1298
35 Ga0070674_101025410 3300005356 Bacteria 725
36 Ga0070673_100178103 3300005364 Bacteria 1818
37 Ga0070673_101416112 3300005364 Unclassified 654
38 Ga0070688_100047679 3300005365 Bacteria 2659
39 Ga0070688_100074848 3300005365 Bacteria 2175
40 Ga0070688_100423287 3300005365 Bacteria 990
41 Ga0070659_100333031 3300005366 Unclassified 1271
42 Ga0070659_100598005 3300005366 Bacteria 948
43 Ga0070667_100059947 3300005367 Bacteria 3220
44 Ga0070667_100196362 3300005367 Bacteria 1789
45 Ga0070667_100388181 3300005367 Unclassified 1269
46 Ga0070703_10235418 3300005406 Bacteria 736
47 Ga0070701_10005480 3300005438 Bacteria 5250
48 Ga0070701_10472869 3300005438 Bacteria 808
49 Ga0070700_100002944 3300005441 Bacteria 8739
50 Ga0070700_100557869 3300005441 Bacteria 891
51 Ga0070663_100222372 3300005455 Unclassified 1483
52 Ga0070678_100010449 3300005456 Bacteria 5673
53 Ga0070678_100118205 3300005456 Bacteria 2086
54 Ga0070678_100205123 3300005456 Unclassified 1630
55 Ga0070681_10174002 3300005458 Bacteria 2074
56 Ga0068867_100256036 3300005459 Bacteria 1425
57 Ga0068867_100545361 3300005459 Bacteria 1004
58 Ga0070685_10046426 3300005466 Bacteria 2493
59 Ga0070706_100588461 3300005467 Bacteria 1034
60 Ga0070707_101289834 3300005468 Unclassified 697
61 Ga0070698_101040553 3300005471 Bacteria 766
62 Ga0070679_101226057 3300005530 Unclassified 695
63 Ga0070684_100873780 3300005535 Unclassified 842
64 Ga0070672_100081255 3300005543 Bacteria 2598
65 Ga0070672_100208370 3300005543 Bacteria 1637
66 Ga0070686_100170845 3300005544 Bacteria 1537
67 Ga0070695_100514285 3300005545 Unclassified 928
68 Ga0070693_100043194 3300005547 Bacteria 2545
69 Ga0070704_100831535 3300005549 Unclassified 827
70 Ga0070664_100000258 3300005564 Bacteria 38234
71 Ga0070664_100292057 3300005564 Bacteria 1472
72 Ga0070664_100466512 3300005564 Bacteria 1161
73 Ga0068854_100023440 3300005578 Bacteria 4216
74 Ga0068854_100463106 3300005578 Unclassified 1061
75 Ga0070702_100380382 3300005615 Bacteria 1003
76 Ga0070702_101623234 3300005615 Bacteria 535
77 Ga0068852_100627043 3300005616 Bacteria 1081
78 Ga0068859_100009509 3300005617 Bacteria 9815
79 Ga0068859_100078370 3300005617 Bacteria 3344
80 Ga0068859_100498885 3300005617 Bacteria 1312
81 Ga0068864_100230973 3300005618 Bacteria 1711
82 Ga0068864_100930143 3300005618 Bacteria 860
83 Ga0068866_10361640 3300005718 Unclassified 925
84 Ga0068866_10396145 3300005718 Bacteria 889
85 Ga0068861_100021883 3300005719 Bacteria 4599
86 Ga0068861_100759921 3300005719 Bacteria 906
87 Ga0068851_11066460 3300005834 Bacteria 512
88 Ga0068870_10195161 3300005840 Bacteria 1224
89 Ga0068863_100002880 3300005841 Bacteria 17034
90 Ga0068863_100088677 3300005841 Bacteria 2932
91 Ga0068858_100313518 3300005842 Bacteria 1498
92 Ga0068858_100357517 3300005842 Bacteria 1399
93 Ga0068858_100392002 3300005842 Bacteria 1333
94 Ga0068860_100051326 3300005843 Bacteria 3924
95 Ga0068860_100059991 3300005843 Bacteria 3616
96 Ga0068860_100158999 3300005843 Bacteria 2178
97 Ga0068860_100253160 3300005843 Bacteria 1715
98 Ga0068862_100027916 3300005844 Bacteria 4753
99 Ga0068862_100671166 3300005844 Bacteria 1001
100 Ga0097621_100054150 3300006237 Bacteria 3271
101 Ga0097621_102117491 3300006237 Bacteria 538
102 Ga0068871_100140308 3300006358 Bacteria 2054
