F423403

General Info

Members Datasets Scaffolds Average Seq Length
364 216 728 154

Family's Representative Sequence

Representative Sequence 3300039450|Ga0436363_1060733|Ga0436363_1060733_414_845
Length 143
Sequence MKSLQETFAPQNRCFGCGPANEKGLRIRSFESGDELVAEWKAEPHHVAFDGILNGGICGALLDCHSNWAAAIHLMKMHGQAAPPCTVTADFHVTLRRPTPIDAPLHLRAHVVEATLEANGKVTATCRGTFVAVTEGHPAYHRW

Samples

Sample ID Description Type Environment
1 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
76 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
93 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
94 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
137 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
142 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
143 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
144 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
147 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
148 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
149 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
150 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
151 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
153 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
154 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
155 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
156 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
157 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
158 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
159 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
160 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
161 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
162 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
163 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
164 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
165 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
166 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
167 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
168 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
169 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
170 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
171 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
172 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
173 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
174 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
175 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
176 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
177 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
178 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
179 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
180 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
181 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
182 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
183 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
184 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
186 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
187 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
188 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
189 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
190 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
191 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
192 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
193 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
194 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
195 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
196 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
197 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
198 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
199 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
200 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
201 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
202 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
203 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
204 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
205 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
206 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
207 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
208 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
209 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
210 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
211 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
212 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
213 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
214 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
215 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
216 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.37
Nodule 0
Rhizoplane 1.65
Rhizosphere 93.96
Stem 0
Stem Tuber 0
Unclassified 21.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436363_1060733 3300039450 Bacteria 1308
2 JGI25406J46586_10000023 3300003203 Bacteria 76640
3 rootH1_10211829 3300003323 Bacteria 1504
4 Ga0065715_10196986 3300005293 Bacteria 1382
5 Ga0070658_10511323 3300005327 Unclassified 1038
6 Ga0070676_10011815 3300005328 Bacteria 4753
7 Ga0070690_100035062 3300005330 Bacteria 3147
8 Ga0070670_100009002 3300005331 Bacteria 8529
9 Ga0070677_10009717 3300005333 Unclassified 3270
10 Ga0068869_100074967 3300005334 Unclassified 2513
11 Ga0068869_100552389 3300005334 Bacteria 967
12 Ga0068869_101110288 3300005334 Bacteria 692
13 Ga0070680_100017612 3300005336 Bacteria 5635
14 Ga0070680_100405035 3300005336 Bacteria 1163
15 Ga0070682_100000001 3300005337 Bacteria 569837
16 Ga0070682_100303236 3300005337 Bacteria 1173
17 Ga0070689_100158714 3300005340 Bacteria 1827
18 Ga0070689_100259610 3300005340 Bacteria 1436
19 Ga0070687_100006223 3300005343 Bacteria 4882
20 Ga0070692_10010143 3300005345 Unclassified 4277
21 Ga0070669_100481376 3300005353 Bacteria 1027
22 Ga0070675_100000002 3300005354 Bacteria 435215
23 Ga0070675_100019238 3300005354 Bacteria 5440
24 Ga0070671_100019400 3300005355 Bacteria 5532
25 Ga0070671_100492912 3300005355 Bacteria 1054
26 Ga0070671_100813437 3300005355 Bacteria 814
27 Ga0070674_100044949 3300005356 Bacteria 3015
28 Ga0070674_100760101 3300005356 Bacteria 834
29 Ga0070688_100182741 3300005365 Unclassified 1456
30 Ga0070659_100217989 3300005366 Bacteria 1574
31 Ga0070659_100290921 3300005366 Unclassified 1360
32 Ga0070667_100042458 3300005367 Bacteria 3815
33 Ga0070667_100249123 3300005367 Bacteria 1588
34 Ga0070667_100685980 3300005367 Bacteria 947
35 Ga0070667_101025328 3300005367 Unclassified 770
36 Ga0070713_100014028 3300005436 Bacteria 5933
37 Ga0070713_101479461 3300005436 Bacteria 659
38 Ga0070711_100312984 3300005439 Bacteria 1252
39 Ga0070705_100080429 3300005440 Unclassified 1999
40 Ga0070700_100000040 3300005441 Bacteria 105850
41 Ga0070694_100154544 3300005444 Bacteria 1678
42 Ga0070708_100175043 3300005445 Bacteria 2004
43 Ga0070708_100224311 3300005445 Bacteria 1763
44 Ga0070708_100432375 3300005445 Bacteria 1241
45 Ga0070708_100634563 3300005445 Unclassified 1007
46 Ga0070663_100257580 3300005455 Bacteria 1383
47 Ga0070663_101327018 3300005455 Bacteria 635
48 Ga0070678_100034685 3300005456 Unclassified 3516
49 Ga0070662_100011478 3300005457 Bacteria 5847
50 Ga0068867_100023729 3300005459 Bacteria 4392
51 Ga0068867_100404494 3300005459 Bacteria 1152
52 Ga0070685_10313264 3300005466 Unclassified 1061
53 Ga0070706_100033072 3300005467 Bacteria 4772
54 Ga0070706_100033941 3300005467 Bacteria 4711
55 Ga0070706_100047401 3300005467 Bacteria 3965
56 Ga0070706_100071956 3300005467 Bacteria 3199
57 Ga0070706_100100287 3300005467 Bacteria 2690
58 Ga0070706_100116875 3300005467 Bacteria 2484
59 Ga0070706_100211825 3300005467 Bacteria 1809
60 Ga0070706_100520081 3300005467 Bacteria 1107
61 Ga0070706_100627147 3300005467 Unclassified 998
62 Ga0070707_100019041 3300005468 Bacteria 6464
63 Ga0070707_100024558 3300005468 Bacteria 5709
64 Ga0070707_100088739 3300005468 Bacteria 2991
65 Ga0070707_100178082 3300005468 Bacteria 2073
66 Ga0070707_100183250 3300005468 Bacteria 2041
67 Ga0070707_100361077 3300005468 Bacteria 1411
