F423420

General Info

Members Datasets Scaffolds Average Seq Length
364 228 728 119

Family's Representative Sequence

Representative Sequence 3300044842|Ga0466957_0423035|Ga0466957_0423035_98_538
Length 146
Sequence MSQEISTGCRPAIRVRTGIVGGHLYGVVMAIARFPTVVLDCPDPEALAKFYGTLLDWKVEVSPEWAEVRADYGDSIGFQQVQDYTAPRWPGQEVPQQMHIDVVVDDLDAAETAVLELGATKHEHQPGTTFRVFLDPAGHPFCLCVS

Samples

Sample ID Description Type Environment
1 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
80 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
81 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
82 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
83 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
84 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
85 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
86 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
87 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
88 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
89 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
90 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
91 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
92 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
93 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
94 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
95 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
96 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
97 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
98 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
99 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
100 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
101 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
102 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
103 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
104 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
105 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
106 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
107 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
108 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
109 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
110 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
111 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
112 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
113 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
114 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
116 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
117 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
118 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
119 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
120 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
121 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
122 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
123 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
124 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
125 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
126 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
127 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
128 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
129 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
130 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
131 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
132 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
133 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
134 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
135 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
136 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
137 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
138 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
139 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
140 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
141 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
142 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
143 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
144 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
145 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
146 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
147 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
148 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
