F423435

General Info

Members Datasets Scaffolds Average Seq Length
364 202 364 122

Family's Representative Sequence

Representative Sequence 3300046536|Ga0495587_0337020|Ga0495587_0337020_249_698
Length 149
Sequence VIKLLLIKLVLVRNSFSDMIFVKTEEQKMIQGLRTAIYPTPDLARGKAWYAHVLERQPYFDQPFYVGFSVGGFELGLIPDGEPGLAGVQIYWGVPDAASELARLTQLGAAIHEDVKDVGGGIKVASVRDPFGNLFGILENPHFKLEEVR

Samples

Sample ID Description Type Environment
1 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
2 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
3 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
35 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
36 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
47 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
49 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
51 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
52 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
53 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
54 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
70 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
73 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
74 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
75 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
76 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
77 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
78 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
79 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
80 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
81 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
82 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
83 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
84 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
85 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
86 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
87 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
88 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
89 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
90 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
91 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
92 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
93 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
94 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
95 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
96 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
97 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
98 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
99 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
100 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
101 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
102 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
103 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
104 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
105 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
106 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
107 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
108 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
109 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
110 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
111 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
112 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
113 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
114 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
115 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
116 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
117 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
118 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
119 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
120 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
121 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
122 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
123 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
124 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
125 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
126 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
127 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
128 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
129 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
130 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
131 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
132 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
133 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
134 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
135 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
136 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
137 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
138 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
139 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
140 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
141 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
142 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
143 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
144 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
145 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
146 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
147 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
148 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
149 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
150 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
151 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
152 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
153 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
154 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
155 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
156 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
157 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
158 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
159 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
160 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
161 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