103 Ga0075428_100008168 3300006844 Bacteria 11614
104 Ga0075428_100017008 3300006844 Bacteria 8035
105 Ga0075430_100010871 3300006846 Bacteria 7711
106 Ga0075430_100664985 3300006846 Unclassified 859
107 Ga0075431_100000207 3300006847 Bacteria 43553
108 Ga0075433_10017660 3300006852 Bacteria 5917
109 Ga0075434_100059942 3300006871 Bacteria 3785
110 Ga0075429_100010072 3300006880 Bacteria 8193
111 Ga0075429_100186972 3300006880 Bacteria 1815
112 Ga0075429_100209332 3300006880 Bacteria 1709
113 Ga0068865_100210517 3300006881 Bacteria 1515
114 Ga0068865_100556425 3300006881 Bacteria 964
115 Ga0068865_101000676 3300006881 Unclassified 732
116 Ga0068865_101591817 3300006881 Unclassified 587
117 Ga0097620_100009510 3300006931 Bacteria 9815
118 Ga0097620_100078372 3300006931 Bacteria 3344
119 Ga0097620_100498903 3300006931 Bacteria 1312
120 Ga0075435_100004647 3300007076 Bacteria 9461
121 Ga0075435_101109106 3300007076 Unclassified 692
122 Ga0111539_10091520 3300009094 Bacteria 3574
123 Ga0111539_10336708 3300009094 Bacteria 1756
124 Ga0111539_10347153 3300009094 Bacteria 1727
125 Ga0111539_10517812 3300009094 Bacteria 1389
126 Ga0105245_10842309 3300009098 Bacteria 957
127 Ga0105245_12633799 3300009098 Unclassified 556
128 Ga0105247_10244088 3300009101 Unclassified 1225
129 Ga0114129_10166708 3300009147 Bacteria 3006
130 Ga0114129_10304595 3300009147 Bacteria 2123
131 Ga0114129_11465930 3300009147 Bacteria 840
132 Ga0105243_10022973 3300009148 Bacteria 4743
133 Ga0105243_10367819 3300009148 Bacteria 1326
134 Ga0105243_10786292 3300009148 Unclassified 936
135 Ga0105241_10168275 3300009174 Bacteria 1808
136 Ga0105242_10031605 3300009176 Bacteria 4230
137 Ga0105248_10061887 3300009177 Bacteria 4203
138 Ga0105248_10361142 3300009177 Bacteria 1635
139 Ga0105248_10735433 3300009177 Bacteria 1113
140 Ga0105248_12953340 3300009177 Unclassified 542
141 Ga0105237_12771295 3300009545 Bacteria 501
142 Ga0105238_12900000 3300009551 Unclassified 516
143 Ga0105249_10042003 3300009553 Bacteria 4158
144 Ga0105249_10460479 3300009553 Bacteria 1312
145 Ga0105249_10497568 3300009553 Bacteria 1264
146 Ga0105239_11363051 3300010375 Unclassified 819
147 Ga0105239_11430721 3300010375 Bacteria 798
148 Ga0105246_10004418 3300011119 Bacteria 8560
149 Ga0105246_10134564 3300011119 Bacteria 1851
150 Ga0157314_1012108 3300012500 Unclassified 771
151 Ga0157371_10361706 3300013102 Unclassified 1058
152 Ga0157369_11290853 3300013105 Unclassified 744
153 Ga0157374_10209102 3300013296 Bacteria 1913
154 Ga0157378_11230578 3300013297 Bacteria 789
155 Ga0157378_12673136 3300013297 Unclassified 552
156 Ga0163162_10002970 3300013306 Bacteria 16193
157 Ga0157375_10296611 3300013308 Bacteria 1780
158 Ga0163163_10145736 3300014325 Bacteria 2412
159 Ga0157380_10017825 3300014326 Bacteria 5262
160 Ga0157380_10140241 3300014326 Unclassified 2076
161 Ga0157380_10300892 3300014326 Bacteria 1477
162 Ga0157379_10343638 3300014968 Bacteria 1365
163 Ga0157376_10047185 3300014969 Bacteria 3555
164 Ga0163161_10244179 3300017792 Bacteria 1398
165 Ga0207697_10000243 3300025315 Bacteria 29799
166 Ga0207697_10007878 3300025315 Bacteria 4707
167 Ga0207697_10030023 3300025315 Bacteria 2225
168 Ga0207656_10320233 3300025321 Bacteria 770
169 Ga0207653_10162145 3300025885 Unclassified 828
170 Ga0207653_10231188 3300025885 Bacteria 704