149 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
150 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
151 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
152 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
153 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
154 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
155 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
156 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
157 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
158 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
159 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
160 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
161 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
162 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
163 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
164 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
165 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
166 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
167 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
168 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
169 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
170 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
171 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
172 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
173 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
174 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
175 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
176 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
177 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
178 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
179 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
193 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
194 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
195 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
196 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
197 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
198 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
199 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
200 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
201 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
202 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
203 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
204 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
205 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
206 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
209 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
210 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
211 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
212 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
213 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
214 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
215 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
218 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
219 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
220 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
221 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
222 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
223 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
224 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
225 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
226 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
227 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
228 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.15
Metatranscriptomes 1.37
Isolates 2.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.2
Nodule 0
Rhizoplane 12.64
Rhizosphere 81.59
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466957_0423035 3300044842 Bacteria 914
2 JGI24741J21665_1075978 3300001915 Bacteria 501
3 JGI24740J21852_10098918 3300001979 Bacteria 744
4 JGI24737J22298_10228211 3300001990 Bacteria 550
5 JGI24738J21930_10090026 3300002075 Bacteria 648
6 JGI25404J52841_10010391 3300003659 Bacteria 2002
7 Ga0070658_10879032 3300005327 Bacteria 779
8 Ga0070683_100158046 3300005329 Bacteria 2150
9 Ga0070683_100426600 3300005329 Bacteria 1265
10 Ga0070683_100690919 3300005329 Bacteria 977
11 Ga0070680_101724483 3300005336 Bacteria 543
12 Ga0070682_100650769 3300005337 Bacteria 839