162 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
163 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
164 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
165 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
166 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
167 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
168 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
169 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
174 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
175 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
176 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
177 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
178 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
179 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
180 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
181 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
182 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
183 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
184 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
185 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
186 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
187 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
188 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
189 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
190 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
191 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
194 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
195 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
197 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
198 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
199 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
200 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
201 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
202 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.02
Nodule 0.55
Rhizoplane 6.59
Rhizosphere 84.89
Stem 0
Stem Tuber 0
Unclassified 4.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10089908 3300003322 Bacteria 5273
2 rootL2_10284800 3300003322 Unclassified 1399
3 Ga0055524_1000026 3300003775 Bacteria 214653
4 Ga0065165_1013815 3300005262 Bacteria 3179
5 Ga0065165_1034528 3300005262 Bacteria 1563
6 Ga0070658_10067980 3300005327 Bacteria 2912
7 Ga0070658_10467240 3300005327 Bacteria 1088
8 Ga0070676_10212379 3300005328 Bacteria 1274
9 Ga0070680_100217566 3300005336 Bacteria 1612
10 Ga0068868_100128603 3300005338 Unclassified 2071
11 Ga0070660_100405517 3300005339 Bacteria 1127
12 Ga0070692_10555942 3300005345 Unclassified 752
13 Ga0070688_101434788 3300005365 Unclassified 560
14 Ga0070659_100585747 3300005366 Bacteria 957
15 Ga0070701_10141370 3300005438 Bacteria 1377
16 Ga0070705_100268827 3300005440 Bacteria 1206
17 Ga0070708_100461948 3300005445 Bacteria 1198
18 Ga0070681_10259413 3300005458 Unclassified 1650
19 Ga0070681_11570276 3300005458 Unclassified 583
20 Ga0070706_100053869 3300005467 Unclassified 3713
21 Ga0070706_100108993 3300005467 Bacteria 2576
22 Ga0070707_100044512 3300005468 Unclassified 4250
23 Ga0070707_100755643 3300005468 Bacteria 936
24 Ga0070698_100411686 3300005471 Unclassified 1286
25 Ga0070698_101484277 3300005471 Bacteria 629
26 Ga0070699_100419973 3300005518 Bacteria 1210
27 Ga0070699_100677364 3300005518 Unclassified 942
28 Ga0070697_100430963 3300005536 Unclassified 1147
29 Ga0070696_102003606 3300005546 Unclassified 503
30 Ga0070704_100331995 3300005549 Bacteria 1278
31 Ga0068855_100280146 3300005563 Bacteria 1852
32 Ga0068855_101638170 3300005563 Bacteria 658
33 Ga0068857_100586362 3300005577 Bacteria 1053
34 Ga0070702_100186098 3300005615 Bacteria 1363
35 Ga0068852_100734621 3300005616 Bacteria 999
36 Ga0068864_101562355 3300005618 Bacteria 663
37 Ga0068863_100547978 3300005841 Bacteria 1142
38 Ga0068862_100113514 3300005844 Unclassified 2380
39 Ga0068862_101196849 3300005844 Bacteria 758
40 Ga0070717_10046579 3300006028 Bacteria 3549
41 Ga0097621_100156995 3300006237 Bacteria 1953
42 Ga0075428_100022173 3300006844 Bacteria 7031
43 Ga0075430_100592951 3300006846 Bacteria 914
44 Ga0099826_10000003 3300006948 Bacteria 1067817
45 Ga0105244_10055703 3300009036 Bacteria 2002
46 Ga0105241_11707458 3300009174 Bacteria 612
47 Ga0105242_11544010 3300009176 Bacteria 696
48 Ga0105248_11394582 3300009177 Unclassified 793
49 Ga0105237_10244068 3300009545 Bacteria 1797
50 Ga0105237_12128993 3300009545 Unclassified 570
51 Ga0105249_10198876 3300009553 Bacteria 1960
52 Ga0105239_10506504 3300010375 Bacteria 1373
53 Ga0157378_10061714 3300013297 Bacteria 3347
54 Ga0157372_10103095 3300013307 Bacteria 3260
55 Ga0157372_10729908 3300013307 Bacteria 1152
56 Ga0157372_12268159 3300013307 Bacteria 624
57 Ga0157375_13496747 3300013308 Unclassified 523
58 Ga0163163_10829653 3300014325 Unclassified 988
59 Ga0213872_10023256 3300021361 Bacteria 2851
60 Ga0209563_100003 3300025230 Bacteria 1932942
61 Ga0209026_1004953 3300025250 Bacteria 3743
62 Ga0209677_103953 3300025253 Bacteria 4507
63 Ga0209233_1002738 3300025261 Bacteria 6343
64 Ga0209565_1006289 3300025263 Bacteria 3348
65 Ga0209675_1085772 3300025291 Bacteria 576
66 Ga0209564_1037388 3300025295 Bacteria 1369
67 Ga0209256_1000013 3300025299 Bacteria 689442
68 Ga0207705_11337023 3300025909 Bacteria 546
69 Ga0207684_10159909 3300025910 Bacteria 1939
70 Ga0207684_10418387 3300025910 Unclassified 1151
71 Ga0207660_10178266 3300025917 Bacteria 1649
72 Ga0207657_10025883 3300025919 Bacteria 5403
73 Ga0207657_11006174 3300025919 Unclassified 639
74 Ga0207646_10043782 3300025922 Unclassified 4019
75 Ga0207646_10742596 3300025922 Bacteria 876
76 Ga0207690_10028113 3300025932 Bacteria 3561
77 Ga0207686_10135618 3300025934 Bacteria 1694
78 Ga0207689_10310882 3300025942 Bacteria 1307
79 Ga0207667_10584581 3300025949 Bacteria 1127
80 Ga0207712_10891114 3300025961 Bacteria 786
81 Ga0207677_11594120 3300026023 Bacteria 604
82 Ga0207676_10367734 3300026095 Unclassified 1335
83 Ga0207674_10016161 3300026116 Bacteria 8176
84 Ga0207698_10036921 3300026142 Bacteria 3593
85 Ga0209282_1000002 3300027666 Bacteria 1067825
86 Ga0268265_10230558 3300028380 Bacteria 1627
87 Ga0268264_10145196 3300028381 Unclassified 2121