171 Ga0207682_10002390 3300025893 Bacteria 8443
172 Ga0207642_10609982 3300025899 Bacteria 680
173 Ga0207688_10001003 3300025901 Bacteria 14364
174 Ga0207688_10001364 3300025901 Bacteria 12684
175 Ga0207688_10114415 3300025901 Unclassified 1569
176 Ga0207688_10290790 3300025901 Bacteria 997
177 Ga0207680_10459411 3300025903 Unclassified 904
178 Ga0207647_10570822 3300025904 Bacteria 626
179 Ga0207645_10012102 3300025907 Bacteria 5864
180 Ga0207645_11029193 3300025907 Bacteria 557
181 Ga0207643_10000200 3300025908 Bacteria 41454
182 Ga0207660_10027364 3300025917 Unclassified 3890
183 Ga0207662_10003463 3300025918 Bacteria 8126
184 Ga0207662_10549477 3300025918 Bacteria 800
185 Ga0207649_10146853 3300025920 Bacteria 1619
186 Ga0207652_10046365 3300025921 Bacteria 3708
187 Ga0207681_10282889 3300025923 Bacteria 1306
188 Ga0207681_10935912 3300025923 Unclassified 726
189 Ga0207681_11848778 3300025923 Bacteria 503
190 Ga0207650_10395976 3300025925 Unclassified 1142
191 Ga0207659_10003090 3300025926 Bacteria 9940
192 Ga0207659_10187050 3300025926 Bacteria 1645
193 Ga0207687_10862559 3300025927 Unclassified 774
194 Ga0207644_10162206 3300025931 Bacteria 1738
195 Ga0207644_10171270 3300025931 Bacteria 1695
196 Ga0207690_10127764 3300025932 Bacteria 1856
197 Ga0207690_10718910 3300025932 Unclassified 822
198 Ga0207706_10013902 3300025933 Bacteria 7300
199 Ga0207706_10796967 3300025933 Bacteria 803
200 Ga0207670_10162475 3300025936 Bacteria 1668
201 Ga0207669_10427567 3300025937 Bacteria 1044
202 Ga0207704_10210903 3300025938 Unclassified 1429
203 Ga0207691_10004572 3300025940 Bacteria 13399
204 Ga0207691_10114710 3300025940 Bacteria 2393
205 Ga0207711_10146796 3300025941 Unclassified 2125
206 Ga0207711_10675493 3300025941 Unclassified 963
207 Ga0207711_11283297 3300025941 Unclassified 674
208 Ga0207689_10022169 3300025942 Bacteria 5341
209 Ga0207661_10082885 3300025944 Unclassified 2653
210 Ga0207679_10059064 3300025945 Bacteria 2845
211 Ga0207679_10237034 3300025945 Bacteria 1544
212 Ga0207679_10341904 3300025945 Bacteria 1302
213 Ga0207651_10076062 3300025960 Bacteria 2398
214 Ga0207651_10119092 3300025960 Bacteria 1998
215 Ga0207651_10823500 3300025960 Unclassified 824
216 Ga0207712_10020838 3300025961 Bacteria 4299
217 Ga0207712_10601208 3300025961 Bacteria 951
218 Ga0207668_10177872 3300025972 Bacteria 1675
219 Ga0207668_10446277 3300025972 Bacteria 1103
220 Ga0207668_11605667 3300025972 Unclassified 587
221 Ga0207640_10995334 3300025981 Bacteria 737
222 Ga0207658_10485863 3300025986 Unclassified 1098
223 Ga0207658_11210389 3300025986 Bacteria 690
224 Ga0207658_11349800 3300025986 Unclassified 652
225 Ga0207677_10221606 3300026023 Bacteria 1517
226 Ga0207677_10544352 3300026023 Bacteria 1011
227 Ga0207677_10749613 3300026023 Bacteria 870
228 Ga0207703_11623336 3300026035 Bacteria 622
229 Ga0207678_10153490 3300026067 Bacteria 1966
230 Ga0207678_10230292 3300026067 Bacteria 1586
231 Ga0207708_10010210 3300026075 Bacteria 6971
232 Ga0207708_10016472 3300026075 Bacteria 5558
233 Ga0207708_10853160 3300026075 Bacteria 786
234 Ga0207641_10017890 3300026088 Bacteria 5806
235 Ga0207641_10112401 3300026088 Bacteria 2417
236 Ga0207648_10034797 3300026089 Bacteria 4440
237 Ga0207648_10219470 3300026089 Bacteria 1689
238 Ga0207676_10051665 3300026095 Bacteria 3210