68 Ga0070698_100001428 3300005471 Bacteria 26458
69 Ga0070698_100023622 3300005471 Bacteria 6424
70 Ga0070698_100214042 3300005471 Bacteria 1861
71 Ga0070698_100218591 3300005471 Bacteria 1839
72 Ga0070698_101025387 3300005471 Bacteria 773
73 Ga0070698_101076821 3300005471 Bacteria 752
74 Ga0070699_100057163 3300005518 Bacteria 3379
75 Ga0070699_100432520 3300005518 Bacteria 1192
76 Ga0070699_100622827 3300005518 Unclassified 984
77 Ga0070684_100032098 3300005535 Bacteria 4474
78 Ga0070697_100108431 3300005536 Bacteria 2311
79 Ga0070697_100258613 3300005536 Unclassified 1490
80 Ga0070697_100303553 3300005536 Bacteria 1373
81 Ga0070672_100113072 3300005543 Bacteria 2215
82 Ga0070672_100472712 3300005543 Bacteria 1082
83 Ga0070686_100283333 3300005544 Unclassified 1223
84 Ga0070696_100359699 3300005546 Bacteria 1129
85 Ga0070693_100115148 3300005547 Bacteria 1660
86 Ga0070665_100009635 3300005548 Bacteria 9769
87 Ga0070665_100206527 3300005548 Bacteria 1965
88 Ga0070665_100280617 3300005548 Unclassified 1668
89 Ga0070704_100023774 3300005549 Bacteria 4009
90 Ga0068855_100252083 3300005563 Unclassified 1969
91 Ga0070664_100035351 3300005564 Bacteria 4194
92 Ga0070664_100199328 3300005564 Bacteria 1786
93 Ga0070702_100715428 3300005615 Unclassified 765
94 Ga0068852_100349079 3300005616 Unclassified 1444
95 Ga0068859_100000005 3300005617 Bacteria 430800
96 Ga0068859_100053140 3300005617 Unclassified 4073
97 Ga0068859_101489702 3300005617 Unclassified 747
98 Ga0068859_101541160 3300005617 Bacteria 734
99 Ga0068864_100024777 3300005618 Bacteria 5048
100 Ga0068864_100760818 3300005618 Bacteria 950
101 Ga0068866_10567805 3300005718 Bacteria 761
102 Ga0068861_100058066 3300005719 Unclassified 2958
103 Ga0068861_100451812 3300005719 Bacteria 1152
104 Ga0068870_10005099 3300005840 Bacteria 5712
105 Ga0068870_10200973 3300005840 Bacteria 1208
106 Ga0068863_100030400 3300005841 Bacteria 5158
107 Ga0068863_100228915 3300005841 Bacteria 1792
108 Ga0068863_100761793 3300005841 Bacteria 964
109 Ga0068858_100147527 3300005842 Bacteria 2210
110 Ga0068858_100295280 3300005842 Bacteria 1545
111 Ga0068858_101019952 3300005842 Unclassified 811
112 Ga0068860_100059589 3300005843 Unclassified 3628
113 Ga0068860_100079562 3300005843 Unclassified 3117
114 Ga0068862_100021039 3300005844 Bacteria 5451
115 Ga0081455_10025475 3300005937 Bacteria 5458
116 Ga0081539_10000014 3300005985 Bacteria 411270
117 Ga0070717_10000026 3300006028 Bacteria 150967
118 Ga0075367_10547226 3300006178 Bacteria 735
119 Ga0097621_100212071 3300006237 Bacteria 1685
120 Ga0097621_100935238 3300006237 Bacteria 809
121 Ga0068871_100617416 3300006358 Bacteria 987
122 Ga0075428_100525442 3300006844 Unclassified 1266
123 Ga0075430_100503013 3300006846 Bacteria 1000
124 Ga0075431_100002569 3300006847 Bacteria 17524
125 Ga0075431_101413818 3300006847 Archaea 655
126 Ga0075433_10678908 3300006852 Bacteria 903
127 Ga0075434_100218019 3300006871 Bacteria 1928
128 Ga0075434_100366832 3300006871 Bacteria 1461
129 Ga0075434_100936512 3300006871 Unclassified 881
130 Ga0075434_100981808 3300006871 Bacteria 859
131 Ga0075429_100037609 3300006880 Bacteria 4214
132 Ga0068865_100133002 3300006881 Bacteria 1866
133 Ga0075436_100003480 3300006914 Bacteria 10795
134 Ga0075436_100036080 3300006914 Bacteria 3412
135 Ga0097620_100000005 3300006931 Bacteria 430800
136 Ga0097620_100053141 3300006931 Unclassified 4073
137 Ga0097620_101489636 3300006931 Unclassified 747
138 Ga0097620_101541230 3300006931 Bacteria 734
139 Ga0075435_100000195 3300007076 Bacteria 36669
140 Ga0099795_10217745 3300007788 Unclassified 811
141 Ga0105244_10061482 3300009036 Bacteria 1890
142 Ga0111539_10064288 3300009094 Bacteria 4341
143 Ga0111539_10370323 3300009094 Unclassified 1667
144 Ga0111539_10909639 3300009094 Unclassified 1023
145 Ga0111539_11137646 3300009094 Unclassified 907
146 Ga0105245_10000391 3300009098 Bacteria 40833
147 Ga0105245_10309081 3300009098 Bacteria 1554
148 Ga0114129_10034535 3300009147 Bacteria 7144
149 Ga0114129_10229019 3300009147 Bacteria 2504
150 Ga0114129_10428566 3300009147 Unclassified 1738
151 Ga0114129_10590704 3300009147 Bacteria 1440