88 Ga0268264_11626596 3300028381 Unclassified 656
89 Ga0265336_10000003 3300028666 Bacteria 423158
90 Ga0265324_10008759 3300029957 Bacteria 3995
91 Ga0265330_10034607 3300031235 Bacteria 2256
92 Ga0265332_10011014 3300031238 Bacteria 4017
93 Ga0265325_10024831 3300031241 Bacteria 3257
94 Ga0265329_10001154 3300031242 Bacteria 13000
95 Ga0265340_10224388 3300031247 Bacteria 841
96 Ga0265327_10004189 3300031251 Bacteria 12988
97 Ga0265316_10160719 3300031344 Bacteria 1679
98 Ga0265314_10022391 3300031711 Bacteria 4840
99 Ga0265342_10022057 3300031712 Bacteria 4055
100 Ga0307409_100318761 3300031995 Bacteria 1454
101 Ga0395899_0001045 3300037312 Bacteria 25131
102 Ga0395899_0124093 3300037312 Bacteria 1847
103 Ga0395899_0782599 3300037312 Bacteria 591
104 Ga0395899_0929751 3300037312 Bacteria 528
105 Ga0395900_0000065 3300037418 Bacteria 196327
106 Ga0395900_0001188 3300037418 Bacteria 32276
107 Ga0395900_0144093 3300037418 Bacteria 2437
108 Ga0395900_0195525 3300037418 Bacteria 2049
109 Ga0395900_0364654 3300037418 Bacteria 1415
110 Ga0395900_1114149 3300037418 Bacteria 706
111 Ga0395898_0047238 3300037466 Bacteria 4225
112 Ga0395898_0133841 3300037466 Bacteria 2373
113 Ga0395898_0295787 3300037466 Bacteria 1544
114 Ga0395898_0359564 3300037466 Bacteria 1388
115 Ga0395905_0033989 3300037471 Bacteria 4789
116 Ga0395905_0170932 3300037471 Bacteria 2041
117 Ga0395905_0607827 3300037471 Bacteria 995
118 Ga0395905_0737635 3300037471 Bacteria 887
119 Ga0395905_1147193 3300037471 Bacteria 680
120 Ga0395901_0000639 3300038443 Bacteria 40528
121 Ga0395901_0128128 3300038443 Bacteria 2667
122 Ga0395901_0321276 3300038443 Bacteria 1601
123 Ga0395901_0488045 3300038443 Bacteria 1255
124 Ga0395901_1182142 3300038443 Bacteria 731
125 Ga0395901_1357759 3300038443 Bacteria 670
126 Ga0436363_1618113 3300039450 Bacteria 625
127 Ga0439449_0018520 3300042007 Bacteria 2614
128 Ga0439455_0057639 3300042012 Bacteria 1025
129 Ga0450911_032750 3300042115 Bacteria 674
130 Ga0439458_0022397 3300042157 Bacteria 1468
131 Ga0466969_0053105 3300044656 Bacteria 1990
132 Ga0466969_0364192 3300044656 Bacteria 655
133 Ga0466969_0428027 3300044656 Bacteria 601
134 Ga0466965_0257882 3300044683 Bacteria 936
135 Ga0466966_0036383 3300044684 Bacteria 3178
136 Ga0466966_0044174 3300044684 Bacteria 2853
137 Ga0466966_0117964 3300044684 Bacteria 1632
138 Ga0466961_0173274 3300044693 Bacteria 1341
139 Ga0466971_0071520 3300044719 Bacteria 1575
140 Ga0466970_0064923 3300044765 Bacteria 1958
141 Ga0466970_0197946 3300044765 Bacteria 1117
142 Ga0466970_0848438 3300044765 Bacteria 536
143 Ga0466970_0955198 3300044765 Bacteria 505
144 Ga0466957_0072196 3300044842 Bacteria 2136
145 Ga0466959_0010234 3300045049 Bacteria 6697
146 Ga0466959_0101321 3300045049 Bacteria 2061
147 Ga0466958_0178413 3300045836 Bacteria 1347
148 Ga0466958_0314943 3300045836 Bacteria 1005
149 Ga0466958_0353961 3300045836 Bacteria 945
150 Ga0466958_0627581 3300045836 Bacteria 699
151 Ga0466958_0702759 3300045836 Bacteria 659
152 Ga0466967_0153379 3300045976 Bacteria 2155
153 Ga0495617_000008 3300046452 Bacteria 340369
154 Ga0495617_140148 3300046452 Bacteria 772
155 Ga0495627_000812 3300046453 Bacteria 22811
156 Ga0495592_0000007 3300046454 Bacteria 180892
157 Ga0495590_0021775 3300046457 Bacteria 2270
158 Ga0495590_0064000 3300046457 Bacteria 1287
159 Ga0495590_0139039 3300046457 Bacteria 876
160 Ga0495638_0008635 3300046460 Bacteria 7206
161 Ga0495638_0054669 3300046460 Bacteria 2481
162 Ga0495653_0025046 3300046463 Bacteria 4800
163 Ga0495605_0000083 3300046474 Bacteria 124953
164 Ga0495605_0000160 3300046474 Bacteria 86202
165 Ga0495605_0005132 3300046474 Bacteria 7632
166 Ga0495605_0122582 3300046474 Bacteria 1177
167 Ga0495662_0008152 3300046476 Bacteria 5161
168 Ga0495664_0010958 3300046477 Bacteria 5100
169 Ga0495584_0000390 3300046491 Bacteria 30206
170 Ga0495584_0001843 3300046491 Bacteria 12301
171 Ga0495584_0097848 3300046491 Bacteria 1482
172 Ga0495584_0681055 3300046491 Bacteria 524
173 Ga0495585_0002256 3300046492 Bacteria 13935
174 Ga0495585_0169076 3300046492 Bacteria 1130
175 Ga0495585_0186198 3300046492 Bacteria 1064
176 Ga0495596_0007400 3300046500 Bacteria 4954
177 Ga0495596_0052104 3300046500 Bacteria 1603
178 Ga0495607_0002156 3300046501 Bacteria 16392
179 Ga0495607_0002570 3300046501 Bacteria 14663
180 Ga0495607_0008312 3300046501 Bacteria 7097
181 Ga0495607_0063626 3300046501 Bacteria 2086
182 Ga0495607_0193450 3300046501 Bacteria 1011
183 Ga0495607_0236580 3300046501 Bacteria 885
184 Ga0495607_0244917 3300046501 Bacteria 865
185 Ga0495583_0000004 3300046506 Bacteria 655287
186 Ga0495583_0196312 3300046506 Bacteria 821
187 Ga0495606_0001441 3300046507 Bacteria 31901
188 Ga0495606_0010703 3300046507 Bacteria 7570
189 Ga0495606_0026012 3300046507 Bacteria 4176
190 Ga0495616_0002266 3300046513 Bacteria 12867
191 Ga0495616_0025480 3300046513 Bacteria 3159
192 Ga0495616_0055585 3300046513 Bacteria 1959
193 Ga0495616_0194871 3300046513 Bacteria 893
194 Ga0495616_0205547 3300046513 Bacteria 863
195 Ga0495618_0012438 3300046514 Bacteria 5169
196 Ga0495628_0000269 3300046516 Bacteria 46574
197 Ga0495631_0001062 3300046518 Bacteria 17059
198 Ga0495631_0010034 3300046518 Bacteria 4704
199 Ga0495631_0417170 3300046518 Bacteria 571
200 Ga0495631_0468933 3300046518 Bacteria 536
201 Ga0495632_0067327 3300046519 Bacteria 1727
202 Ga0495637_0019371 3300046520 Bacteria 3147
203 Ga0495637_0179214 3300046520 Bacteria 786
204 Ga0495643_0000552 3300046522 Bacteria 46298
205 Ga0495643_0040693 3300046522 Bacteria 2537
206 Ga0495643_0057648 3300046522 Bacteria 2069
207 Ga0495643_0273214 3300046522 Bacteria 780
208 Ga0495644_0003575 3300046523 Bacteria 6135
209 Ga0495644_0057026 3300046523 Bacteria 1467
210 Ga0495648_0002936 3300046524 Bacteria 15301
211 Ga0495648_0003845 3300046524 Bacteria 13030
212 Ga0495648_0016296 3300046524 Bacteria 5363
213 Ga0495648_0043005 3300046524 Bacteria 2836
214 Ga0495666_0000706 3300046526 Bacteria 15182
215 Ga0495642_0001020 3300046528 Bacteria 13014
216 Ga0495642_0037846 3300046528 Bacteria 1953
217 Ga0495652_0036690 3300046529 Bacteria 4259
218 Ga0495654_0003954 3300046530 Bacteria 8943
219 Ga0495654_0111724 3300046530 Bacteria 1246
220 Ga0495640_0022410 3300046533 Bacteria 4617
