F423570

General Info

Members Datasets Scaffolds Average Seq Length
365 231 730 172

Family's Representative Sequence

Representative Sequence 3300005345|Ga0070692_10067443|Ga0070692_100674432
Length 196
Sequence MELKYRQRIIATRVIINVPTYPAPKRNSKEIRMKWLLIAAISLAGLMILIVVIGACLPQKHTVSRTISLHHPADQVWSLISGPPTWRPGITNYQELPPHEGQRMWRETDKHGQTITFEAIESIPPRRLVTHIADPNLPFGGTWAYEIVPQGDSCTLTITENGEVYNPLFRFVSRFIMGHAATIDGYLTALNAKLSD

Samples

Sample ID Description Type Environment
1 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
106 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
160 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
164 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
168 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
169 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
170 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
171 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
172 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
173 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
174 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
175 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
176 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
177 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
178 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
181 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
182 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
183 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
184 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
185 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
186 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
187 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
188 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
189 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
190 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
191 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
192 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
193 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
194 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
195 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
196 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
197 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
198 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
199 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
200 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
201 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
202 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
203 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
204 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
205 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
206 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
207 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
208 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
209 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
210 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
211 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
212 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
213 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
214 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
215 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
216 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
217 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
218 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
219 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
220 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
221 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
222 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
223 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
224 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
225 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
226 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
227 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