13 Ga0070661_100628336 3300005344 Bacteria 870
14 Ga0070661_100739574 3300005344 Bacteria 804
15 Ga0070675_100035441 3300005354 Bacteria 4055
16 Ga0070667_100166369 3300005367 Bacteria 1945
17 Ga0070709_10003324 3300005434 Bacteria 8653
18 Ga0070709_10059050 3300005434 Bacteria 2434
19 Ga0070714_100019535 3300005435 Bacteria 5522
20 Ga0070714_100022211 3300005435 Bacteria 5201
21 Ga0070714_100028143 3300005435 Bacteria 4660
22 Ga0070714_100293023 3300005435 Bacteria 1515
23 Ga0070714_100973639 3300005435 Bacteria 825
24 Ga0070714_101083600 3300005435 Bacteria 780
25 Ga0070713_100100357 3300005436 Bacteria 2505
26 Ga0070713_100215369 3300005436 Bacteria 1740
27 Ga0070713_100342389 3300005436 Bacteria 1386
28 Ga0070713_100828880 3300005436 Bacteria 887
29 Ga0070713_101140447 3300005436 Bacteria 754
30 Ga0070710_10048905 3300005437 Bacteria 2363
31 Ga0070710_10419283 3300005437 Bacteria 901
32 Ga0070710_10884347 3300005437 Bacteria 644
33 Ga0070701_10162826 3300005438 Bacteria 1294
34 Ga0070711_100209190 3300005439 Bacteria 1510
35 Ga0070711_100832972 3300005439 Bacteria 784
36 Ga0070711_100842719 3300005439 Bacteria 780
37 Ga0070706_100089001 3300005467 Bacteria 2863
38 Ga0070706_101149915 3300005467 Bacteria 714
39 Ga0070707_100038248 3300005468 Bacteria 4582
40 Ga0070698_100016295 3300005471 Bacteria 7846
41 Ga0070699_100246090 3300005518 Bacteria 1597
42 Ga0070679_100282682 3300005530 Bacteria 1611
43 Ga0070679_102187105 3300005530 Bacteria 503
44 Ga0070672_100205489 3300005543 Bacteria 1648
45 Ga0070693_100820296 3300005547 Bacteria 691
46 Ga0068855_100018457 3300005563 Bacteria 8382
47 Ga0068855_100461181 3300005563 Bacteria 1385
48 Ga0068855_101025658 3300005563 Bacteria 866
49 Ga0068855_101227626 3300005563 Bacteria 779
50 Ga0068856_100146844 3300005614 Bacteria 2366
51 Ga0068856_100255171 3300005614 Bacteria 1768
52 Ga0068852_101875108 3300005616 Bacteria 622
53 Ga0068858_100315278 3300005842 Bacteria 1494
54 Ga0081540_1000130 3300005983 Bacteria 80050
55 Ga0081540_1000487 3300005983 Bacteria 38975
56 Ga0081539_10009760 3300005985 Bacteria 7940
57 Ga0081539_10031680 3300005985 Bacteria 3254
58 Ga0070717_10090082 3300006028 Bacteria 2588
59 Ga0070717_10247516 3300006028 Bacteria 1574
60 Ga0070717_10898165 3300006028 Bacteria 806
61 Ga0075365_10170005 3300006038 Bacteria 1521
62 Ga0075364_10199211 3300006051 Bacteria 1357
63 Ga0070716_100076207 3300006173 Bacteria 1987
64 Ga0070712_100044100 3300006175 Bacteria 3073
65 Ga0070712_100296844 3300006175 Bacteria 1306
66 Ga0070712_100609102 3300006175 Bacteria 925
67 Ga0075362_10141920 3300006177 Bacteria 1148
68 Ga0075428_101802700 3300006844 Bacteria 637
69 Ga0075434_100975500 3300006871 Bacteria 862
70 Ga0105240_10247339 3300009093 Bacteria 2064
71 Ga0105247_10775423 3300009101 Bacteria 729
72 Ga0105241_10506291 3300009174 Bacteria 1077
73 Ga0105241_10527859 3300009174 Bacteria 1056
74 Ga0105237_10072864 3300009545 Bacteria 3428
75 Ga0105237_11000324 3300009545 Bacteria 843
76 Ga0105238_12599596 3300009551 Bacteria 542
77 Ga0105239_10512816 3300010375 Bacteria 1364
78 Ga0105239_11276763 3300010375 Bacteria 847
79 Ga0105246_10017003 3300011119 Bacteria 4618
80 Ga0157373_11048710 3300013100 Bacteria 610
81 Ga0157369_10193459 3300013105 Bacteria 2136
82 Ga0157369_10296308 3300013105 Bacteria 1683
83 Ga0157374_11743758 3300013296 Bacteria 648
84 Ga0157378_12044506 3300013297 Bacteria 623
85 Ga0157372_10442452 3300013307 Bacteria 1515
86 Ga0157372_10831625 3300013307 Bacteria 1072
87 Ga0157372_12301201 3300013307 Bacteria 619
88 Ga0157375_12478197 3300013308 Bacteria 619
89 Ga0197907_10771307 3300020069 Bacteria 701
90 Ga0206353_11573525 3300020082 Bacteria 813
91 Ga0206353_12008300 3300020082 Bacteria 621
92 Ga0209148_1002190 3300025254 Bacteria 7216
93 Ga0209051_1002838 3300025303 Bacteria 11940
94 Ga0207692_10008700 3300025898 Bacteria 4213
95 Ga0207692_10116013 3300025898 Bacteria 1492
96 Ga0207692_10244085 3300025898 Bacteria 1074
97 Ga0207692_10658802 3300025898 Bacteria 677
98 Ga0207692_10813259 3300025898 Bacteria 611
99 Ga0207692_10827412 3300025898 Bacteria 606
100 Ga0207647_10288696 3300025904 Bacteria 935
101 Ga0207647_10465695 3300025904 Bacteria 707
102 Ga0207699_10006314 3300025906 Bacteria 5727
103 Ga0207699_10199737 3300025906 Bacteria 1354
104 Ga0207699_10625941 3300025906 Bacteria 785
105 Ga0207684_11155778 3300025910 Bacteria 642
106 Ga0207695_10278727 3300025913 Bacteria 1566