221 Ga0495586_0000401 3300046535 Bacteria 26270
222 Ga0495587_0114225 3300046536 Bacteria 1549
223 Ga0495587_0337020 3300046536 Bacteria 841
224 Ga0495609_0000445 3300046538 Bacteria 34051
225 Ga0495609_0001680 3300046538 Bacteria 14357
226 Ga0495609_0034541 3300046538 Bacteria 2292
227 Ga0495609_0042800 3300046538 Bacteria 2034
228 Ga0495609_0103023 3300046538 Bacteria 1235
229 Ga0495609_0205191 3300046538 Bacteria 822
230 Ga0495597_0001302 3300046542 Bacteria 18321
231 Ga0495597_0010381 3300046542 Bacteria 4553
232 Ga0495597_0405403 3300046542 Bacteria 518
233 Ga0495645_0193258 3300046543 Bacteria 1385
234 Ga0495633_0141852 3300046558 Bacteria 1111
235 Ga0495633_0151860 3300046558 Bacteria 1069
236 Ga0495656_0071840 3300046615 Bacteria 1539
237 Ga0495656_0164495 3300046615 Bacteria 1080
238 Ga0495656_0223828 3300046615 Bacteria 942
239 Ga0495656_0385035 3300046615 Bacteria 731
240 Ga0495656_0679327 3300046615 Bacteria 553
241 Ga0495668_0003268 3300046616 Bacteria 12323
242 Ga0495668_0004225 3300046616 Bacteria 10342
243 Ga0495668_0010168 3300046616 Bacteria 5719
244 Ga0495611_0066083 3300046648 Bacteria 1648
245 Ga0495625_0009439 3300046660 Bacteria 8163
246 Ga0495625_0021655 3300046660 Bacteria 4945
247 Ga0495625_0708953 3300046660 Bacteria 593
248 Ga0495659_0010448 3300046664 Bacteria 2978
249 Ga0495661_0001097 3300046665 Bacteria 23749
250 Ga0495661_0005999 3300046665 Bacteria 8577
251 Ga0495661_0008637 3300046665 Bacteria 7041
252 Ga0495661_0011442 3300046665 Bacteria 6022
253 Ga0495661_0047411 3300046665 Bacteria 2616
254 Ga0495661_0106095 3300046665 Bacteria 1572
255 Ga0495588_0000052 3300046674 Bacteria 304493
256 Ga0495599_0002580 3300046678 Bacteria 10556
257 Ga0495669_0013873 3300046684 Bacteria 3439
258 Ga0495624_0046256 3300046690 Unclassified 2768
259 Ga0495670_0063640 3300046691 Bacteria 1857
260 Ga0495671_0001415 3300046692 Bacteria 16132
261 Ga0495671_0205928 3300046692 Bacteria 953
262 Ga0495671_0329868 3300046692 Bacteria 732
263 Ga0495649_0446661 3300046694 Bacteria 646
264 Ga0495649_0594023 3300046694 Bacteria 546
265 Ga0495589_0000058 3300046794 Bacteria 107640
266 Ga0495589_0000501 3300046794 Bacteria 27708
267 Ga0495589_0001047 3300046794 Bacteria 16678
268 Ga0495589_0026341 3300046794 Bacteria 2946
269 Ga0495660_0000050 3300046810 Bacteria 140329
270 Ga0495660_0008687 3300046810 Bacteria 5938
271 Ga0495660_0025436 3300046810 Bacteria 3362
272 Ga0495660_0130587 3300046810 Bacteria 1260
273 Ga0495636_0002131 3300047318 Bacteria 7599
274 Ga0495636_0002363 3300047318 Bacteria 7242
275 Ga0495636_0160938 3300047318 Bacteria 1011
276 Ga0495674_0050216 3300047319 Bacteria 3681
277 Ga0495672_0000222 3300047320 Bacteria 81058
278 Ga0495672_0000765 3300047320 Bacteria 34954
279 Ga0495672_0080736 3300047320 Bacteria 1813
280 Ga0495672_0170981 3300047320 Bacteria 1108
281 Ga0495672_0222724 3300047320 Bacteria 930
282 Ga0495676_0257136 3300047321 Bacteria 1189
283 Ga0495683_0015974 3300047323 Bacteria 3899
284 Ga0495683_0044394 3300047323 Bacteria 2235
285 Ga0495683_0051699 3300047323 Bacteria 2053
286 Ga0495687_000003 3300047443 Bacteria 859509
287 Ga0495687_000073 3300047443 Bacteria 155429
288 Ga0495687_000487 3300047443 Bacteria 48069
289 Ga0495687_000489 3300047443 Bacteria 47669
290 Ga0495687_019504 3300047443 Bacteria 3325
291 Ga0495687_021095 3300047443 Bacteria 3162
292 Ga0495677_0000144 3300047445 Bacteria 34126
293 Ga0495677_0027805 3300047445 Bacteria 2052
294 Ga0495679_011141 3300047446 Bacteria 3489
295 Ga0495679_012264 3300047446 Bacteria 3269
296 Ga0495685_000132 3300047447 Bacteria 25959
297 Ga0495673_0011436 3300047469 Bacteria 4771
298 Ga0495681_0188468 3300047470 Bacteria 843
299 Ga0495686_0038570 3300047472 Bacteria 3054
300 Ga0495686_0355809 3300047472 Bacteria 795
301 Ga0495602_0000903 3300048088 Bacteria 28669
302 Ga0495615_0040957 3300048090 Bacteria 1156
303 Ga0495626_0000102 3300048091 Bacteria 110315
304 Ga0495626_0000145 3300048091 Bacteria 89603
305 Ga0495626_0009485 3300048091 Bacteria 5260
306 Ga0495626_0016842 3300048091 Bacteria 3703
307 Ga0495626_0021269 3300048091 Bacteria 3220
308 Ga0495626_0129019 3300048091 Bacteria 1081
309 Ga0496101_0253716 3300048904 Bacteria 1371
310 Ga0496102_0199416 3300048905 Bacteria 1886
311 Ga0496102_0362350 3300048905 Bacteria 1365
312 Ga0496102_0535057 3300048905 Bacteria 1094
313 Ga0496103_0030385 3300048906 Bacteria 3287
314 Ga0496103_0191926 3300048906 Bacteria 1313
315 Ga0496103_0310785 3300048906 Bacteria 1014
316 Ga0496104_0166531 3300048907 Bacteria 2114
317 Ga0496104_0189677 3300048907 Bacteria 1967
318 Ga0496105_0014567 3300048908 Bacteria 6262
319 Ga0496106_0034658 3300048909 Bacteria 3771
320 Ga0496106_1508015 3300048909 Bacteria 517
321 Ga0496107_0277146 3300048910 Bacteria 1248
322 Ga0496107_1307734 3300048910 Bacteria 518
323 Ga0496108_0641279 3300048911 Bacteria 924
324 Ga0496109_0243166 3300048912 Bacteria 1694
325 Ga0496110_0000275 3300048913 Bacteria 33355
326 Ga0496110_0353914 3300048913 Bacteria 1338
327 Ga0496111_0495171 3300048914 Bacteria 900
328 Ga0496111_0736635 3300048914 Bacteria 716
329 Ga0496113_0007646 3300048916 Bacteria 6974
330 Ga0496113_0200388 3300048916 Bacteria 1586
331 Ga0496114_0110961 3300048917 Bacteria 2350
332 Ga0496114_0453666 3300048917 Bacteria 1135
333 Ga0496119_0261934 3300048922 Bacteria 867
334 Ga0496120_0022028 3300048923 Bacteria 4013
335 Ga0496122_0002401 3300048925 Bacteria 26723
336 Ga0496122_0034998 3300048925 Bacteria 4098
337 Ga0496122_0452766 3300048925 Bacteria 636
338 Ga0496123_0006224 3300048926 Bacteria 11643
339 Ga0496123_0007046 3300048926 Bacteria 10701
340 Ga0496123_0010024 3300048926 Bacteria 8440
341 Ga0496124_0027304 3300048927 Bacteria 5126
342 Ga0496124_0040451 3300048927 Bacteria 4031
343 Ga0496124_0047431 3300048927 Bacteria 3676
344 Ga0496125_0020660 3300048928 Bacteria 6176
345 Ga0496125_0255218 3300048928 Bacteria 1103
346 Ga0496126_0746545 3300048929 Bacteria 756
347 Ga0495678_001414 3300049459 Bacteria 19020
348 Ga0495678_001721 3300049459 Bacteria 16367
349 Ga0495678_007066 3300049459 Bacteria 5876
350 Ga0495678_104631 3300049459 Bacteria 976
351 Ga0495682_0000763 3300049460 Bacteria 20680
352 Ga0495682_0004796 3300049460 Bacteria 5709
353 Ga0501034_0277181 3300049571 Bacteria 1617