239 Ga0207676_10214281 3300026095 Bacteria 1711
240 Ga0207676_10852774 3300026095 Bacteria 891
241 Ga0207675_100815499 3300026118 Bacteria 947
242 Ga0207675_101264200 3300026118 Unclassified 758
243 Ga0207675_102638650 3300026118 Unclassified 512
244 Ga0207683_10145396 3300026121 Bacteria 2138
245 Ga0207683_10157262 3300026121 Unclassified 2053
246 Ga0207683_11635086 3300026121 Unclassified 593
247 Ga0207683_11755097 3300026121 Unclassified 570
248 Ga0207698_10039052 3300026142 Unclassified 3514
249 Ga0209999_1034541 3300027543 Bacteria 942
250 Ga0209983_1124518 3300027665 Bacteria 589
251 Ga0209974_10061169 3300027876 Bacteria 1275
252 Ga0209974_10083087 3300027876 Bacteria 1104
253 Ga0207428_10025932 3300027907 Bacteria 4898
254 Ga0268265_11122108 3300028380 Unclassified 781
255 Ga0268264_10098146 3300028381 Bacteria 2540
256 Ga0268264_10736124 3300028381 Unclassified 981
257 Ga0268264_11054564 3300028381 Unclassified 820
258 Ga0307408_100251602 3300031548 Unclassified 1458
259 Ga0307408_100391692 3300031548 Bacteria 1191
260 Ga0307408_100562569 3300031548 Bacteria 1008
261 Ga0307508_10020942 3300031616 Bacteria 5943
262 Ga0307405_10047568 3300031731 Bacteria 2642
263 Ga0307413_10045140 3300031824 Unclassified 2610
264 Ga0307410_10025464 3300031852 Bacteria 3713
265 Ga0307406_10785104 3300031901 Unclassified 802
266 Ga0307406_10985500 3300031901 Unclassified 722
267 Ga0307412_10285422 3300031911 Bacteria 1298
268 Ga0307409_100060294 3300031995 Unclassified 2958
269 Ga0307416_100025355 3300032002 Bacteria 4345
270 Ga0307416_100027623 3300032002 Bacteria 4206
271 Ga0307416_102621862 3300032002 Unclassified 601
272 Ga0307414_10062682 3300032004 Bacteria 2640
273 Ga0307411_10899116 3300032005 Unclassified 786
274 Ga0307415_100050982 3300032126 Unclassified 2807
275 Ga0307415_100153953 3300032126 Unclassified 1773
276 Ga0373959_0138284 3300034820 Bacteria 608
277 Ga0373929_0199040 3300035085 Bacteria 560
278 Ga0373940_0031292 3300035088 Bacteria 1420
279 Ga0373940_0137321 3300035088 Unclassified 770
280 Ga0373952_0061410 3300035092 Bacteria 920
281 Ga0373960_0218895 3300035121 Bacteria 680
282 Ga0373961_0076727 3300035241 Bacteria 1044
283 Ga0373931_0804757 3300035691 Unclassified 627
284 Ga0439436_0159325 3300041404 Bacteria 638
285 Ga0439453_0011686 3300041408 Bacteria 1468
286 Ga0439433_0084705 3300041999 Bacteria 774
287 Ga0439450_043047 3300042008 Bacteria 1054
288 Ga0439451_076711 3300042009 Bacteria 670
289 Ga0439462_0009759 3300042015 Unclassified 2428
290 Ga0450920_129741 3300042122 Bacteria 531
291 Ga0450898_025789 3300042134 Unclassified 1056
292 Ga0439446_0027707 3300042156 Unclassified 1627
293 Ga0439446_0049074 3300042156 Unclassified 1258
294 Ga0439446_0295732 3300042156 Bacteria 567
295 Ga0439434_0183810 3300042435 Bacteria 701
296 Ga0439435_0011856 3300042436 Unclassified 2098
297 Ga0439435_0030842 3300042436 Bacteria 1455
298 Ga0439464_0142578 3300042439 Unclassified 747
299 Ga0450916_041710 3300042530 Bacteria 700
300 Ga0466957_0356079 3300044842 Unclassified 994
301 Ga0451576_0837667 3300045051 Unclassified 965
302 Ga0466967_0293974 3300045976 Unclassified 1561
303 Ga0495656_0291801 3300046615 Bacteria 834
304 Ga0496101_0328334 3300048904 Bacteria 1201
305 Ga0496102_0472646 3300048905 Bacteria 1175