107 Ga0207671_10060172 3300025914 Bacteria 2817
108 Ga0207671_10152477 3300025914 Bacteria 1786
109 Ga0207693_10058156 3300025915 Bacteria 3029
110 Ga0207693_10121710 3300025915 Bacteria 2049
111 Ga0207693_10194199 3300025915 Bacteria 1597
112 Ga0207693_10266407 3300025915 Bacteria 1343
113 Ga0207693_10607426 3300025915 Bacteria 851
114 Ga0207693_10667141 3300025915 Bacteria 807
115 Ga0207693_10854195 3300025915 Bacteria 700
116 Ga0207663_10083146 3300025916 Bacteria 2102
117 Ga0207663_10085379 3300025916 Bacteria 2078
118 Ga0207663_10124614 3300025916 Bacteria 1770
119 Ga0207663_10965118 3300025916 Bacteria 683
120 Ga0207663_11151552 3300025916 Bacteria 624
121 Ga0207660_10127099 3300025917 Bacteria 1937
122 Ga0207649_10214477 3300025920 Bacteria 1367
123 Ga0207652_10129037 3300025921 Bacteria 2254
124 Ga0207652_10187151 3300025921 Bacteria 1862
125 Ga0207646_10077086 3300025922 Bacteria 2979
126 Ga0207650_11863322 3300025925 Bacteria 508
127 Ga0207700_10018633 3300025928 Bacteria 4671
128 Ga0207700_10032154 3300025928 Bacteria 3739
129 Ga0207700_10236698 3300025928 Bacteria 1555
130 Ga0207700_10271313 3300025928 Bacteria 1456
131 Ga0207664_10003662 3300025929 Bacteria 10294
132 Ga0207664_10032252 3300025929 Bacteria 4013
133 Ga0207664_10229173 3300025929 Bacteria 1614
134 Ga0207664_10262492 3300025929 Bacteria 1511
135 Ga0207664_10439631 3300025929 Bacteria 1163
136 Ga0207664_10572835 3300025929 Bacteria 1013
137 Ga0207664_10693731 3300025929 Bacteria 915
138 Ga0207665_10034058 3300025939 Bacteria 3379
139 Ga0207665_11445511 3300025939 Bacteria 547
140 Ga0207661_10207071 3300025944 Bacteria 1727
141 Ga0207661_10419633 3300025944 Bacteria 1215
142 Ga0207661_11075926 3300025944 Bacteria 741
143 Ga0207667_10030392 3300025949 Bacteria 5845
144 Ga0207667_10067580 3300025949 Bacteria 3723
145 Ga0207639_10244264 3300026041 Bacteria 1563
146 Ga0207639_11302069 3300026041 Bacteria 682
147 Ga0207702_10230500 3300026078 Bacteria 1731
148 Ga0207702_11448199 3300026078 Bacteria 680
149 Ga0207698_11137459 3300026142 Bacteria 794
150 Ga0207698_12374960 3300026142 Bacteria 541
151 Ga0265337_1004813 3300028556 Bacteria 5520
152 Ga0265326_10008505 3300028558 Bacteria 3094
153 Ga0265319_1001319 3300028563 Bacteria 15002
154 Ga0265334_10005738 3300028573 Bacteria 5409
155 Ga0265318_10008863 3300028577 Bacteria 4458
156 Ga0265323_10003550 3300028653 Bacteria 6864
157 Ga0265322_10010451 3300028654 Bacteria 2691
158 Ga0265336_10003051 3300028666 Bacteria 6670
159 Ga0265338_10002773 3300028800 Bacteria 25645
160 Ga0265324_10003609 3300029957 Bacteria 7281
161 Ga0307512_10227584 3300030522 Bacteria 964
162 Ga0265332_10003761 3300031238 Bacteria 7257
163 Ga0265320_10008970 3300031240 Bacteria 6071
164 Ga0265325_10007512 3300031241 Bacteria 6517
165 Ga0265340_10031788 3300031247 Bacteria 2637
166 Ga0265339_10098765 3300031249 Bacteria 1522
167 Ga0265316_10025190 3300031344 Bacteria 4968
168 Ga0265313_10011296 3300031595 Bacteria 5562
169 Ga0265314_10010264 3300031711 Bacteria 7831
170 Ga0265342_10004359 3300031712 Bacteria 11193
171 Ga0307413_10460251 3300031824 Bacteria 1012
172 Ga0307413_10839790 3300031824 Bacteria 775
173 Ga0307413_10920097 3300031824 Bacteria 744
174 Ga0307410_10260392 3300031852 Bacteria 1352
175 Ga0307410_11066302 3300031852 Bacteria 699
176 Ga0307407_10223128 3300031903 Bacteria 1275
177 Ga0307412_10077554 3300031911 Bacteria 2286
178 Ga0307412_10147498 3300031911 Bacteria 1731
179 Ga0307412_10252750 3300031911 Bacteria 1369
180 Ga0307416_100092062 3300032002 Bacteria 2606
181 Ga0307416_100131361 3300032002 Bacteria 2255
182 Ga0307416_101559170 3300032002 Bacteria 766
183 Ga0307411_10059593 3300032005 Bacteria 2531
184 Ga0373926_0256039 3300035083 Bacteria 679
185 Ga0373936_0081835 3300035113 Bacteria 1345
186 Ga0373954_0642094 3300035118 Bacteria 526
187 Ga0373956_0003862 3300035119 Bacteria 6025
188 Ga0373957_0412736 3300035120 Bacteria 582
189 Ga0373957_0522672 3300035120 Bacteria 518
190 Ga0373946_0529997 3300035171 Bacteria 606
191 Ga0373924_0014578 3300035410 Bacteria 2974
192 Ga0373935_0177918 3300035692 Bacteria 1459
193 Ga0373935_1088943 3300035692 Bacteria 594
194 Ga0373933_0223822 3300035724 Bacteria 1207
195 Ga0373937_0108789 3300036401 Bacteria 2577
196 Ga0395899_0002335 3300037312 Bacteria 15441
197 Ga0395900_0028487 3300037418 Bacteria 5722
198 Ga0395900_0180575 3300037418 Bacteria 2145