354 Ga0501047_0305562 3300049581 Bacteria 1432
355 Ga0501257_025624 3300049686 Bacteria 1404
356 Ga0501241_041355 3300049758 Bacteria 894
357 Ga0501035_0000552 3300049822 Bacteria 41623
358 Ga0501044_0107080 3300049823 Bacteria 2807
359 nmdc:mga0qj67_556892_c1 3300050509 Bacteria 919
360 nmdc:mga0a205_58014_c1 3300050515 Bacteria 3426
361 Ga0500616_0000869 3300053153 Bacteria 33425
362 Ga0501084_0036190 3300054114 Bacteria 4124
363 Ga0466962_0368564 3300061719 Bacteria 716
364 Ga0530510_0026955 3300061734 Bacteria 4116

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025922 Ga0207646_10742596 Ga0207646_107425962 115
2 3300003322 rootL2_10089908 rootL2_100899089 121
3 3300003322 rootL2_10284800 rootL2_102848002 121
4 3300003775 Ga0055524_1000026 Ga0055524_1000026122 121
5 3300005262 Ga0065165_1013815 Ga0065165_10138155 121
6 3300005262 Ga0065165_1034528 Ga0065165_10345282 121
7 3300005327 Ga0070658_10067980 Ga0070658_100679802 121
8 3300005327 Ga0070658_10467240 Ga0070658_104672402 121
9 3300005328 Ga0070676_10212379 Ga0070676_102123792 121
10 3300005336 Ga0070680_100217566 Ga0070680_1002175663 121
11 3300005338 Ga0068868_100128603 Ga0068868_1001286033 121
12 3300005339 Ga0070660_100405517 Ga0070660_1004055171 121
13 3300005345 Ga0070692_10555942 Ga0070692_105559421 121
14 3300005365 Ga0070688_101434788 Ga0070688_1014347881 121
15 3300005366 Ga0070659_100585747 Ga0070659_1005857471 121
16 3300005438 Ga0070701_10141370 Ga0070701_101413703 121
17 3300005440 Ga0070705_100268827 Ga0070705_1002688272 121
18 3300005445 Ga0070708_100461948 Ga0070708_1004619481 121
19 3300005458 Ga0070681_10259413 Ga0070681_102594132 121
20 3300005458 Ga0070681_11570276 Ga0070681_115702761 121
21 3300005467 Ga0070706_100053869 Ga0070706_1000538692 121
22 3300005467 Ga0070706_100108993 Ga0070706_1001089934 121
23 3300005468 Ga0070707_100044512 Ga0070707_1000445126 121
24 3300005468 Ga0070707_100755643 Ga0070707_1007556432 121
25 3300005471 Ga0070698_100411686 Ga0070698_1004116862 121
26 3300005471 Ga0070698_101484277 Ga0070698_1014842771 121
27 3300005518 Ga0070699_100419973 Ga0070699_1004199732 121
28 3300005518 Ga0070699_100677364 Ga0070699_1006773641 121
29 3300005536 Ga0070697_100430963 Ga0070697_1004309632 121
30 3300005546 Ga0070696_102003606 Ga0070696_1020036061 121
31 3300005549 Ga0070704_100331995 Ga0070704_1003319953 121
32 3300005563 Ga0068855_100280146 Ga0068855_1002801462 121
33 3300005563 Ga0068855_101638170 Ga0068855_1016381702 121
34 3300005577 Ga0068857_100586362 Ga0068857_1005863622 121
35 3300005615 Ga0070702_100186098 Ga0070702_1001860983 121
36 3300005616 Ga0068852_100734621 Ga0068852_1007346212 121
37 3300005618 Ga0068864_101562355 Ga0068864_1015623551 121
38 3300005841 Ga0068863_100547978 Ga0068863_1005479782 121
39 3300005844 Ga0068862_100113514 Ga0068862_1001135143 121
40 3300005844 Ga0068862_101196849 Ga0068862_1011968491 121
41 3300006028 Ga0070717_10046579 Ga0070717_100465793 121
42 3300006237 Ga0097621_100156995 Ga0097621_1001569952 121
43 3300006844 Ga0075428_100022173 Ga0075428_1000221736 121
44 3300006846 Ga0075430_100592951 Ga0075430_1005929512 121
45 3300006948 Ga0099826_10000003 Ga0099826_10000003939 121
46 3300009036 Ga0105244_10055703 Ga0105244_100557035 121
47 3300009174 Ga0105241_11707458 Ga0105241_117074581 121
48 3300009176 Ga0105242_11544010 Ga0105242_115440101 121
49 3300009177 Ga0105248_11394582 Ga0105248_113945822 121
50 3300009545 Ga0105237_10244068 Ga0105237_102440683 121
51 3300009545 Ga0105237_12128993 Ga0105237_121289931 121
52 3300009553 Ga0105249_10198876 Ga0105249_101988764 121
53 3300010375 Ga0105239_10506504 Ga0105239_105065042 121
54 3300013297 Ga0157378_10061714 Ga0157378_100617143 121
55 3300013307 Ga0157372_10103095 Ga0157372_101030956 121
56 3300013307 Ga0157372_10729908 Ga0157372_107299082 121
57 3300013307 Ga0157372_12268159 Ga0157372_122681592 121
58 3300013308 Ga0157375_13496747 Ga0157375_134967471 121
59 3300014325 Ga0163163_10829653 Ga0163163_108296532 121
60 3300021361 Ga0213872_10023256 Ga0213872_100232563 121
61 3300025230 Ga0209563_100003 Ga0209563_1000031588 121
62 3300025250 Ga0209026_1004953 Ga0209026_10049533 121
63 3300025253 Ga0209677_103953 Ga0209677_1039532 121
64 3300025261 Ga0209233_1002738 Ga0209233_10027384 121
65 3300025263 Ga0209565_1006289 Ga0209565_10062893 121
66 3300025291 Ga0209675_1085772 Ga0209675_10857722 121
67 3300025295 Ga0209564_1037388 Ga0209564_10373883 121
68 3300025299 Ga0209256_1000013 Ga0209256_1000013534 121
69 3300025909 Ga0207705_11337023 Ga0207705_113370231 121
70 3300025910 Ga0207684_10159909 Ga0207684_101599094 121
71 3300025910 Ga0207684_10418387 Ga0207684_104183872 121
72 3300025917 Ga0207660_10178266 Ga0207660_101782663 121
73 3300025919 Ga0207657_10025883 Ga0207657_100258832 121
74 3300025919 Ga0207657_11006174 Ga0207657_110061742 121
75 3300025922 Ga0207646_10043782 Ga0207646_100437822 121
76 3300025932 Ga0207690_10028113 Ga0207690_100281131 121
77 3300025934 Ga0207686_10135618 Ga0207686_101356183 121
78 3300025942 Ga0207689_10310882 Ga0207689_103108822 121
79 3300025949 Ga0207667_10584581 Ga0207667_105845812 121
80 3300025961 Ga0207712_10891114 Ga0207712_108911141 121
81 3300026023 Ga0207677_11594120 Ga0207677_115941201 121
82 3300026095 Ga0207676_10367734 Ga0207676_103677341 121
83 3300026116 Ga0207674_10016161 Ga0207674_100161615 121
84 3300026142 Ga0207698_10036921 Ga0207698_100369214 121
85 3300027666 Ga0209282_1000002 Ga0209282_100000269 121
86 3300028380 Ga0268265_10230558 Ga0268265_102305583 121
87 3300028381 Ga0268264_10145196 Ga0268264_101451962 121
88 3300028381 Ga0268264_11626596 Ga0268264_116265962 121
89 3300028666 Ga0265336_10000003 Ga0265336_10000003113 121
90 3300029957 Ga0265324_10008759 Ga0265324_100087594 121
91 3300031235 Ga0265330_10034607 Ga0265330_100346074 121
92 3300031238 Ga0265332_10011014 Ga0265332_100110144 121
93 3300031241 Ga0265325_10024831 Ga0265325_100248316 121
94 3300031242 Ga0265329_10001154 Ga0265329_1000115411 121
95 3300031247 Ga0265340_10224388 Ga0265340_102243881 121
96 3300031251 Ga0265327_10004189 Ga0265327_100041894 121
97 3300031344 Ga0265316_10160719 Ga0265316_101607193 121
98 3300031711 Ga0265314_10022391 Ga0265314_100223913 121
99 3300031712 Ga0265342_10022057 Ga0265342_100220577 121