228 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
229 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
230 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
231 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.18
Metatranscriptomes 0.82
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.19
Rhizosphere 96.99
Stem 0
Stem Tuber 0
Unclassified 20

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070692_10067443 3300005345 Bacteria 1899
2 Ga0065715_10021148 3300005293 Bacteria 2081
3 Ga0065707_10086306 3300005295 Bacteria 5540
4 Ga0065707_10154466 3300005295 Unclassified 1623
5 Ga0065707_10371549 3300005295 Bacteria 872
6 Ga0070676_10035320 3300005328 Bacteria 2874
7 Ga0070676_10551406 3300005328 Unclassified 825
8 Ga0070676_10590910 3300005328 Bacteria 799
9 Ga0070683_100022031 3300005329 Bacteria 5689
10 Ga0070683_100071030 3300005329 Bacteria 3248
11 Ga0070683_100525742 3300005329 Bacteria 1131
12 Ga0070690_100033135 3300005330 Bacteria 3232
13 Ga0070670_100232715 3300005331 Bacteria 1603
14 Ga0070677_10205297 3300005333 Unclassified 953
15 Ga0068869_100316258 3300005334 Bacteria 1265
16 Ga0070680_100133181 3300005336 Bacteria 2081
17 Ga0070680_100235838 3300005336 Unclassified 1546
18 Ga0068868_100215656 3300005338 Bacteria 1605
19 Ga0068868_101261614 3300005338 Bacteria 685
20 Ga0070660_100094174 3300005339 Bacteria 2366
21 Ga0070689_100084461 3300005340 Bacteria 2495
22 Ga0070692_10250789 3300005345 Bacteria 1060
23 Ga0070668_100018677 3300005347 Bacteria 5206
24 Ga0070669_100002609 3300005353 Bacteria 13035
25 Ga0070669_100019285 3300005353 Bacteria 4871
26 Ga0070669_100117909 3300005353 Bacteria 2021
27 Ga0070675_100188426 3300005354 Bacteria 1786
28 Ga0070671_100268942 3300005355 Unclassified 1449
29 Ga0070671_100848352 3300005355 Bacteria 797
30 Ga0070674_100166583 3300005356 Unclassified 1677
31 Ga0070673_100596957 3300005364 Unclassified 1007
32 Ga0070673_101052720 3300005364 Unclassified 759
33 Ga0070688_100086505 3300005365 Bacteria 2040
34 Ga0070688_100885164 3300005365 Bacteria 703
35 Ga0070659_100062886 3300005366 Bacteria 2935
36 Ga0070659_100501464 3300005366 Bacteria 1035
37 Ga0070667_100079716 3300005367 Bacteria 2800
38 Ga0070709_10897807 3300005434 Unclassified 700
39 Ga0070714_100433667 3300005435 Bacteria 1246
40 Ga0070713_100079371 3300005436 Bacteria 2796
41 Ga0070701_10149720 3300005438 Bacteria 1343
42 Ga0070701_10258181 3300005438 Bacteria 1055
43 Ga0070711_100356085 3300005439 Unclassified 1178
44 Ga0070711_100414680 3300005439 Unclassified 1096
45 Ga0070705_100495375 3300005440 Unclassified 926
46 Ga0070700_100370715 3300005441 Bacteria 1068
47 Ga0070694_100011694 3300005444 Bacteria 5437
48 Ga0070694_100087456 3300005444 Bacteria 2180
49 Ga0070708_100012325 3300005445 Bacteria 6973
50 Ga0070678_100065813 3300005456 Bacteria 2692
51 Ga0070662_100290946 3300005457 Bacteria 1324
52 Ga0070662_100347593 3300005457 Bacteria 1214
53 Ga0070681_10016811 3300005458 Bacteria 7306
54 Ga0070681_10107721 3300005458 Bacteria 2727
55 Ga0070681_10290156 3300005458 Unclassified 1546
56 Ga0070681_10505209 3300005458 Unclassified 1122
57 Ga0070681_10916173 3300005458 Archaea 795
58 Ga0068867_100051527 3300005459 Bacteria 3036
59 Ga0068867_100551633 3300005459 Unclassified 998
60 Ga0070706_100001398 3300005467 Bacteria 25511
61 Ga0070706_100084569 3300005467 Bacteria 2939
62 Ga0070706_100597155 3300005467 Archaea 1026
63 Ga0070707_100024478 3300005468 Bacteria 5719
64 Ga0070707_100031910 3300005468 Bacteria 5018
65 Ga0070698_100015220 3300005471 Bacteria 8135
66 Ga0070698_100808272 3300005471 Unclassified 882
67 Ga0070699_100077868 3300005518 Bacteria 2887
68 Ga0070699_100144561 3300005518 Bacteria 2101
69 Ga0070699_100815057 3300005518 Bacteria 854
70 Ga0070679_100019475 3300005530 Bacteria 6598
71 Ga0070679_100027929 3300005530 Bacteria 5559
72 Ga0070679_100089168 3300005530 Bacteria 3071
73 Ga0070679_100224320 3300005530 Bacteria 1839
74 Ga0070684_100062203 3300005535 Bacteria 3270
75 Ga0070684_100139546 3300005535 Viruses 2191