306 Ga0496102_0775333 3300048905 Bacteria 881
307 Ga0496106_0146429 3300048909 Bacteria 1861
308 Ga0496107_0112125 3300048910 Bacteria 2005
309 Ga0496109_0024472 3300048912 Bacteria 5369
310 Ga0496109_0195349 3300048912 Bacteria 1902
311 Ga0496109_0765956 3300048912 Bacteria 903
312 Ga0496110_0147973 3300048913 Unclassified 2125
313 Ga0496112_0700059 3300048915 Bacteria 941
314 Ga0496113_0367512 3300048916 Bacteria 1154
315 Ga0496122_0474473 3300048925 Bacteria 614
316 Ga0496125_0005076 3300048928 Bacteria 14822
317 Ga0496126_0119483 3300048929 Bacteria 2287
318 Ga0501298_064778 3300049521 Unclassified 780
319 Ga0501036_0712416 3300049572 Unclassified 829
320 Ga0501039_0594651 3300049575 Bacteria 867
321 Ga0501040_0360562 3300049576 Bacteria 1042
322 Ga0501042_0382097 3300049578 Bacteria 1020
323 Ga0501072_0587899 3300049588 Unclassified 878
324 Ga0501072_0958816 3300049588 Unclassified 667
325 Ga0501075_0127209 3300049591 Unclassified 1940
326 Ga0501076_0205113 3300049592 Unclassified 1610
327 Ga0501076_0266773 3300049592 Bacteria 1402
328 Ga0501248_050667 3300049678 Unclassified 533
329 Ga0501225_0292353 3300049705 Bacteria 549
330 Ga0501080_0158471 3300049742 Unclassified 2091
331 Ga0501080_0857607 3300049742 Archaea 794
332 Ga0501081_0456909 3300049743 Bacteria 949
333 Ga0501083_0420826 3300049744 Bacteria 869
334 Ga0501083_0733474 3300049744 Unclassified 643
335 Ga0501044_1551947 3300049823 Bacteria 527
336 Ga0501045_1002476 3300049824 Bacteria 612
337 nmdc:mga05p37_190887_c1 3300050507 Bacteria 2487
338 nmdc:mga05p37_245602_c1 3300050507 Bacteria 2149
339 nmdc:mga05p37_89815_c1 3300050507 Bacteria 3786
340 nmdc:mga09592_18832_c1 3300050508 Bacteria 5664
341 nmdc:mga09592_201442_c1 3300050508 Bacteria 1724
342 nmdc:mga09592_576385_c1 3300050508 Unclassified 965
343 nmdc:mga0qj67_104291_c1 3300050509 Bacteria 2287
344 nmdc:mga0qj67_288734_c1 3300050509 Bacteria 1329
345 nmdc:mga0qj67_405767_c1 3300050509 Unclassified 1100
346 nmdc:mga06r32_1806_c1 3300050510 Bacteria 19153
347 nmdc:mga06r32_325434_c1 3300050510 Bacteria 1522
348 nmdc:mga08y16_1024087_c1 3300050511 Unclassified 804
349 nmdc:mga08y16_443180_c1 3300050511 Bacteria 1325
350 nmdc:mga08y16_724992_c1 3300050511 Bacteria 992
351 nmdc:mga0n895_4443_c1 3300050512 Bacteria 11521
352 nmdc:mga0rr50_142522_c1 3300050513 Bacteria 1929
353 nmdc:mga0rr50_37120_c1 3300050513 Bacteria 3515
354 nmdc:mga0a205_40622_c1 3300050515 Bacteria 4479
355 Ga0501084_0140208 3300054114 Bacteria 2036
356 Ga0501084_0288718 3300054114 Bacteria 1385
357 Ga0501084_0973724 3300054114 Unclassified 713
358 Ga0590071_003028 3300059421 Unclassified 4172
359 Ga0590074_006545 3300059423 Bacteria 1934
360 Ga0590075_000734 3300059424 Bacteria 8698
361 Ga0590077_003776 3300059426 Unclassified 3124
362 Ga0501082_0206456 3300060353 Unclassified 1709
363 Ga0501082_0612427 3300060353 Unclassified 953
364 Ga0501082_0971547 3300060353 Bacteria 743
365 Ga0530510_0156003 3300061734 Bacteria 1687
366 Ga0070663_100650541
367 JGI24746J21847_1005634
368 JGI24034J26672_10017824
369 Ga0065712_10075340
370 Ga0065715_10128110
371 Ga0070676_10002464
372 Ga0070676_11107996
373 Ga0070683_101193363
374 Ga0070690_100007511
375 Ga0070690_100049120
376 Ga0070670_100010701
377 Ga0070677_10001505
378 Ga0068869_100009468
379 Ga0068869_100882630