199 Ga0395898_0036630 3300037466 Bacteria 4871
200 Ga0395905_0155514 3300037471 Bacteria 2151
201 Ga0395905_0509677 3300037471 Bacteria 1103
202 Ga0436364_0361413 3300037853 Bacteria 4268
203 Ga0436364_0428712 3300037853 Bacteria 830
204 Ga0395901_0131343 3300038443 Bacteria 2631
205 Ga0395901_0690851 3300038443 Bacteria 1019
206 Ga0436365_1739552 3300039437 Bacteria 873
207 Ga0436360_0779555 3300039438 Bacteria 725
208 Ga0436363_0143690 3300039450 Bacteria 793
209 Ga0436362_0009758 3300039453 Bacteria 1099
210 Ga0439466_0159516 3300041411 Bacteria 690
211 Ga0451791_0694949 3300041451 Bacteria 665
212 Ga0451797_1143158 3300041453 Bacteria 548
213 Ga0451798_0507228 3300041458 Bacteria 656
214 Ga0451802_0740993 3300041460 Bacteria 539
215 Ga0451802_1539664 3300041460 Bacteria 605
216 Ga0451843_0250386 3300041509 Bacteria 622
217 Ga0451855_1402944 3300041511 Bacteria 544
218 Ga0451853_3912467 3300041512 Bacteria 715
219 Ga0439442_017589 3300042002 Bacteria 1476
220 Ga0439434_0003256 3300042435 Bacteria 4767
221 Ga0466969_0290641 3300044656 Bacteria 740
222 Ga0466972_0240524 3300044658 Bacteria 847
223 Ga0466965_0013434 3300044683 Bacteria 3864
224 Ga0466965_0505935 3300044683 Bacteria 678
225 Ga0466965_0708289 3300044683 Bacteria 578
226 Ga0466966_0278295 3300044684 Bacteria 1007
227 Ga0466961_0633461 3300044693 Bacteria 642
228 Ga0466963_0114325 3300044694 Bacteria 1854
229 Ga0466963_0127946 3300044694 Bacteria 1752
230 Ga0466963_0165635 3300044694 Bacteria 1540
231 Ga0466963_0968200 3300044694 Bacteria 599
232 Ga0466963_1137936 3300044694 Bacteria 549
233 Ga0466970_0166535 3300044765 Bacteria 1220
234 Ga0466970_0170242 3300044765 Bacteria 1207
235 Ga0466970_0478107 3300044765 Bacteria 716
236 Ga0466970_0965065 3300044765 Bacteria 502
237 Ga0466957_0738583 3300044842 Bacteria 696
238 Ga0466960_0055709 3300044901 Bacteria 1923
239 Ga0466960_0140505 3300044901 Bacteria 1282
240 Ga0466960_0816698 3300044901 Bacteria 565
241 Ga0466959_0075710 3300045049 Bacteria 2431
242 Ga0466958_0037841 3300045836 Bacteria 2892
243 Ga0466958_0332052 3300045836 Bacteria 978
244 Ga0466958_0356450 3300045836 Bacteria 942
245 Ga0466967_0103861 3300045976 Bacteria 2600
246 Ga0466967_0263336 3300045976 Bacteria 1650
247 Ga0466967_0542905 3300045976 Bacteria 1144
248 Ga0466967_0713675 3300045976 Bacteria 993
249 Ga0495651_0100796 3300046462 Bacteria 2150
250 Ga0495653_0024545 3300046463 Bacteria 4856
251 Ga0495662_0039960 3300046476 Bacteria 2266
252 Ga0495664_0176094 3300046477 Bacteria 1297
253 Ga0495596_0221890 3300046500 Bacteria 734
254 Ga0495618_0102968 3300046514 Bacteria 1827
255 Ga0495628_0247902 3300046516 Bacteria 1330
256 Ga0495630_0208613 3300046517 Bacteria 1491
257 Ga0495667_0056807 3300046559 Bacteria 2573
258 Ga0495634_0161889 3300046642 Bacteria 1410
259 Ga0495635_0046948 3300046663 Bacteria 2979
260 Ga0495599_0044253 3300046678 Bacteria 2792
261 Ga0495646_0177293 3300046680 Bacteria 1171
262 Ga0495624_0108111 3300046690 Bacteria 1711
263 Ga0495600_0032291 3300046809 Bacteria 3396
264 Ga0495604_0509724 3300047317 Bacteria 779
265 Ga0495684_0015890 3300047471 Bacteria 5796
266 Ga0496100_0028790 3300048903 Bacteria 3430
267 Ga0496100_0470454 3300048903 Bacteria 966
268 Ga0496100_0470505 3300048903 Bacteria 966
269 Ga0496100_0745952 3300048903 Bacteria 765
270 Ga0496100_0750477 3300048903 Bacteria 763
271 Ga0496101_0244471 3300048904 Bacteria 1397
272 Ga0496102_0494792 3300048905 Bacteria 1144
273 Ga0496103_0277829 3300048906 Bacteria 1077
274 Ga0496104_0626440 3300048907 Bacteria 985
275 Ga0496104_1556949 3300048907 Bacteria 564
276 Ga0496105_0388347 3300048908 Bacteria 1110
277 Ga0496105_0404325 3300048908 Bacteria 1083
278 Ga0496105_1275572 3300048908 Bacteria 537
279 Ga0496107_0356688 3300048910 Bacteria 1088
280 Ga0496108_0048014 3300048911 Bacteria 3569
281 Ga0496108_0183928 3300048911 Bacteria 1810
282 Ga0496108_0962298 3300048911 Bacteria 730
283 Ga0496109_0030230 3300048912 Bacteria 4856
284 Ga0496109_0079013 3300048912 Bacteria 3030
285 Ga0496109_0169558 3300048912 Bacteria 2047
286 Ga0496109_0276558 3300048912 Bacteria 1582
287 Ga0496109_0520427 3300048912 Bacteria 1123
288 Ga0496110_0179970 3300048913 Bacteria 1920
289 Ga0496110_0496592 3300048913 Bacteria 1111
290 Ga0496111_0659467 3300048914 Bacteria 763
291 Ga0496112_0142803 3300048915 Bacteria 2363
292 Ga0496112_0190023 3300048915 Bacteria 2016
293 Ga0496112_0267868 3300048915 Bacteria 1657