76 Ga0070684_100203963 3300005535 Unclassified 1801
77 Ga0070684_100216809 3300005535 Bacteria 1745
78 Ga0070697_100014942 3300005536 Bacteria 6094
79 Ga0070697_100053680 3300005536 Bacteria 3276
80 Ga0070697_100444893 3300005536 Bacteria 1128
81 Ga0070697_100951227 3300005536 Archaea 763
82 Ga0068853_100072670 3300005539 Bacteria 2998
83 Ga0068853_100726087 3300005539 Unclassified 949
84 Ga0070672_100189506 3300005543 Bacteria 1716
85 Ga0070686_100244216 3300005544 Bacteria 1309
86 Ga0070695_100147166 3300005545 Unclassified 1640
87 Ga0070696_101449882 3300005546 Unclassified 586
88 Ga0070693_100002301 3300005547 Bacteria 8765
89 Ga0070665_100015531 3300005548 Bacteria 7648
90 Ga0070665_100251091 3300005548 Bacteria 1770
91 Ga0070704_100183871 3300005549 Unclassified 1674
92 Ga0068855_100011238 3300005563 Bacteria 10812
93 Ga0068855_100073109 3300005563 Unclassified 3984
94 Ga0068855_100297647 3300005563 Bacteria 1787
95 Ga0070664_100046981 3300005564 Bacteria 3647
96 Ga0070664_100129580 3300005564 Bacteria 2215
97 Ga0070664_100613451 3300005564 Bacteria 1009
98 Ga0068857_100028115 3300005577 Bacteria 4960
99 Ga0068857_100036596 3300005577 Bacteria 4349
100 Ga0068857_100065918 3300005577 Bacteria 3221
101 Ga0068857_100174961 3300005577 Unclassified 1952
102 Ga0068857_100257835 3300005577 Unclassified 1600
103 Ga0068854_100020869 3300005578 Bacteria 4439
104 Ga0068854_100440568 3300005578 Bacteria 1086
105 Ga0068856_100326468 3300005614 Bacteria 1552
106 Ga0068852_100056681 3300005616 Unclassified 3387
107 Ga0068852_100069448 3300005616 Bacteria 3088
108 Ga0068852_100219011 3300005616 Bacteria 1809
109 Ga0068852_100576130 3300005616 Unclassified 1128
110 Ga0068859_100259031 3300005617 Bacteria 1830
111 Ga0068859_100392418 3300005617 Bacteria 1484
112 Ga0068864_100208944 3300005618 Bacteria 1797
113 Ga0068861_100289630 3300005719 Bacteria 1413
114 Ga0068861_101551890 3300005719 Unclassified 651
115 Ga0068851_10056147 3300005834 Bacteria 2008
116 Ga0068870_10012112 3300005840 Bacteria 4021
117 Ga0068863_100220240 3300005841 Bacteria 1828
118 Ga0068858_100216928 3300005842 Bacteria 1811
119 Ga0068860_100247155 3300005843 Bacteria 1736
120 Ga0068860_100845490 3300005843 Bacteria 930
121 Ga0068862_100018647 3300005844 Bacteria 5780
122 Ga0068862_100021411 3300005844 Bacteria 5402
123 Ga0070717_10300956 3300006028 Bacteria 1426
124 Ga0070717_10458651 3300006028 Bacteria 1149
125 Ga0070717_11395648 3300006028 Unclassified 636
126 Ga0070712_100177270 3300006175 Bacteria 1658
127 Ga0075428_100472417 3300006844 Bacteria 1342
128 Ga0075430_100172573 3300006846 Bacteria 1799
129 Ga0075430_100188110 3300006846 Bacteria 1716
130 Ga0075431_100215742 3300006847 Bacteria 1959
131 Ga0075433_10019072 3300006852 Bacteria 5706
132 Ga0075433_10033975 3300006852 Bacteria 4376
133 Ga0075433_10693220 3300006852 Bacteria 892
134 Ga0075434_100058577 3300006871 Bacteria 3829
135 Ga0075429_100111834 3300006880 Bacteria 2387
136 Ga0075429_100211411 3300006880 Bacteria 1700
137 Ga0075429_100246395 3300006880 Bacteria 1565
138 Ga0068865_100636309 3300006881 Unclassified 905
139 Ga0068865_101388834 3300006881 Bacteria 627
140 Ga0075436_100385700 3300006914 Bacteria 1013
141 Ga0097620_100259021 3300006931 Bacteria 1830
142 Ga0097620_100392425 3300006931 Bacteria 1484
143 Ga0075435_100040777 3300007076 Bacteria 3709
144 Ga0099795_10074171 3300007788 Bacteria 1289
145 Ga0105240_10057039 3300009093 Bacteria 4883
146 Ga0105240_10300159 3300009093 Bacteria 1837
147 Ga0111539_10000498 3300009094 Bacteria 49981
148 Ga0111539_10186531 3300009094 Bacteria 2422
149 Ga0111539_10231902 3300009094 Bacteria 2150
150 Ga0105245_10000140 3300009098 Bacteria 68524
151 Ga0105247_10819983 3300009101 Unclassified 711
152 Ga0114129_10014994 3300009147 Bacteria 11038
153 Ga0114129_10036215 3300009147 Bacteria 6969
154 Ga0105241_10010585 3300009174 Bacteria 6766
155 Ga0105242_10077196 3300009176 Bacteria 2778
156 Ga0105242_10104142 3300009176 Bacteria 2408
157 Ga0105248_10267737 3300009177 Bacteria 1924