380 Ga0070666_10037180
381 Ga0070680_100033147
382 Ga0068868_100026216
383 Ga0068868_100327193
384 Ga0068868_100816513
385 Ga0070689_100061741
386 Ga0070691_10513115
387 Ga0070687_100009437
388 Ga0070661_100027208
389 Ga0070661_100091959
390 Ga0070668_100025077
391 Ga0070668_100324421
392 Ga0070668_100718499
393 Ga0070669_100017040
394 Ga0070669_100091038
395 Ga0070669_100998223
396 Ga0070675_100002786
397 Ga0070675_100667046
398 Ga0070671_100296073
399 Ga0070671_100331020
400 Ga0070674_101025410
401 Ga0070673_100178103
402 Ga0070673_101416112
403 Ga0070688_100047679
404 Ga0070688_100074848
405 Ga0070688_100423287
406 Ga0070659_100333031
407 Ga0070659_100598005
408 Ga0070667_100059947
409 Ga0070667_100196362
410 Ga0070667_100388181
411 Ga0070703_10235418
412 Ga0070701_10005480
413 Ga0070701_10472869
414 Ga0070700_100002944
415 Ga0070700_100557869
416 Ga0070663_100222372
417 Ga0070678_100010449
418 Ga0070678_100118205
419 Ga0070678_100205123
420 Ga0070681_10174002
421 Ga0068867_100256036
422 Ga0068867_100545361
423 Ga0070685_10046426
424 Ga0070706_100588461
425 Ga0070707_101289834
426 Ga0070698_101040553
427 Ga0070679_101226057
428 Ga0070684_100873780
429 Ga0070672_100081255
430 Ga0070672_100208370
431 Ga0070686_100170845
432 Ga0070695_100514285
433 Ga0070693_100043194
434 Ga0070704_100831535
435 Ga0070664_100000258
436 Ga0070664_100292057
437 Ga0070664_100466512
438 Ga0068854_100023440
439 Ga0068854_100463106
440 Ga0070702_100380382
441 Ga0070702_101623234
442 Ga0068852_100627043
443 Ga0068859_100009509
444 Ga0068859_100078370
445 Ga0068859_100498885
446 Ga0068864_100230973
447 Ga0068864_100930143
448 Ga0068866_10361640
449 Ga0068866_10396145
450 Ga0068861_100021883
451 Ga0068861_100759921
452 Ga0068851_11066460
453 Ga0068870_10195161
454 Ga0068863_100002880
455 Ga0068863_100088677
456 Ga0068858_100313518
457 Ga0068858_100357517
458 Ga0068858_100392002
459 Ga0068860_100051326
460 Ga0068860_100059991
461 Ga0068860_100158999
462 Ga0068860_100253160
463 Ga0068862_100027916
464 Ga0068862_100671166
465 Ga0097621_100054150
466 Ga0097621_102117491
467 Ga0068871_100140308
468 Ga0075428_100008168
469 Ga0075428_100017008
470 Ga0075430_100010871
471 Ga0075430_100664985
472 Ga0075431_100000207
473 Ga0075433_10017660
474 Ga0075434_100059942
475 Ga0075429_100010072
476 Ga0075429_100186972
477 Ga0075429_100209332
478 Ga0068865_100210517
479 Ga0068865_100556425
480 Ga0068865_101000676
481 Ga0068865_101591817
482 Ga0097620_100009510
483 Ga0097620_100078372
484 Ga0097620_100498903
485 Ga0075435_100004647
486 Ga0075435_101109106
487 Ga0111539_10091520
488 Ga0111539_10336708
489 Ga0111539_10347153
490 Ga0111539_10517812
491 Ga0105245_10842309
492 Ga0105245_12633799
493 Ga0105247_10244088
494 Ga0114129_10166708
495 Ga0114129_10304595
496 Ga0114129_11465930
497 Ga0105243_10022973
498 Ga0105243_10367819
499 Ga0105243_10786292
500 Ga0105241_10168275
501 Ga0105242_10031605
502 Ga0105248_10061887
503 Ga0105248_10361142
504 Ga0105248_10735433
505 Ga0105248_12953340
506 Ga0105237_12771295
507 Ga0105238_12900000
508 Ga0105249_10042003
509 Ga0105249_10460479
510 Ga0105249_10497568
511 Ga0105239_11363051
512 Ga0105239_11430721
513 Ga0105246_10004418
514 Ga0105246_10134564
515 Ga0157314_1012108
516 Ga0157371_10361706
517 Ga0157369_11290853
518 Ga0157374_10209102
519 Ga0157378_11230578