100 3300031995 Ga0307409_100318761 Ga0307409_1003187612 121
101 3300037312 Ga0395899_0001045 Ga0395899_0001045_4572_4937 121
102 3300037312 Ga0395899_0124093 Ga0395899_0124093_1085_1450 121
103 3300037312 Ga0395899_0782599 Ga0395899_0782599_95_460 121
104 3300037312 Ga0395899_0929751 Ga0395899_0929751_70_435 121
105 3300037418 Ga0395900_0000065 Ga0395900_0000065_187006_187371 121
106 3300037418 Ga0395900_0001188 Ga0395900_0001188_12177_12542 121
107 3300037418 Ga0395900_0144093 Ga0395900_0144093_1422_1787 121
108 3300037418 Ga0395900_0195525 Ga0395900_0195525_849_1214 121
109 3300037418 Ga0395900_0364654 Ga0395900_0364654_242_607 121
110 3300037418 Ga0395900_1114149 Ga0395900_1114149_67_432 121
111 3300037466 Ga0395898_0047238 Ga0395898_0047238_15_380 121
112 3300037466 Ga0395898_0133841 Ga0395898_0133841_1532_1897 121
113 3300037466 Ga0395898_0295787 Ga0395898_0295787_930_1295 121
114 3300037466 Ga0395898_0359564 Ga0395898_0359564_781_1146 121
115 3300037471 Ga0395905_0033989 Ga0395905_0033989_4175_4540 121
116 3300037471 Ga0395905_0170932 Ga0395905_0170932_175_540 121
117 3300037471 Ga0395905_0607827 Ga0395905_0607827_35_400 121
118 3300037471 Ga0395905_0737635 Ga0395905_0737635_169_534 121
119 3300037471 Ga0395905_1147193 Ga0395905_1147193_119_484 121
120 3300038443 Ga0395901_0000639 Ga0395901_0000639_28558_28923 121
121 3300038443 Ga0395901_0128128 Ga0395901_0128128_2248_2613 121
122 3300038443 Ga0395901_0321276 Ga0395901_0321276_832_1197 121
123 3300038443 Ga0395901_0488045 Ga0395901_0488045_639_1004 121
124 3300038443 Ga0395901_1182142 Ga0395901_1182142_286_651 121
125 3300038443 Ga0395901_1357759 Ga0395901_1357759_212_577 121
126 3300039450 Ga0436363_1618113 Ga0436363_1618113_67_432 121
127 3300042007 Ga0439449_0018520 Ga0439449_0018520_1243_1608 121
128 3300042012 Ga0439455_0057639 Ga0439455_0057639_440_805 121
129 3300042115 Ga0450911_032750 Ga0450911_032750_136_501 121
130 3300042157 Ga0439458_0022397 Ga0439458_0022397_856_1221 121
131 3300044656 Ga0466969_0053105 Ga0466969_0053105_805_1170 121
132 3300044656 Ga0466969_0364192 Ga0466969_0364192_247_612 121
133 3300044656 Ga0466969_0428027 Ga0466969_0428027_154_519 121
134 3300044683 Ga0466965_0257882 Ga0466965_0257882_459_824 121
135 3300044684 Ga0466966_0036383 Ga0466966_0036383_2734_3099 121
136 3300044684 Ga0466966_0044174 Ga0466966_0044174_219_584 121
137 3300044684 Ga0466966_0117964 Ga0466966_0117964_814_1179 121
138 3300044693 Ga0466961_0173274 Ga0466961_0173274_178_543 121
139 3300044719 Ga0466971_0071520 Ga0466971_0071520_1068_1433 121
140 3300044765 Ga0466970_0064923 Ga0466970_0064923_1528_1893 121
141 3300044765 Ga0466970_0197946 Ga0466970_0197946_525_890 121
142 3300044765 Ga0466970_0848438 Ga0466970_0848438_58_423 121
143 3300044765 Ga0466970_0955198 Ga0466970_0955198_88_453 121
144 3300044842 Ga0466957_0072196 Ga0466957_0072196_386_751 121
145 3300045049 Ga0466959_0010234 Ga0466959_0010234_2797_3162 121
146 3300045049 Ga0466959_0101321 Ga0466959_0101321_490_855 121
147 3300045836 Ga0466958_0178413 Ga0466958_0178413_560_925 121
148 3300045836 Ga0466958_0314943 Ga0466958_0314943_482_847 121
149 3300045836 Ga0466958_0353961 Ga0466958_0353961_158_523 121
150 3300045836 Ga0466958_0627581 Ga0466958_0627581_75_440 121
151 3300045836 Ga0466958_0702759 Ga0466958_0702759_29_394 121
152 3300045976 Ga0466967_0153379 Ga0466967_0153379_1454_1819 121
153 3300046452 Ga0495617_000008 Ga0495617_000008_94462_94827 121
154 3300046452 Ga0495617_140148 Ga0495617_140148_191_556 121
155 3300046453 Ga0495627_000812 Ga0495627_000812_21339_21704 121
156 3300046454 Ga0495592_0000007 Ga0495592_0000007_108464_108829 121
157 3300046457 Ga0495590_0021775 Ga0495590_0021775_307_672 121
158 3300046457 Ga0495590_0064000 Ga0495590_0064000_684_1049 121
159 3300046457 Ga0495590_0139039 Ga0495590_0139039_262_627 121
160 3300046460 Ga0495638_0008635 Ga0495638_0008635_537_902 121
161 3300046460 Ga0495638_0054669 Ga0495638_0054669_2016_2381 121
162 3300046463 Ga0495653_0025046 Ga0495653_0025046_2013_2405 121
163 3300046474 Ga0495605_0000083 Ga0495605_0000083_21227_21592 121
164 3300046474 Ga0495605_0000160 Ga0495605_0000160_73936_74301 121
165 3300046474 Ga0495605_0005132 Ga0495605_0005132_486_851 121
166 3300046474 Ga0495605_0122582 Ga0495605_0122582_228_593 121
167 3300046476 Ga0495662_0008152 Ga0495662_0008152_3262_3627 121
168 3300046477 Ga0495664_0010958 Ga0495664_0010958_564_929 121
169 3300046491 Ga0495584_0000390 Ga0495584_0000390_19525_19890 121
170 3300046491 Ga0495584_0001843 Ga0495584_0001843_2035_2400 121
171 3300046491 Ga0495584_0097848 Ga0495584_0097848_894_1259 121
172 3300046491 Ga0495584_0681055 Ga0495584_0681055_96_461 121
173 3300046492 Ga0495585_0002256 Ga0495585_0002256_77_442 121
174 3300046492 Ga0495585_0169076 Ga0495585_0169076_754_1119 121
175 3300046492 Ga0495585_0186198 Ga0495585_0186198_509_874 121
176 3300046500 Ga0495596_0007400 Ga0495596_0007400_1023_1388 121
177 3300046500 Ga0495596_0052104 Ga0495596_0052104_974_1369 121
178 3300046501 Ga0495607_0002156 Ga0495607_0002156_11236_11601 121
179 3300046501 Ga0495607_0002570 Ga0495607_0002570_12614_12979 121
180 3300046501 Ga0495607_0008312 Ga0495607_0008312_4528_4893 121
181 3300046501 Ga0495607_0063626 Ga0495607_0063626_360_725 121
182 3300046501 Ga0495607_0193450 Ga0495607_0193450_617_982 121
183 3300046501 Ga0495607_0236580 Ga0495607_0236580_354_719 121
184 3300046501 Ga0495607_0244917 Ga0495607_0244917_354_719 121
185 3300046506 Ga0495583_0000004 Ga0495583_0000004_551572_551937 121
186 3300046506 Ga0495583_0196312 Ga0495583_0196312_192_557 121
187 3300046507 Ga0495606_0001441 Ga0495606_0001441_882_1247 121
188 3300046507 Ga0495606_0010703 Ga0495606_0010703_3685_4050 121
189 3300046507 Ga0495606_0026012 Ga0495606_0026012_1583_1948 121
190 3300046513 Ga0495616_0002266 Ga0495616_0002266_656_1021 121
191 3300046513 Ga0495616_0025480 Ga0495616_0025480_953_1318 121
192 3300046513 Ga0495616_0055585 Ga0495616_0055585_1070_1435 121
193 3300046513 Ga0495616_0194871 Ga0495616_0194871_203_568 121
194 3300046513 Ga0495616_0205547 Ga0495616_0205547_354_719 121
195 3300046514 Ga0495618_0012438 Ga0495618_0012438_3347_3712 121
196 3300046516 Ga0495628_0000269 Ga0495628_0000269_20337_20702 121
197 3300046518 Ga0495631_0001062 Ga0495631_0001062_2992_3357 121