158 Ga0105248_11057336 3300009177 Unclassified 917
159 Ga0105237_11011127 3300009545 Unclassified 838
160 Ga0105238_10026945 3300009551 Bacteria 5858
161 Ga0105238_10323678 3300009551 Bacteria 1528
162 Ga0105238_10569043 3300009551 Bacteria 1139
163 Ga0105249_10015840 3300009553 Bacteria 6680
164 Ga0105249_10023651 3300009553 Bacteria 5515
165 Ga0105249_10024298 3300009553 Bacteria 5445
166 Ga0099796_10038467 3300010159 Bacteria 1605
167 Ga0105239_10165588 3300010375 Bacteria 2472
168 Ga0105239_11144647 3300010375 Unclassified 896
169 Ga0157373_10115884 3300013100 Bacteria 1883
170 Ga0157373_10239569 3300013100 Bacteria 1282
171 Ga0157371_10162859 3300013102 Bacteria 1593
172 Ga0157370_10063839 3300013104 Bacteria 3487
173 Ga0157370_10079184 3300013104 Bacteria 3095
174 Ga0157370_10254830 3300013104 Bacteria 1623
175 Ga0157369_10123541 3300013105 Bacteria 2746
176 Ga0157369_10140742 3300013105 Unclassified 2553
177 Ga0157374_10082069 3300013296 Bacteria 3060
178 Ga0157378_10367527 3300013297 Unclassified 1409
179 Ga0157378_10384513 3300013297 Bacteria 1379
180 Ga0163162_10130528 3300013306 Bacteria 2621
181 Ga0157372_10086862 3300013307 Bacteria 3548
182 Ga0157375_10301781 3300013308 Bacteria 1765
183 Ga0157380_10075076 3300014326 Bacteria 2746
184 Ga0157379_10313659 3300014968 Bacteria 1431
185 Ga0157376_10234635 3300014969 Bacteria 1706
186 Ga0163161_10221980 3300017792 Bacteria 1464
187 Ga0213875_10013367 3300021388 Bacteria 4034
188 Ga0207697_10010806 3300025315 Bacteria 3884
189 Ga0207656_10014793 3300025321 Bacteria 3014
190 Ga0207656_10274433 3300025321 Unclassified 830
191 Ga0207682_10184832 3300025893 Unclassified 953
192 Ga0207688_10522062 3300025901 Unclassified 745
193 Ga0207680_10768454 3300025903 Bacteria 691
194 Ga0207647_10135298 3300025904 Bacteria 1447
195 Ga0207645_10012779 3300025907 Bacteria 5688
196 Ga0207645_10438233 3300025907 Unclassified 881
197 Ga0207643_10050674 3300025908 Bacteria 2354
198 Ga0207684_10018085 3300025910 Bacteria 6039
199 Ga0207684_10028688 3300025910 Bacteria 4740
200 Ga0207684_10432921 3300025910 Archaea 1130
201 Ga0207654_10064353 3300025911 Bacteria 2156
202 Ga0207707_10187049 3300025912 Bacteria 1807
203 Ga0207707_10286930 3300025912 Bacteria 1424
204 Ga0207707_10913876 3300025912 Unclassified 725
205 Ga0207707_11152447 3300025912 Unclassified 629
206 Ga0207695_10010053 3300025913 Bacteria 11619
207 Ga0207671_10006356 3300025914 Bacteria 10539
208 Ga0207693_10140445 3300025915 Bacteria 1899
209 Ga0207663_10085922 3300025916 Bacteria 2073
210 Ga0207663_10107253 3300025916 Bacteria 1889
211 Ga0207660_10019720 3300025917 Bacteria 4513
212 Ga0207660_10107940 3300025917 Bacteria 2090
213 Ga0207660_10131921 3300025917 Bacteria 1902
214 Ga0207662_10021310 3300025918 Bacteria 3703
215 Ga0207657_10058069 3300025919 Bacteria 3331
216 Ga0207649_10347030 3300025920 Bacteria 1097
217 Ga0207652_10378652 3300025921 Bacteria 1277
218 Ga0207646_10004591 3300025922 Bacteria 14937
219 Ga0207681_10290374 3300025923 Bacteria 1290
220 Ga0207694_10010338 3300025924 Bacteria 7035
221 Ga0207694_10634196 3300025924 Unclassified 900
222 Ga0207650_10098969 3300025925 Bacteria 2241
223 Ga0207650_10202122 3300025925 Bacteria 1592
224 Ga0207659_10163234 3300025926 Bacteria 1751
225 Ga0207687_10000108 3300025927 Bacteria 59942
226 Ga0207700_10061008 3300025928 Bacteria 2858
227 Ga0207664_11735018 3300025929 Unclassified 547
228 Ga0207690_10044361 3300025932 Bacteria 2930
229 Ga0207690_10097948 3300025932 Unclassified 2088
230 Ga0207690_10212471 3300025932 Bacteria 1476
231 Ga0207706_10045951 3300025933 Bacteria 3867
232 Ga0207706_10532156 3300025933 Unclassified 1013
233 Ga0207686_10129045 3300025934 Unclassified 1732
234 Ga0207670_10252694 3300025936 Bacteria 1363
235 Ga0207669_10058229 3300025937 Unclassified 2357
236 Ga0207704_10111223 3300025938 Bacteria 1852
237 Ga0207665_10011806 3300025939 Bacteria 5739
238 Ga0207691_10047339 3300025940 Bacteria 3946
239 Ga0207691_10167801 3300025940 Bacteria 1923
240 Ga0207711_10190774 3300025941 Bacteria 1867