294 Ga0496112_1611654 3300048915 Bacteria 562
295 Ga0496113_0038789 3300048916 Bacteria 3503
296 Ga0496113_0050232 3300048916 Bacteria 3109
297 Ga0496113_0133582 3300048916 Bacteria 1949
298 Ga0496113_0462907 3300048916 Bacteria 1019
299 Ga0496113_0756764 3300048916 Bacteria 773
300 Ga0496114_0017909 3300048917 Bacteria 5725
301 Ga0496114_0174831 3300048917 Bacteria 1873
302 Ga0496114_0911810 3300048917 Bacteria 760
303 Ga0496114_0989108 3300048917 Bacteria 724
304 Ga0496115_0228894 3300048918 Bacteria 1533
305 Ga0496115_0247324 3300048918 Bacteria 1469
306 Ga0496115_0336788 3300048918 Bacteria 1232
307 Ga0496126_0021364 3300048929 Bacteria 6321
308 Ga0496126_0173850 3300048929 Bacteria 1833
309 Ga0501031_0003686 3300049568 Bacteria 9853
310 Ga0501033_0103142 3300049570 Bacteria 2080
311 Ga0501033_0762422 3300049570 Bacteria 656
312 Ga0501036_0036729 3300049572 Bacteria 4146
313 Ga0501037_0015243 3300049573 Bacteria 5655
314 Ga0501038_0747696 3300049574 Bacteria 729
315 Ga0501039_0142378 3300049575 Bacteria 1883
316 Ga0501039_0180580 3300049575 Bacteria 1660
317 Ga0501039_0935553 3300049575 Bacteria 674
318 Ga0501040_0037325 3300049576 Bacteria 3300
319 Ga0501041_0006357 3300049577 Bacteria 6913
320 Ga0501041_0534545 3300049577 Bacteria 747
321 Ga0501042_0008662 3300049578 Bacteria 6740
322 Ga0501042_0343086 3300049578 Bacteria 1080
323 Ga0501043_0096599 3300049579 Bacteria 2322
324 Ga0501046_0172598 3300049580 Bacteria 1621
325 Ga0501047_0042143 3300049581 Bacteria 4412
326 Ga0501048_0016896 3300049582 Bacteria 5379
327 Ga0501068_0062918 3300049584 Bacteria 2257
328 Ga0501069_0731959 3300049585 Bacteria 597
329 Ga0501070_0023535 3300049586 Bacteria 5160
330 Ga0501071_0756888 3300049587 Bacteria 748
331 Ga0501071_1003958 3300049587 Bacteria 645
332 Ga0501072_0047576 3300049588 Bacteria 3377
333 Ga0501073_0313644 3300049589 Bacteria 1082
334 Ga0501074_0033710 3300049590 Bacteria 3711
335 Ga0501075_0003711 3300049591 Bacteria 10257
336 Ga0501076_0015817 3300049592 Bacteria 5708
337 Ga0501077_0012160 3300049593 Bacteria 5387
338 Ga0501079_0060575 3300049741 Bacteria 2919
339 Ga0501080_0053251 3300049742 Bacteria 3767
340 Ga0501081_0035217 3300049743 Bacteria 3407
341 Ga0501279_092069 3300049775 Bacteria 536
342 Ga0501035_0179168 3300049822 Bacteria 1827
343 Ga0501044_0157242 3300049823 Bacteria 2252
344 Ga0501045_0017130 3300049824 Bacteria 5145
345 nmdc:mga03683_124755_c1 3300050489 Bacteria 1148
346 nmdc:mga03n38_18208_c1 3300050490 Bacteria 2768
347 nmdc:mga00v17_75549_c2 3300050491 Bacteria 1357
348 Ga0495601_0182821 3300053077 Bacteria 1370
349 Ga0495612_0052090 3300053078 Bacteria 1683
350 Ga0501084_0011272 3300054114 Bacteria 7399
351 Ga0587067_120525 3300059640 Bacteria 629
352 Ga0587072_029441 3300059643 Bacteria 1019
353 Ga0501082_0051789 3300060353 Bacteria 3538
354 Ga0466962_0344477 3300061719 Bacteria 742
355 Ga0530510_0004299 3300061734 Bacteria 9856
356 2819668081 2818991458 Bacteria 4794049
357 2857743175 2857740372 Bacteria 4782044
358 2904497167 2904497146 Bacteria 4731781
359 2904780384 2904776348 Bacteria 4658726
360 2910813881 2910809715 Bacteria 4982797
361 2919038367 2919034639 Bacteria 4763403
362 2919540100 2919538618 Bacteria 4677069
363 2932428943 2932426870 Bacteria 4547726
364 2933422653 2933418574 Bacteria 4476724
365 Ga0466957_0423035
366 JGI24741J21665_1075978
367 JGI24740J21852_10098918
368 JGI24737J22298_10228211
369 JGI24738J21930_10090026
370 JGI25404J52841_10010391
371 Ga0070658_10879032
372 Ga0070683_100158046
373 Ga0070683_100426600
374 Ga0070683_100690919
375 Ga0070680_101724483
376 Ga0070682_100650769
377 Ga0070661_100628336
378 Ga0070661_100739574
379 Ga0070675_100035441
380 Ga0070667_100166369
381 Ga0070709_10003324
382 Ga0070709_10059050
383 Ga0070714_100019535
384 Ga0070714_100022211
385 Ga0070714_100028143
386 Ga0070714_100293023
387 Ga0070714_100973639
388 Ga0070714_101083600
389 Ga0070713_100100357
390 Ga0070713_100215369
391 Ga0070713_100342389
392 Ga0070713_100828880
393 Ga0070713_101140447
394 Ga0070710_10048905
395 Ga0070710_10419283
396 Ga0070710_10884347
397 Ga0070701_10162826
398 Ga0070711_100209190
399 Ga0070711_100832972
400 Ga0070711_100842719
401 Ga0070706_100089001
402 Ga0070706_101149915
403 Ga0070707_100038248
404 Ga0070698_100016295
405 Ga0070699_100246090
406 Ga0070679_100282682
407 Ga0070679_102187105
408 Ga0070672_100205489
409 Ga0070693_100820296
410 Ga0068855_100018457