520 Ga0157378_12673136
521 Ga0163162_10002970
522 Ga0157375_10296611
523 Ga0163163_10145736
524 Ga0157380_10017825
525 Ga0157380_10140241
526 Ga0157380_10300892
527 Ga0157379_10343638
528 Ga0157376_10047185
529 Ga0163161_10244179
530 Ga0207697_10000243
531 Ga0207697_10007878
532 Ga0207697_10030023
533 Ga0207656_10320233
534 Ga0207653_10162145
535 Ga0207653_10231188
536 Ga0207682_10002390
537 Ga0207642_10609982
538 Ga0207688_10001003
539 Ga0207688_10001364
540 Ga0207688_10114415
541 Ga0207688_10290790
542 Ga0207680_10459411
543 Ga0207647_10570822
544 Ga0207645_10012102
545 Ga0207645_11029193
546 Ga0207643_10000200
547 Ga0207660_10027364
548 Ga0207662_10003463
549 Ga0207662_10549477
550 Ga0207649_10146853
551 Ga0207652_10046365
552 Ga0207681_10282889
553 Ga0207681_10935912
554 Ga0207681_11848778
555 Ga0207650_10395976
556 Ga0207659_10003090
557 Ga0207659_10187050
558 Ga0207687_10862559
559 Ga0207644_10162206
560 Ga0207644_10171270
561 Ga0207690_10127764
562 Ga0207690_10718910
563 Ga0207706_10013902
564 Ga0207706_10796967
565 Ga0207670_10162475
566 Ga0207669_10427567
567 Ga0207704_10210903
568 Ga0207691_10004572
569 Ga0207691_10114710
570 Ga0207711_10146796
571 Ga0207711_10675493
572 Ga0207711_11283297
573 Ga0207689_10022169
574 Ga0207661_10082885
575 Ga0207679_10059064
576 Ga0207679_10237034
577 Ga0207679_10341904
578 Ga0207651_10076062
579 Ga0207651_10119092
580 Ga0207651_10823500
581 Ga0207712_10020838
582 Ga0207712_10601208
583 Ga0207668_10177872
584 Ga0207668_10446277
585 Ga0207668_11605667
586 Ga0207640_10995334
587 Ga0207658_10485863
588 Ga0207658_11210389
589 Ga0207658_11349800
590 Ga0207677_10221606
591 Ga0207677_10544352
592 Ga0207677_10749613
593 Ga0207703_11623336
594 Ga0207678_10153490
595 Ga0207678_10230292
596 Ga0207708_10010210
597 Ga0207708_10016472
598 Ga0207708_10853160
599 Ga0207641_10017890
600 Ga0207641_10112401
601 Ga0207648_10034797
602 Ga0207648_10219470
603 Ga0207676_10051665
604 Ga0207676_10214281
605 Ga0207676_10852774
606 Ga0207675_100815499
607 Ga0207675_101264200
608 Ga0207675_102638650
609 Ga0207683_10145396
610 Ga0207683_10157262
611 Ga0207683_11635086
612 Ga0207683_11755097
613 Ga0207698_10039052
614 Ga0209999_1034541
615 Ga0209983_1124518
616 Ga0209974_10061169
617 Ga0209974_10083087
618 Ga0207428_10025932
619 Ga0268265_11122108
620 Ga0268264_10098146
621 Ga0268264_10736124
622 Ga0268264_11054564
623 Ga0307408_100251602
624 Ga0307408_100391692
625 Ga0307408_100562569
626 Ga0307508_10020942
627 Ga0307405_10047568
628 Ga0307413_10045140
629 Ga0307410_10025464
630 Ga0307406_10785104
631 Ga0307406_10985500
632 Ga0307412_10285422
633 Ga0307409_100060294
634 Ga0307416_100025355
635 Ga0307416_100027623
636 Ga0307416_102621862
637 Ga0307414_10062682
638 Ga0307411_10899116
639 Ga0307415_100050982
640 Ga0307415_100153953
641 Ga0373959_0138284
642 Ga0373929_0199040
643 Ga0373940_0031292
644 Ga0373940_0137321
645 Ga0373952_0061410
646 Ga0373960_0218895
647 Ga0373961_0076727
648 Ga0373931_0804757
649 Ga0439436_0159325
650 Ga0439453_0011686
651 Ga0439433_0084705
652 Ga0439450_043047
653 Ga0439451_076711
654 Ga0439462_0009759
655 Ga0450920_129741
656 Ga0450898_025789
657 Ga0439446_0027707
658 Ga0439446_0049074
659 Ga0439446_0295732
660 Ga0439434_0183810
661 Ga0439435_0011856
662 Ga0439435_0030842
663 Ga0439464_0142578