241 Ga0207711_10871496 3300025941 Unclassified 837
242 Ga0207689_10124424 3300025942 Bacteria 2121
243 Ga0207661_10110361 3300025944 Unclassified 2325
244 Ga0207661_10242629 3300025944 Bacteria 1599
245 Ga0207679_10206867 3300025945 Bacteria 1643
246 Ga0207679_10815371 3300025945 Unclassified 851
247 Ga0207679_10988585 3300025945 Unclassified 771
248 Ga0207667_10071409 3300025949 Bacteria 3609
249 Ga0207667_10130578 3300025949 Bacteria 2588
250 Ga0207667_10439697 3300025949 Bacteria 1326
251 Ga0207712_10007059 3300025961 Bacteria 7086
252 Ga0207712_10554729 3300025961 Bacteria 989
253 Ga0207668_10145674 3300025972 Bacteria 1827
254 Ga0207668_10709907 3300025972 Unclassified 884
255 Ga0207640_10772416 3300025981 Bacteria 830
256 Ga0207640_10935270 3300025981 Viruses 759
257 Ga0207639_10461251 3300026041 Bacteria 1155
258 Ga0207708_10162102 3300026075 Bacteria 1766
259 Ga0207641_10936049 3300026088 Unclassified 861
260 Ga0207648_10006615 3300026089 Bacteria 11513
261 Ga0207648_10060652 3300026089 Bacteria 3298
262 Ga0207648_10209709 3300026089 Unclassified 1729
263 Ga0207676_10764940 3300026095 Bacteria 940
264 Ga0207674_10001634 3300026116 Bacteria 28842
265 Ga0207674_10008731 3300026116 Bacteria 11666
266 Ga0207674_10678159 3300026116 Bacteria 995
267 Ga0207675_100114258 3300026118 Bacteria 2550
268 Ga0207675_100628448 3300026118 Bacteria 1079
269 Ga0207683_10039575 3300026121 Bacteria 4114
270 Ga0207698_10123534 3300026142 Unclassified 2196
271 Ga0207698_10265418 3300026142 Unclassified 1579
272 Ga0207698_10365262 3300026142 Bacteria 1368
273 Ga0207428_10011148 3300027907 Bacteria 7973
274 Ga0268266_10059059 3300028379 Bacteria 3304
275 Ga0268265_10013321 3300028380 Bacteria 5587
276 Ga0268265_10039984 3300028380 Bacteria 3460
277 Ga0268265_10736621 3300028380 Bacteria 955
278 Ga0268264_10869529 3300028381 Bacteria 904
279 Ga0265338_10305865 3300028800 Bacteria 1154
280 Ga0265770_1001759 3300030878 Bacteria 2958
281 Ga0265765_1027871 3300030879 Bacteria 709
282 Ga0265760_10001366 3300031090 Bacteria 7160
283 Ga0307406_10542524 3300031901 Unclassified 950
284 Ga0307414_10703220 3300032004 Unclassified 915
285 Ga0307415_100427878 3300032126 Bacteria 1138
286 Ga0373934_0007202 3300035086 Bacteria 4124
287 Ga0373923_0092315 3300035111 Unclassified 1326
288 Ga0373953_0063632 3300035117 Bacteria 1512
289 Ga0373956_0030858 3300035119 Bacteria 2345
290 Ga0373957_0019251 3300035120 Bacteria 2400
291 Ga0373955_0008301 3300035172 Bacteria 4818
292 Ga0373933_0070007 3300035724 Bacteria 2133
293 Ga0373947_0034443 3300035725 Bacteria 2995
294 Ga0373947_0112495 3300035725 Unclassified 1722
295 Ga0373937_0001066 3300036401 Bacteria 23146
296 Ga0373937_0357909 3300036401 Bacteria 1383
297 Ga0373925_0196930 3300037068 Bacteria 1601
298 Ga0395905_1062306 3300037471 Unclassified 713
299 Ga0436364_0694113 3300037853 Bacteria 6712
300 Ga0436365_0527535 3300039437 Unclassified 606
301 Ga0439446_0042848 3300042156 Bacteria 1337
302 Ga0453683_0172968 3300044673 Bacteria 1368
303 Ga0466963_0261998 3300044694 Bacteria 1214
304 Ga0466963_0472090 3300044694 Bacteria 885
305 Ga0466957_0000088 3300044842 Bacteria 36833
306 Ga0466959_0555341 3300045049 Bacteria 774
307 Ga0451576_0521711 3300045051 Unclassified 1248
308 Ga0495629_0107832 3300046459 Bacteria 1943
309 Ga0495629_0280628 3300046459 Unclassified 1143
310 Ga0495580_0210222 3300046472 Bacteria 1339
311 Ga0495639_0234114 3300046475 Bacteria 905
312 Ga0495664_0125951 3300046477 Unclassified 1550
313 Ga0495608_0286826 3300046511 Bacteria 1021
314 Ga0495628_0034702 3300046516 Bacteria 4057
315 Ga0495630_0007901 3300046517 Bacteria 7628
316 Ga0495630_0054330 3300046517 Bacteria 3001
317 Ga0495666_0057822 3300046526 Bacteria 1856
318 Ga0495652_0306360 3300046529 Bacteria 1153
319 Ga0495665_0079400 3300046531 Bacteria 1726
320 Ga0495586_0016313 3300046535 Bacteria 3950
321 Ga0495586_0045001 3300046535 Bacteria 2378
322 Ga0495587_0019993 3300046536 Bacteria 4139
323 Ga0495645_0000316 3300046543 Bacteria 34637
324 Ga0495667_0057046 3300046559 Bacteria 2568