198 3300046518 Ga0495631_0010034 Ga0495631_0010034_2620_2985 121
199 3300046518 Ga0495631_0417170 Ga0495631_0417170_92_457 121
200 3300046518 Ga0495631_0468933 Ga0495631_0468933_129_494 121
201 3300046519 Ga0495632_0067327 Ga0495632_0067327_93_458 121
202 3300046520 Ga0495637_0019371 Ga0495637_0019371_1354_1719 121
203 3300046520 Ga0495637_0179214 Ga0495637_0179214_364_759 121
204 3300046522 Ga0495643_0000552 Ga0495643_0000552_24401_24766 121
205 3300046522 Ga0495643_0040693 Ga0495643_0040693_1037_1402 121
206 3300046522 Ga0495643_0057648 Ga0495643_0057648_1511_1876 121
207 3300046522 Ga0495643_0273214 Ga0495643_0273214_328_693 121
208 3300046523 Ga0495644_0003575 Ga0495644_0003575_2210_2575 121
209 3300046523 Ga0495644_0057026 Ga0495644_0057026_846_1211 121
210 3300046524 Ga0495648_0002936 Ga0495648_0002936_11891_12256 121
211 3300046524 Ga0495648_0003845 Ga0495648_0003845_12037_12402 121
212 3300046524 Ga0495648_0016296 Ga0495648_0016296_3574_3939 121
213 3300046524 Ga0495648_0043005 Ga0495648_0043005_708_1073 121
214 3300046526 Ga0495666_0000706 Ga0495666_0000706_14735_15100 121
215 3300046528 Ga0495642_0001020 Ga0495642_0001020_10553_10918 121
216 3300046528 Ga0495642_0037846 Ga0495642_0037846_236_637 121
217 3300046529 Ga0495652_0036690 Ga0495652_0036690_2129_2494 121
218 3300046530 Ga0495654_0003954 Ga0495654_0003954_165_530 121
219 3300046530 Ga0495654_0111724 Ga0495654_0111724_205_570 121
220 3300046533 Ga0495640_0022410 Ga0495640_0022410_943_1308 121
221 3300046535 Ga0495586_0000401 Ga0495586_0000401_19746_20111 121
222 3300046536 Ga0495587_0114225 Ga0495587_0114225_435_800 121
223 3300046536 Ga0495587_0337020 Ga0495587_0337020_249_698 121
224 3300046538 Ga0495609_0000445 Ga0495609_0000445_11974_12339 121
225 3300046538 Ga0495609_0001680 Ga0495609_0001680_10028_10423 121
226 3300046538 Ga0495609_0034541 Ga0495609_0034541_826_1191 121
227 3300046538 Ga0495609_0042800 Ga0495609_0042800_460_825 121
228 3300046538 Ga0495609_0103023 Ga0495609_0103023_235_600 121
229 3300046538 Ga0495609_0205191 Ga0495609_0205191_235_600 121
230 3300046542 Ga0495597_0001302 Ga0495597_0001302_692_1057 121
231 3300046542 Ga0495597_0010381 Ga0495597_0010381_1293_1658 121
232 3300046542 Ga0495597_0405403 Ga0495597_0405403_59_424 121
233 3300046543 Ga0495645_0193258 Ga0495645_0193258_682_1047 121
234 3300046558 Ga0495633_0141852 Ga0495633_0141852_297_662 121
235 3300046558 Ga0495633_0151860 Ga0495633_0151860_235_600 121
236 3300046615 Ga0495656_0071840 Ga0495656_0071840_517_882 121
237 3300046615 Ga0495656_0164495 Ga0495656_0164495_546_911 121
238 3300046615 Ga0495656_0223828 Ga0495656_0223828_12_377 121
239 3300046615 Ga0495656_0385035 Ga0495656_0385035_28_393 121
240 3300046615 Ga0495656_0679327 Ga0495656_0679327_63_428 121
241 3300046616 Ga0495668_0003268 Ga0495668_0003268_1252_1617 121
242 3300046616 Ga0495668_0004225 Ga0495668_0004225_6732_7097 121
243 3300046616 Ga0495668_0010168 Ga0495668_0010168_5269_5634 121
244 3300046648 Ga0495611_0066083 Ga0495611_0066083_257_622 121
245 3300046660 Ga0495625_0009439 Ga0495625_0009439_7409_7774 121
246 3300046660 Ga0495625_0021655 Ga0495625_0021655_3610_3975 121
247 3300046660 Ga0495625_0708953 Ga0495625_0708953_121_486 121
248 3300046664 Ga0495659_0010448 Ga0495659_0010448_542_907 121
249 3300046665 Ga0495661_0001097 Ga0495661_0001097_1684_2049 121
250 3300046665 Ga0495661_0005999 Ga0495661_0005999_3911_4276 121
251 3300046665 Ga0495661_0008637 Ga0495661_0008637_4741_5106 121
252 3300046665 Ga0495661_0011442 Ga0495661_0011442_3314_3679 121
253 3300046665 Ga0495661_0047411 Ga0495661_0047411_1055_1420 121
254 3300046665 Ga0495661_0106095 Ga0495661_0106095_72_437 121
255 3300046674 Ga0495588_0000052 Ga0495588_0000052_11392_11757 121
256 3300046678 Ga0495599_0002580 Ga0495599_0002580_8594_8959 121
257 3300046684 Ga0495669_0013873 Ga0495669_0013873_1217_1582 121
258 3300046690 Ga0495624_0046256 Ga0495624_0046256_1288_1653 121
259 3300046691 Ga0495670_0063640 Ga0495670_0063640_39_407 121
260 3300046692 Ga0495671_0001415 Ga0495671_0001415_1815_2180 121
261 3300046692 Ga0495671_0205928 Ga0495671_0205928_235_600 121
262 3300046692 Ga0495671_0329868 Ga0495671_0329868_354_719 121
263 3300046694 Ga0495649_0446661 Ga0495649_0446661_125_490 121
264 3300046694 Ga0495649_0594023 Ga0495649_0594023_94_489 121
265 3300046794 Ga0495589_0000058 Ga0495589_0000058_77577_77942 121
266 3300046794 Ga0495589_0000501 Ga0495589_0000501_16692_17057 121
267 3300046794 Ga0495589_0001047 Ga0495589_0001047_11971_12336 121
268 3300046794 Ga0495589_0026341 Ga0495589_0026341_1348_1713 121
269 3300046810 Ga0495660_0000050 Ga0495660_0000050_96003_96368 121
270 3300046810 Ga0495660_0008687 Ga0495660_0008687_1455_1820 121
271 3300046810 Ga0495660_0025436 Ga0495660_0025436_2103_2468 121
272 3300046810 Ga0495660_0130587 Ga0495660_0130587_603_968 121
273 3300047318 Ga0495636_0002131 Ga0495636_0002131_3613_3978 121
274 3300047318 Ga0495636_0002363 Ga0495636_0002363_393_758 121
275 3300047318 Ga0495636_0160938 Ga0495636_0160938_260_625 121
276 3300047319 Ga0495674_0050216 Ga0495674_0050216_859_1224 121
277 3300047320 Ga0495672_0000222 Ga0495672_0000222_39665_40030 121
278 3300047320 Ga0495672_0000765 Ga0495672_0000765_14796_15191 121
279 3300047320 Ga0495672_0080736 Ga0495672_0080736_1380_1745 121
280 3300047320 Ga0495672_0170981 Ga0495672_0170981_390_755 121
281 3300047320 Ga0495672_0222724 Ga0495672_0222724_354_719 121
282 3300047321 Ga0495676_0257136 Ga0495676_0257136_718_1113 121
283 3300047323 Ga0495683_0015974 Ga0495683_0015974_785_1150 121
284 3300047323 Ga0495683_0044394 Ga0495683_0044394_665_1060 121
285 3300047323 Ga0495683_0051699 Ga0495683_0051699_1110_1475 121
286 3300047443 Ga0495687_000003 Ga0495687_000003_415750_416115 121
287 3300047443 Ga0495687_000073 Ga0495687_000073_144674_145039 121
288 3300047443 Ga0495687_000487 Ga0495687_000487_46477_46842 121
289 3300047443 Ga0495687_000489 Ga0495687_000489_11754_12119 121
290 3300047443 Ga0495687_019504 Ga0495687_019504_2838_3203 121
291 3300047443 Ga0495687_021095 Ga0495687_021095_1861_2226 121
292 3300047445 Ga0495677_0000144 Ga0495677_0000144_21788_22153 121
293 3300047445 Ga0495677_0027805 Ga0495677_0027805_1204_1569 121
294 3300047446 Ga0495679_011141 Ga0495679_011141_501_866 121