411 Ga0068855_100461181
412 Ga0068855_101025658
413 Ga0068855_101227626
414 Ga0068856_100146844
415 Ga0068856_100255171
416 Ga0068852_101875108
417 Ga0068858_100315278
418 Ga0081540_1000130
419 Ga0081540_1000487
420 Ga0081539_10009760
421 Ga0081539_10031680
422 Ga0070717_10090082
423 Ga0070717_10247516
424 Ga0070717_10898165
425 Ga0075365_10170005
426 Ga0075364_10199211
427 Ga0070716_100076207
428 Ga0070712_100044100
429 Ga0070712_100296844
430 Ga0070712_100609102
431 Ga0075362_10141920
432 Ga0075428_101802700
433 Ga0075434_100975500
434 Ga0105240_10247339
435 Ga0105247_10775423
436 Ga0105241_10506291
437 Ga0105241_10527859
438 Ga0105237_10072864
439 Ga0105237_11000324
440 Ga0105238_12599596
441 Ga0105239_10512816
442 Ga0105239_11276763
443 Ga0105246_10017003
444 Ga0157373_11048710
445 Ga0157369_10193459
446 Ga0157369_10296308
447 Ga0157374_11743758
448 Ga0157378_12044506
449 Ga0157372_10442452
450 Ga0157372_10831625
451 Ga0157372_12301201
452 Ga0157375_12478197
453 Ga0197907_10771307
454 Ga0206353_11573525
455 Ga0206353_12008300
456 Ga0209148_1002190
457 Ga0209051_1002838
458 Ga0207692_10008700
459 Ga0207692_10116013
460 Ga0207692_10244085
461 Ga0207692_10658802
462 Ga0207692_10813259
463 Ga0207692_10827412
464 Ga0207647_10288696
465 Ga0207647_10465695
466 Ga0207699_10006314
467 Ga0207699_10199737
468 Ga0207699_10625941
469 Ga0207684_11155778
470 Ga0207695_10278727
471 Ga0207671_10060172
472 Ga0207671_10152477
473 Ga0207693_10058156
474 Ga0207693_10121710
475 Ga0207693_10194199
476 Ga0207693_10266407
477 Ga0207693_10607426
478 Ga0207693_10667141
479 Ga0207693_10854195
480 Ga0207663_10083146
481 Ga0207663_10085379
482 Ga0207663_10124614
483 Ga0207663_10965118
484 Ga0207663_11151552
485 Ga0207660_10127099
486 Ga0207649_10214477
487 Ga0207652_10129037
488 Ga0207652_10187151
489 Ga0207646_10077086
490 Ga0207650_11863322
491 Ga0207700_10018633
492 Ga0207700_10032154
493 Ga0207700_10236698
494 Ga0207700_10271313
495 Ga0207664_10003662
496 Ga0207664_10032252
497 Ga0207664_10229173
498 Ga0207664_10262492
499 Ga0207664_10439631
500 Ga0207664_10572835
501 Ga0207664_10693731
502 Ga0207665_10034058
503 Ga0207665_11445511
504 Ga0207661_10207071
505 Ga0207661_10419633
506 Ga0207661_11075926
507 Ga0207667_10030392
508 Ga0207667_10067580
509 Ga0207639_10244264
510 Ga0207639_11302069
511 Ga0207702_10230500
512 Ga0207702_11448199
513 Ga0207698_11137459
514 Ga0207698_12374960
515 Ga0265337_1004813
516 Ga0265326_10008505
517 Ga0265319_1001319
518 Ga0265334_10005738
519 Ga0265318_10008863
520 Ga0265323_10003550
521 Ga0265322_10010451
522 Ga0265336_10003051
523 Ga0265338_10002773
524 Ga0265324_10003609
525 Ga0307512_10227584
526 Ga0265332_10003761
527 Ga0265320_10008970
528 Ga0265325_10007512
529 Ga0265340_10031788
530 Ga0265339_10098765
531 Ga0265316_10025190
532 Ga0265313_10011296
533 Ga0265314_10010264
534 Ga0265342_10004359
535 Ga0307413_10460251
536 Ga0307413_10839790
537 Ga0307413_10920097
538 Ga0307410_10260392
539 Ga0307410_11066302
540 Ga0307407_10223128
541 Ga0307412_10077554
542 Ga0307412_10147498
543 Ga0307412_10252750
544 Ga0307416_100092062
545 Ga0307416_100131361
546 Ga0307416_101559170
547 Ga0307411_10059593
548 Ga0373926_0256039
549 Ga0373936_0081835
550 Ga0373954_0642094
551 Ga0373956_0003862
552 Ga0373957_0412736
553 Ga0373957_0522672
554 Ga0373946_0529997
555 Ga0373924_0014578
556 Ga0373935_0177918
557 Ga0373935_1088943
558 Ga0373933_0223822
559 Ga0373937_0108789
560 Ga0395899_0002335
561 Ga0395900_0028487
562 Ga0395900_0180575
563 Ga0395898_0036630
564 Ga0395905_0155514
565 Ga0395905_0509677
566 Ga0436364_0361413
567 Ga0436364_0428712
568 Ga0395901_0131343
569 Ga0395901_0690851
570 Ga0436365_1739552
571 Ga0436360_0779555
572 Ga0436363_0143690
573 Ga0436362_0009758
574 Ga0439466_0159516
575 Ga0451791_0694949
576 Ga0451797_1143158
577 Ga0451798_0507228
578 Ga0451802_0740993
579 Ga0451802_1539664
580 Ga0451843_0250386
581 Ga0451855_1402944
582 Ga0451853_3912467
583 Ga0439442_017589
584 Ga0439434_0003256
585 Ga0466969_0290641
586 Ga0466972_0240524
587 Ga0466965_0013434
588 Ga0466965_0505935
589 Ga0466965_0708289
590 Ga0466966_0278295
591 Ga0466961_0633461
592 Ga0466963_0114325
593 Ga0466963_0127946
594 Ga0466963_0165635
595 Ga0466963_0968200
596 Ga0466963_1137936
597 Ga0466970_0166535
598 Ga0466970_0170242
599 Ga0466970_0478107
600 Ga0466970_0965065
601 Ga0466957_0738583
602 Ga0466960_0055709
603 Ga0466960_0140505
604 Ga0466960_0816698