325 Ga0495634_0353694 3300046642 Bacteria 879
326 Ga0495635_0290280 3300046663 Bacteria 1098
327 Ga0495588_0066964 3300046674 Unclassified 1864
328 Ga0495599_0003268 3300046678 Bacteria 9440
329 Ga0495623_0001658 3300046679 Bacteria 14981
330 Ga0495647_0237782 3300046681 Archaea 808
331 Ga0495658_0450650 3300046683 Archaea 822
332 Ga0495658_0629238 3300046683 Bacteria 687
333 Ga0495613_0114515 3300046689 Unclassified 1941
334 Ga0495581_0259352 3300047315 Bacteria 1016
335 Ga0495680_0118553 3300047322 Unclassified 1956
336 Ga0495684_0042990 3300047471 Bacteria 3459
337 Ga0495684_0044395 3300047471 Unclassified 3403
338 Ga0496105_0809771 3300048908 Unclassified 712
339 Ga0496109_0611621 3300048912 Bacteria 1026
340 Ga0496109_0988290 3300048912 Bacteria 779
341 Ga0496110_1087822 3300048913 Unclassified 707
342 Ga0496111_0020080 3300048914 Bacteria 4647
343 Ga0496112_0022523 3300048915 Bacteria 6005
344 Ga0496112_0202835 3300048915 Bacteria 1942
345 Ga0496115_0005292 3300048918 Bacteria 9384
346 Ga0501291_040210 3300049514 Unclassified 820
347 Ga0501068_0406964 3300049584 Bacteria 878
348 Ga0501216_030215 3300049660 Bacteria 997
349 nmdc:mga05p37_397551_c1 3300050507 Bacteria 1610
350 nmdc:mga05p37_99247_c1 3300050507 Unclassified 3586
351 nmdc:mga09592_139708_c1 3300050508 Bacteria 2087
352 nmdc:mga09592_172152_c1 3300050508 Bacteria 1872
353 nmdc:mga09592_57710_c1 3300050508 Bacteria 3281
354 nmdc:mga0qj67_13126_c1 3300050509 Bacteria 6255
355 nmdc:mga08y16_38922_c1 3300050511 Bacteria 4991
356 nmdc:mga08y16_997032_c1 3300050511 Bacteria 818
357 nmdc:mga0n895_15083_c1 3300050512 Bacteria 7042
358 nmdc:mga0n895_177044_c1 3300050512 Bacteria 2164
359 nmdc:mga0rr50_227464_c1 3300050513 Bacteria 1542
360 nmdc:mga0rr50_261641_c1 3300050513 Bacteria 1439
361 nmdc:mga08x19_237933_c1 3300050514 Bacteria 1254
362 nmdc:mga0a205_11612_c3 3300050515 Bacteria 6678
363 nmdc:mga0a205_1902_c1 3300050515 Bacteria 18131
364 nmdc:mga0a205_603080_c1 3300050515 Bacteria 951
365 Ga0495601_0007188 3300053077 Bacteria 6533
366 Ga0070692_10067443
367 Ga0065715_10021148
368 Ga0065707_10086306
369 Ga0065707_10154466
370 Ga0065707_10371549
371 Ga0070676_10035320
372 Ga0070676_10551406
373 Ga0070676_10590910
374 Ga0070683_100022031
375 Ga0070683_100071030
376 Ga0070683_100525742
377 Ga0070690_100033135
378 Ga0070670_100232715
379 Ga0070677_10205297
380 Ga0068869_100316258
381 Ga0070680_100133181
382 Ga0070680_100235838
383 Ga0068868_100215656
384 Ga0068868_101261614
385 Ga0070660_100094174
386 Ga0070689_100084461
387 Ga0070692_10250789
388 Ga0070668_100018677
389 Ga0070669_100002609
390 Ga0070669_100019285
391 Ga0070669_100117909
392 Ga0070675_100188426
393 Ga0070671_100268942
394 Ga0070671_100848352
395 Ga0070674_100166583
396 Ga0070673_100596957
397 Ga0070673_101052720
398 Ga0070688_100086505
399 Ga0070688_100885164
400 Ga0070659_100062886
401 Ga0070659_100501464
402 Ga0070667_100079716
403 Ga0070709_10897807
404 Ga0070714_100433667
405 Ga0070713_100079371
406 Ga0070701_10149720
407 Ga0070701_10258181
408 Ga0070711_100356085
409 Ga0070711_100414680
410 Ga0070705_100495375
411 Ga0070700_100370715
412 Ga0070694_100011694
413 Ga0070694_100087456
414 Ga0070708_100012325
415 Ga0070678_100065813
416 Ga0070662_100290946
417 Ga0070662_100347593
418 Ga0070681_10016811
419 Ga0070681_10107721
420 Ga0070681_10290156
421 Ga0070681_10505209
422 Ga0070681_10916173
423 Ga0068867_100051527
424 Ga0068867_100551633
425 Ga0070706_100001398
426 Ga0070706_100084569
427 Ga0070706_100597155
428 Ga0070707_100024478
429 Ga0070707_100031910
430 Ga0070698_100015220
431 Ga0070698_100808272
432 Ga0070699_100077868
433 Ga0070699_100144561
434 Ga0070699_100815057
435 Ga0070679_100019475
436 Ga0070679_100027929
437 Ga0070679_100089168
438 Ga0070679_100224320
439 Ga0070684_100062203
440 Ga0070684_100139546
441 Ga0070684_100203963
442 Ga0070684_100216809
443 Ga0070697_100014942
444 Ga0070697_100053680
445 Ga0070697_100444893
446 Ga0070697_100951227
447 Ga0068853_100072670
448 Ga0068853_100726087
449 Ga0070672_100189506
450 Ga0070686_100244216