295 3300047446 Ga0495679_012264 Ga0495679_012264_73_441 121
296 3300047447 Ga0495685_000132 Ga0495685_000132_12973_13338 121
297 3300047469 Ga0495673_0011436 Ga0495673_0011436_668_1033 121
298 3300047470 Ga0495681_0188468 Ga0495681_0188468_214_579 121
299 3300047472 Ga0495686_0038570 Ga0495686_0038570_2474_2839 121
300 3300047472 Ga0495686_0355809 Ga0495686_0355809_404_769 121
301 3300048088 Ga0495602_0000903 Ga0495602_0000903_19999_20391 121
302 3300048090 Ga0495615_0040957 Ga0495615_0040957_549_914 121
303 3300048091 Ga0495626_0000102 Ga0495626_0000102_24266_24661 121
304 3300048091 Ga0495626_0000145 Ga0495626_0000145_77577_77942 121
305 3300048091 Ga0495626_0009485 Ga0495626_0009485_2557_2922 121
306 3300048091 Ga0495626_0016842 Ga0495626_0016842_251_616 121
307 3300048091 Ga0495626_0021269 Ga0495626_0021269_885_1250 121
308 3300048091 Ga0495626_0129019 Ga0495626_0129019_625_1020 121
309 3300048904 Ga0496101_0253716 Ga0496101_0253716_164_529 121
310 3300048905 Ga0496102_0199416 Ga0496102_0199416_939_1304 121
311 3300048905 Ga0496102_0362350 Ga0496102_0362350_232_597 121
312 3300048905 Ga0496102_0535057 Ga0496102_0535057_166_531 121
313 3300048906 Ga0496103_0030385 Ga0496103_0030385_2745_3110 121
314 3300048906 Ga0496103_0191926 Ga0496103_0191926_320_685 121
315 3300048906 Ga0496103_0310785 Ga0496103_0310785_29_394 121
316 3300048907 Ga0496104_0166531 Ga0496104_0166531_412_777 121
317 3300048907 Ga0496104_0189677 Ga0496104_0189677_589_954 121
318 3300048908 Ga0496105_0014567 Ga0496105_0014567_3720_4085 121
319 3300048909 Ga0496106_0034658 Ga0496106_0034658_447_812 121
320 3300048909 Ga0496106_1508015 Ga0496106_1508015_101_466 121
321 3300048910 Ga0496107_0277146 Ga0496107_0277146_820_1185 121
322 3300048910 Ga0496107_1307734 Ga0496107_1307734_143_508 121
323 3300048911 Ga0496108_0641279 Ga0496108_0641279_69_434 121
324 3300048912 Ga0496109_0243166 Ga0496109_0243166_379_744 121
325 3300048913 Ga0496110_0000275 Ga0496110_0000275_12239_12604 121
326 3300048913 Ga0496110_0353914 Ga0496110_0353914_790_1155 121
327 3300048914 Ga0496111_0495171 Ga0496111_0495171_18_383 121
328 3300048914 Ga0496111_0736635 Ga0496111_0736635_117_482 121
329 3300048916 Ga0496113_0007646 Ga0496113_0007646_5710_6075 121
330 3300048916 Ga0496113_0200388 Ga0496113_0200388_1059_1424 121
331 3300048917 Ga0496114_0110961 Ga0496114_0110961_1962_2327 121
332 3300048917 Ga0496114_0453666 Ga0496114_0453666_603_968 121
333 3300048922 Ga0496119_0261934 Ga0496119_0261934_307_672 121
334 3300048923 Ga0496120_0022028 Ga0496120_0022028_1368_1733 121
335 3300048925 Ga0496122_0002401 Ga0496122_0002401_14586_14951 121
336 3300048925 Ga0496122_0034998 Ga0496122_0034998_1265_1630 121
337 3300048925 Ga0496122_0452766 Ga0496122_0452766_28_393 121
338 3300048926 Ga0496123_0006224 Ga0496123_0006224_8058_8423 121
339 3300048926 Ga0496123_0007046 Ga0496123_0007046_6860_7225 121
340 3300048926 Ga0496123_0010024 Ga0496123_0010024_6413_6778 121
341 3300048927 Ga0496124_0027304 Ga0496124_0027304_1940_2305 121
342 3300048927 Ga0496124_0040451 Ga0496124_0040451_1307_1672 121
343 3300048927 Ga0496124_0047431 Ga0496124_0047431_2320_2685 121
344 3300048928 Ga0496125_0020660 Ga0496125_0020660_2259_2624 121
345 3300048928 Ga0496125_0255218 Ga0496125_0255218_110_475 121
346 3300048929 Ga0496126_0746545 Ga0496126_0746545_272_637 121
347 3300049459 Ga0495678_001414 Ga0495678_001414_18001_18366 121
348 3300049459 Ga0495678_001721 Ga0495678_001721_14845_15210 121
349 3300049459 Ga0495678_007066 Ga0495678_007066_2188_2553 121
350 3300049459 Ga0495678_104631 Ga0495678_104631_263_628 121
351 3300049460 Ga0495682_0000763 Ga0495682_0000763_11277_11642 121
352 3300049460 Ga0495682_0004796 Ga0495682_0004796_230_595 121
353 3300049571 Ga0501034_0277181 Ga0501034_0277181_805_1170 121
354 3300049581 Ga0501047_0305562 Ga0501047_0305562_587_952 121
355 3300049686 Ga0501257_025624 Ga0501257_025624_502_867 121
356 3300049758 Ga0501241_041355 Ga0501241_041355_120_485 121
357 3300049822 Ga0501035_0000552 Ga0501035_0000552_33913_34278 121
358 3300049823 Ga0501044_0107080 Ga0501044_0107080_63_428 121
359 3300050509 nmdc:mga0qj67_556892_c1 nmdc:mga0qj67_556892_c1_458_823 121
360 3300050515 nmdc:mga0a205_58014_c1 nmdc:mga0a205_58014_c1_296_775 121
361 3300053153 Ga0500616_0000869 Ga0500616_0000869_9264_9629 121
362 3300054114 Ga0501084_0036190 Ga0501084_0036190_1149_1514 121
363 3300061719 Ga0466962_0368564 Ga0466962_0368564_234_599 121
364 3300061734 Ga0530510_0026955 Ga0530510_0026955_1363_1728 121

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

32

137

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2rbb-assembly1.cif.gz_B crystal structure of a glyoxalase/bleomycin resistance protein/dioxygenase family enzyme from burkholderia phytofirmans psjn 0.8413 7 111
2p7m-assembly4.cif.gz_E-3 crystal structure of monoclinic form of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes at ph 6.5 0.8232 1 114
2p7p-assembly2.cif.gz_D crystal structure of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes complexed with mn(ii) and sulfate ion 0.8227 1 114
2p7k-assembly1.cif.gz_B crystal structure of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes (hexagonal form) 0.8195 1 114
5umq-assembly1.cif.gz_A crystal structure of tnms1, an antibiotic binding protein from streptomyces sp. cb03234 0.8189 1 110
ID Description Score Start End Superfamily
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8927 59 111 3.30.720.110
af_C6T374_10_137_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8561 7 113 3.10.180.10
2rbbB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.829 7 111 3.10.180.10
2p7kA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8195 1 114 3.10.180.10
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8082 54 111 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A6F8YEF0-F1-model_v4 VOC domain-containing protein 0.9727 58 112
AF-A0A7X2LVY5-F1-model_v4 VOC family protein 0.9699 1 121
AF-A0A6L6PX40-F1-model_v4 VOC family protein 0.9698 1 121
AF-A0A1H4FS12-F1-model_v4 VOC domain-containing protein 0.9654 1 121
AF-A0A7Y2CVR7-F1-model_v4 VOC family protein 0.9587 2 113

Feature Viewer

pLDDT pTM Quality
95.24 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map