605 Ga0466959_0075710
606 Ga0466958_0037841
607 Ga0466958_0332052
608 Ga0466958_0356450
609 Ga0466967_0103861
610 Ga0466967_0263336
611 Ga0466967_0542905
612 Ga0466967_0713675
613 Ga0495651_0100796
614 Ga0495653_0024545
615 Ga0495662_0039960
616 Ga0495664_0176094
617 Ga0495596_0221890
618 Ga0495618_0102968
619 Ga0495628_0247902
620 Ga0495630_0208613
621 Ga0495667_0056807
622 Ga0495634_0161889
623 Ga0495635_0046948
624 Ga0495599_0044253
625 Ga0495646_0177293
626 Ga0495624_0108111
627 Ga0495600_0032291
628 Ga0495604_0509724
629 Ga0495684_0015890
630 Ga0496100_0028790
631 Ga0496100_0470454
632 Ga0496100_0470505
633 Ga0496100_0745952
634 Ga0496100_0750477
635 Ga0496101_0244471
636 Ga0496102_0494792
637 Ga0496103_0277829
638 Ga0496104_0626440
639 Ga0496104_1556949
640 Ga0496105_0388347
641 Ga0496105_0404325
642 Ga0496105_1275572
643 Ga0496107_0356688
644 Ga0496108_0048014
645 Ga0496108_0183928
646 Ga0496108_0962298
647 Ga0496109_0030230
648 Ga0496109_0079013
649 Ga0496109_0169558
650 Ga0496109_0276558
651 Ga0496109_0520427
652 Ga0496110_0179970
653 Ga0496110_0496592
654 Ga0496111_0659467
655 Ga0496112_0142803
656 Ga0496112_0190023
657 Ga0496112_0267868
658 Ga0496112_1611654
659 Ga0496113_0038789
660 Ga0496113_0050232
661 Ga0496113_0133582
662 Ga0496113_0462907
663 Ga0496113_0756764
664 Ga0496114_0017909
665 Ga0496114_0174831
666 Ga0496114_0911810
667 Ga0496114_0989108
668 Ga0496115_0228894
669 Ga0496115_0247324
670 Ga0496115_0336788
671 Ga0496126_0021364
672 Ga0496126_0173850
673 Ga0501031_0003686
674 Ga0501033_0103142
675 Ga0501033_0762422
676 Ga0501036_0036729
677 Ga0501037_0015243
678 Ga0501038_0747696
679 Ga0501039_0142378
680 Ga0501039_0180580
681 Ga0501039_0935553
682 Ga0501040_0037325
683 Ga0501041_0006357
684 Ga0501041_0534545
685 Ga0501042_0008662
686 Ga0501042_0343086
687 Ga0501043_0096599
688 Ga0501046_0172598
689 Ga0501047_0042143
690 Ga0501048_0016896
691 Ga0501068_0062918
692 Ga0501069_0731959
693 Ga0501070_0023535
694 Ga0501071_0756888
695 Ga0501071_1003958
696 Ga0501072_0047576
697 Ga0501073_0313644
698 Ga0501074_0033710
699 Ga0501075_0003711
700 Ga0501076_0015817
701 Ga0501077_0012160
702 Ga0501079_0060575
703 Ga0501080_0053251
704 Ga0501081_0035217
705 Ga0501279_092069
706 Ga0501035_0179168
707 Ga0501044_0157242
708 Ga0501045_0017130
709 nmdc:mga03683_124755_c1
710 nmdc:mga03n38_18208_c1
711 nmdc:mga00v17_75549_c2
712 Ga0495601_0182821
713 Ga0495612_0052090
714 Ga0501084_0011272
715 Ga0587067_120525
716 Ga0587072_029441
717 Ga0501082_0051789
718 Ga0466962_0344477
719 Ga0530510_0004299
720 2819668081
721 2857743175
722 2904497167
723 2904780384
724 2910813881
725 2919038367
726 2919540100
727 2932428943
728 2933422653

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18029

Glyoxalase_6

Glyoxalase-like domain

36

144

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3h37-assembly3.cif.gz_B the structure of cca-adding enzyme apo form i 0.7687 9 52
2rbb-assembly1.cif.gz_B crystal structure of a glyoxalase/bleomycin resistance protein/dioxygenase family enzyme from burkholderia phytofirmans psjn 0.7494 7 116
4nb0-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus with bs-cys9 disulfide at 1.62 angstrom resolution 0.7262 1 117
4nb2-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus at 1.89 angstrom resolution - apo structure 0.7166 1 117
4jd1-assembly1.cif.gz_A crystal structure of metallothiol transferase fosb 2 from bacillus anthracis str. ames 0.7163 1 117
ID Description Score Start End Superfamily
af_O74381_258_430_2.130.10.30 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;Regulator of chromosome condensation 1/beta-lactamase-inhibitor protein II 0.8474 27 50 2.130.10.30
af_F1R0N1_45_261_2.60.120.200 Mainly Beta;Sandwich;Jelly Rolls; 0.8068 27 52 2.60.120.200
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8029 68 116 3.30.720.110
af_A1ZAQ3_514_641_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.793 27 53 2.30.29.30
af_O06633_2_115_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.778 3 117 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A127A6I5-F1-model_v4 Glyoxalase-like domain-containing protein 0.9763 69 117
AF-A0A7Y5RJU6-F1-model_v4 VOC family protein 0.9689 17 117
AF-A0A2W2AWQ4-F1-model_v4 Glyoxalase 0.9597 1 117
AF-A0A542HE00-F1-model_v4 deleted 0.958 1 117
AF-A0A653MIQ6-F1-model_v4 Enzyme related to lactoylglutathione lyase 0.9579 1 117 GO:0016829

Map