451 Ga0070695_100147166
452 Ga0070696_101449882
453 Ga0070693_100002301
454 Ga0070665_100015531
455 Ga0070665_100251091
456 Ga0070704_100183871
457 Ga0068855_100011238
458 Ga0068855_100073109
459 Ga0068855_100297647
460 Ga0070664_100046981
461 Ga0070664_100129580
462 Ga0070664_100613451
463 Ga0068857_100028115
464 Ga0068857_100036596
465 Ga0068857_100065918
466 Ga0068857_100174961
467 Ga0068857_100257835
468 Ga0068854_100020869
469 Ga0068854_100440568
470 Ga0068856_100326468
471 Ga0068852_100056681
472 Ga0068852_100069448
473 Ga0068852_100219011
474 Ga0068852_100576130
475 Ga0068859_100259031
476 Ga0068859_100392418
477 Ga0068864_100208944
478 Ga0068861_100289630
479 Ga0068861_101551890
480 Ga0068851_10056147
481 Ga0068870_10012112
482 Ga0068863_100220240
483 Ga0068858_100216928
484 Ga0068860_100247155
485 Ga0068860_100845490
486 Ga0068862_100018647
487 Ga0068862_100021411
488 Ga0070717_10300956
489 Ga0070717_10458651
490 Ga0070717_11395648
491 Ga0070712_100177270
492 Ga0075428_100472417
493 Ga0075430_100172573
494 Ga0075430_100188110
495 Ga0075431_100215742
496 Ga0075433_10019072
497 Ga0075433_10033975
498 Ga0075433_10693220
499 Ga0075434_100058577
500 Ga0075429_100111834
501 Ga0075429_100211411
502 Ga0075429_100246395
503 Ga0068865_100636309
504 Ga0068865_101388834
505 Ga0075436_100385700
506 Ga0097620_100259021
507 Ga0097620_100392425
508 Ga0075435_100040777
509 Ga0099795_10074171
510 Ga0105240_10057039
511 Ga0105240_10300159
512 Ga0111539_10000498
513 Ga0111539_10186531
514 Ga0111539_10231902
515 Ga0105245_10000140
516 Ga0105247_10819983
517 Ga0114129_10014994
518 Ga0114129_10036215
519 Ga0105241_10010585
520 Ga0105242_10077196
521 Ga0105242_10104142
522 Ga0105248_10267737
523 Ga0105248_11057336
524 Ga0105237_11011127
525 Ga0105238_10026945
526 Ga0105238_10323678
527 Ga0105238_10569043
528 Ga0105249_10015840
529 Ga0105249_10023651
530 Ga0105249_10024298
531 Ga0099796_10038467
532 Ga0105239_10165588
533 Ga0105239_11144647
534 Ga0157373_10115884
535 Ga0157373_10239569
536 Ga0157371_10162859
537 Ga0157370_10063839
538 Ga0157370_10079184
539 Ga0157370_10254830
540 Ga0157369_10123541
541 Ga0157369_10140742
542 Ga0157374_10082069
543 Ga0157378_10367527
544 Ga0157378_10384513
545 Ga0163162_10130528
546 Ga0157372_10086862
547 Ga0157375_10301781
548 Ga0157380_10075076
549 Ga0157379_10313659
550 Ga0157376_10234635
551 Ga0163161_10221980
552 Ga0213875_10013367
553 Ga0207697_10010806
554 Ga0207656_10014793
555 Ga0207656_10274433
556 Ga0207682_10184832
557 Ga0207688_10522062
558 Ga0207680_10768454
559 Ga0207647_10135298
560 Ga0207645_10012779
561 Ga0207645_10438233
562 Ga0207643_10050674
563 Ga0207684_10018085
564 Ga0207684_10028688
565 Ga0207684_10432921
566 Ga0207654_10064353
567 Ga0207707_10187049
568 Ga0207707_10286930
569 Ga0207707_10913876
570 Ga0207707_11152447
571 Ga0207695_10010053
572 Ga0207671_10006356
573 Ga0207693_10140445
574 Ga0207663_10085922
575 Ga0207663_10107253
576 Ga0207660_10019720
577 Ga0207660_10107940
578 Ga0207660_10131921
579 Ga0207662_10021310
580 Ga0207657_10058069
581 Ga0207649_10347030
582 Ga0207652_10378652
583 Ga0207646_10004591
584 Ga0207681_10290374
585 Ga0207694_10010338
586 Ga0207694_10634196
587 Ga0207650_10098969
588 Ga0207650_10202122
589 Ga0207659_10163234
590 Ga0207687_10000108
591 Ga0207700_10061008
592 Ga0207664_11735018
593 Ga0207690_10044361
594 Ga0207690_10097948
595 Ga0207690_10212471
596 Ga0207706_10045951
597 Ga0207706_10532156
598 Ga0207686_10129045
599 Ga0207670_10252694
600 Ga0207669_10058229
601 Ga0207704_10111223
602 Ga0207665_10011806
603 Ga0207691_10047339
604 Ga0207691_10167801
605 Ga0207711_10190774
606 Ga0207711_10871496
607 Ga0207689_10124424
608 Ga0207661_10110361
609 Ga0207661_10242629
610 Ga0207679_10206867
611 Ga0207679_10815371
612 Ga0207679_10988585
613 Ga0207667_10071409
614 Ga0207667_10130578
615 Ga0207667_10439697
616 Ga0207712_10007059
617 Ga0207712_10554729
618 Ga0207668_10145674
619 Ga0207668_10709907
620 Ga0207640_10772416
621 Ga0207640_10935270
622 Ga0207639_10461251
623 Ga0207708_10162102