664 Ga0450916_041710
665 Ga0466957_0356079
666 Ga0451576_0837667
667 Ga0466967_0293974
668 Ga0495656_0291801
669 Ga0496101_0328334
670 Ga0496102_0472646
671 Ga0496102_0775333
672 Ga0496106_0146429
673 Ga0496107_0112125
674 Ga0496109_0024472
675 Ga0496109_0195349
676 Ga0496109_0765956
677 Ga0496110_0147973
678 Ga0496112_0700059
679 Ga0496113_0367512
680 Ga0496122_0474473
681 Ga0496125_0005076
682 Ga0496126_0119483
683 Ga0501298_064778
684 Ga0501036_0712416
685 Ga0501039_0594651
686 Ga0501040_0360562
687 Ga0501042_0382097
688 Ga0501072_0587899
689 Ga0501072_0958816
690 Ga0501075_0127209
691 Ga0501076_0205113
692 Ga0501076_0266773
693 Ga0501248_050667
694 Ga0501225_0292353
695 Ga0501080_0158471
696 Ga0501080_0857607
697 Ga0501081_0456909
698 Ga0501083_0420826
699 Ga0501083_0733474
700 Ga0501044_1551947
701 Ga0501045_1002476
702 nmdc:mga05p37_190887_c1
703 nmdc:mga05p37_245602_c1
704 nmdc:mga05p37_89815_c1
705 nmdc:mga09592_18832_c1
706 nmdc:mga09592_201442_c1
707 nmdc:mga09592_576385_c1
708 nmdc:mga0qj67_104291_c1
709 nmdc:mga0qj67_288734_c1
710 nmdc:mga0qj67_405767_c1
711 nmdc:mga06r32_1806_c1
712 nmdc:mga06r32_325434_c1
713 nmdc:mga08y16_1024087_c1
714 nmdc:mga08y16_443180_c1
715 nmdc:mga08y16_724992_c1
716 nmdc:mga0n895_4443_c1
717 nmdc:mga0rr50_142522_c1
718 nmdc:mga0rr50_37120_c1
719 nmdc:mga0a205_40622_c1
720 Ga0501084_0140208
721 Ga0501084_0288718
722 Ga0501084_0973724
723 Ga0590071_003028
724 Ga0590074_006545
725 Ga0590075_000734
726 Ga0590077_003776
727 Ga0501082_0206456
728 Ga0501082_0612427
729 Ga0501082_0971547
730 Ga0530510_0156003

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02537

CRCB

CrcB-like protein, Camphor Resistance (CrcB)

28

140

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6bqo-assembly1.cif.gz_A structure of a dual topology fluoride channel with monobody s8 0.9462 2 123
6bqo-assembly2.cif.gz_B-2 structure of a dual topology fluoride channel with monobody s8 0.9422 2 123
6bx4-assembly2.cif.gz_B the crystal structure of fluoride channel fluc ec2 with monobody s9 0.9358 1 123
5a40-assembly2.cif.gz_C crystal structure of a dual topology fluoride ion channel. 0.9354 2 124
5kom-assembly1.cif.gz_A the crystal structure of fluoride channel fluc ec2 f83i mutant 0.9344 1 123
ID Description Score Start End Superfamily
af_Q58918_7_116_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9418 7 116 1.10.287.70
af_P9WP61_13_121_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9339 6 116 1.10.287.70
af_A4I767_271_383_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.931 6 116 1.10.287.70
af_P37002_6_119_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9307 6 117 1.10.287.70
af_Q58918_7_116_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9172 7 116 1.10.287.70
ID Description Score Start End GO Terms
AF-A0A496VKW7-F1-model_v4 Fluoride efflux transporter CrcB 0.9922 1 110 GO:0005886
GO:1903425
AF-A0A7C1WZG6-F1-model_v4 Fluoride-specific ion channel FluC 0.9904 3 123 GO:0005886
GO:0046872
GO:0062054
GO:0140114
AF-A0A659UKJ0-F1-model_v4 Fluoride efflux transporter CrcB 0.9885 1 111 GO:0005886
GO:1903425
AF-A0A1M6I5V1-F1-model_v4 Fluoride-specific ion channel FluC 0.9878 1 120 GO:0005886
GO:0046872
GO:0062054
GO:0140114
AF-A0A3B0YQG1-F1-model_v4 Fluoride ion transporter CrcB 0.9877 1 123 GO:0005886
GO:1903425

Map