624 Ga0207641_10936049
625 Ga0207648_10006615
626 Ga0207648_10060652
627 Ga0207648_10209709
628 Ga0207676_10764940
629 Ga0207674_10001634
630 Ga0207674_10008731
631 Ga0207674_10678159
632 Ga0207675_100114258
633 Ga0207675_100628448
634 Ga0207683_10039575
635 Ga0207698_10123534
636 Ga0207698_10265418
637 Ga0207698_10365262
638 Ga0207428_10011148
639 Ga0268266_10059059
640 Ga0268265_10013321
641 Ga0268265_10039984
642 Ga0268265_10736621
643 Ga0268264_10869529
644 Ga0265338_10305865
645 Ga0265770_1001759
646 Ga0265765_1027871
647 Ga0265760_10001366
648 Ga0307406_10542524
649 Ga0307414_10703220
650 Ga0307415_100427878
651 Ga0373934_0007202
652 Ga0373923_0092315
653 Ga0373953_0063632
654 Ga0373956_0030858
655 Ga0373957_0019251
656 Ga0373955_0008301
657 Ga0373933_0070007
658 Ga0373947_0034443
659 Ga0373947_0112495
660 Ga0373937_0001066
661 Ga0373937_0357909
662 Ga0373925_0196930
663 Ga0395905_1062306
664 Ga0436364_0694113
665 Ga0436365_0527535
666 Ga0439446_0042848
667 Ga0453683_0172968
668 Ga0466963_0261998
669 Ga0466963_0472090
670 Ga0466957_0000088
671 Ga0466959_0555341
672 Ga0451576_0521711
673 Ga0495629_0107832
674 Ga0495629_0280628
675 Ga0495580_0210222
676 Ga0495639_0234114
677 Ga0495664_0125951
678 Ga0495608_0286826
679 Ga0495628_0034702
680 Ga0495630_0007901
681 Ga0495630_0054330
682 Ga0495666_0057822
683 Ga0495652_0306360
684 Ga0495665_0079400
685 Ga0495586_0016313
686 Ga0495586_0045001
687 Ga0495587_0019993
688 Ga0495645_0000316
689 Ga0495667_0057046
690 Ga0495634_0353694
691 Ga0495635_0290280
692 Ga0495588_0066964
693 Ga0495599_0003268
694 Ga0495623_0001658
695 Ga0495647_0237782
696 Ga0495658_0450650
697 Ga0495658_0629238
698 Ga0495613_0114515
699 Ga0495581_0259352
700 Ga0495680_0118553
701 Ga0495684_0042990
702 Ga0495684_0044395
703 Ga0496105_0809771
704 Ga0496109_0611621
705 Ga0496109_0988290
706 Ga0496110_1087822
707 Ga0496111_0020080
708 Ga0496112_0022523
709 Ga0496112_0202835
710 Ga0496115_0005292
711 Ga0501291_040210
712 Ga0501068_0406964
713 Ga0501216_030215
714 nmdc:mga05p37_397551_c1
715 nmdc:mga05p37_99247_c1
716 nmdc:mga09592_139708_c1
717 nmdc:mga09592_172152_c1
718 nmdc:mga09592_57710_c1
719 nmdc:mga0qj67_13126_c1
720 nmdc:mga08y16_38922_c1
721 nmdc:mga08y16_997032_c1
722 nmdc:mga0n895_15083_c1
723 nmdc:mga0n895_177044_c1
724 nmdc:mga0rr50_227464_c1
725 nmdc:mga0rr50_261641_c1
726 nmdc:mga08x19_237933_c1
727 nmdc:mga0a205_11612_c3
728 nmdc:mga0a205_1902_c1
729 nmdc:mga0a205_603080_c1
730 Ga0495601_0007188

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10604

Polyketide_cyc2

Polyketide cyclase / dehydrase and lipid transport

60

194

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
7tmu-assembly4.cif.gz_D crystal structure of the protein of unknown function ypo0625 from yersinia pestis 0.846 26 162
2m89-assembly1.cif.gz_B solution structure of the aha1 dimer from colwellia psychrerythraea 0.8428 29 130
2res-assembly1.cif.gz_A tetracenomycin aro/cyc mutant r69a 0.8206 28 170
2rez-assembly1.cif.gz_A tetracenomycin aro/cyc nai structure 0.8176 25 168
4c9i-assembly5.cif.gz_E crystal structure of the strawberry pathogenesis-related 10 (pr-10) fra a 1e protein (form b) 0.8044 28 134
ID Description Score Start End Superfamily
2m89B00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8428 29 130 3.30.530.20
af_I6X666_8_157_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8427 29 167 3.30.530.20
af_A0A1D8PNQ2_25_168_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8226 29 166 3.30.530.20
af_Q6PBN4_75_220_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8224 29 163 3.30.530.20
af_A0A1D6NAC7_96_241_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8222 29 163 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A2V8HTB4-F1-model_v4 SRPBCC family protein 0.9876 1 164
AF-A0A652NU53-F1-model_v4 SRPBCC family protein 0.9873 2 163
AF-A0A7Y4RNZ7-F1-model_v4 SRPBCC family protein 0.9685 2 165
AF-A0A2V8IFM3-F1-model_v4 SRPBCC family protein 0.9669 1 161 GO:0016020
AF-A0A838T4B6-F1-model_v4 SRPBCC domain-containing protein 0.9637 1 165 GO:0016020

Map