152 Ga0114129_11218334 3300009147 Bacteria 937
153 Ga0105249_10077045 3300009553 Unclassified 3091
154 Ga0105249_10741065 3300009553 Unclassified 1044
155 Ga0105239_10192054 3300010375 Bacteria 2285
156 Ga0105246_12114167 3300011119 Bacteria 546
157 Ga0157378_10020283 3300013297 Bacteria 5845
158 Ga0157378_10202564 3300013297 Bacteria 1878
159 Ga0157378_11480108 3300013297 Bacteria 723
160 Ga0163162_10249677 3300013306 Bacteria 1906
161 Ga0163162_10256944 3300013306 Unclassified 1879
162 Ga0157375_10002854 3300013308 Bacteria 14961
163 Ga0157375_10111892 3300013308 Bacteria 2830
164 Ga0157375_10472771 3300013308 Bacteria 1419
165 Ga0163163_10053285 3300014325 Unclassified 3993
166 Ga0157380_10037341 3300014326 Unclassified 3764
167 Ga0157380_10098369 3300014326 Bacteria 2431
168 Ga0157377_10037063 3300014745 Unclassified 2686
169 Ga0157377_10079743 3300014745 Bacteria 1910
170 Ga0157379_10333202 3300014968 Bacteria 1387
171 Ga0157379_10351934 3300014968 Bacteria 1349
172 Ga0157376_10164328 3300014969 Bacteria 2015
173 Ga0157376_10663434 3300014969 Bacteria 1045
174 Ga0163161_10136279 3300017792 Bacteria 1856
175 Ga0213873_10000011 3300021358 Bacteria 219276
176 Ga0213876_10000029 3300021384 Bacteria 219276
177 Ga0213876_10008605 3300021384 Bacteria 5523
178 Ga0213876_10064663 3300021384 Bacteria 1930
179 Ga0207666_1037547 3300025271 Unclassified 754
180 Ga0207697_10001533 3300025315 Bacteria 12525
181 Ga0207655_1044680 3300025728 Bacteria 1859
182 Ga0207682_10005430 3300025893 Bacteria 5187
183 Ga0207642_10348605 3300025899 Bacteria 873
184 Ga0207688_10037619 3300025901 Unclassified 2685
185 Ga0207645_10020577 3300025907 Bacteria 4317
186 Ga0207643_10001227 3300025908 Bacteria 15143
187 Ga0207705_10948649 3300025909 Bacteria 666
188 Ga0207684_10042091 3300025910 Bacteria 3872
189 Ga0207684_10047676 3300025910 Bacteria 3634
190 Ga0207684_10117112 3300025910 Unclassified 2283
191 Ga0207684_10927161 3300025910 Bacteria 731
192 Ga0207707_11003259 3300025912 Unclassified 685
193 Ga0207660_10008374 3300025917 Bacteria 6688
194 Ga0207662_10023946 3300025918 Bacteria 3512
195 Ga0207662_10260450 3300025918 Bacteria 1141
196 Ga0207649_10699409 3300025920 Unclassified 786
197 Ga0207652_11470878 3300025921 Unclassified 585
198 Ga0207646_10003889 3300025922 Bacteria 16574
199 Ga0207646_10008967 3300025922 Bacteria 9954
200 Ga0207646_10135903 3300025922 Bacteria 2213
201 Ga0207646_10217958 3300025922 Unclassified 1724
202 Ga0207646_10271767 3300025922 Bacteria 1532
203 Ga0207646_10285760 3300025922 Bacteria 1491
204 Ga0207646_10337081 3300025922 Bacteria 1362
205 Ga0207681_10179444 3300025923 Bacteria 1612
206 Ga0207681_10367640 3300025923 Bacteria 1155
207 Ga0207650_10069279 3300025925 Unclassified 2650
208 Ga0207659_10000031 3300025926 Bacteria 121432
209 Ga0207659_10022377 3300025926 Bacteria 4208
210 Ga0207659_10347067 3300025926 Bacteria 1231
211 Ga0207687_10004439 3300025927 Bacteria 9359
212 Ga0207687_10115314 3300025927 Bacteria 2001
213 Ga0207690_10128079 3300025932 Unclassified 1854
214 Ga0207706_10005889 3300025933 Bacteria 11400
215 Ga0207706_10019272 3300025933 Bacteria 6136
216 Ga0207706_10494998 3300025933 Bacteria 1055
217 Ga0207686_10580484 3300025934 Bacteria 880
218 Ga0207670_10313366 3300025936 Bacteria 1232
219 Ga0207670_10838203 3300025936 Bacteria 768
220 Ga0207669_10030732 3300025937 Bacteria 2989
221 Ga0207669_10221648 3300025937 Bacteria 1388
222 Ga0207665_10239343 3300025939 Bacteria 1337
223 Ga0207665_11342796 3300025939 Unclassified 570
224 Ga0207691_10003059 3300025940 Bacteria 16319
225 Ga0207691_10442280 3300025940 Bacteria 1107
226 Ga0207689_10023149 3300025942 Bacteria 5216
227 Ga0207689_10054538 3300025942 Unclassified 3291
228 Ga0207689_10640825 3300025942 Unclassified 895
229 Ga0207689_10892204 3300025942 Bacteria 750
230 Ga0207667_11132669 3300025949 Bacteria 764
231 Ga0207712_10184834 3300025961 Bacteria 1640
232 Ga0207703_10353755 3300026035 Bacteria 1353
233 Ga0207703_10620713 3300026035 Bacteria 1024
234 Ga0207703_11110366 3300026035 Unclassified 760
235 Ga0207708_10000020 3300026075 Bacteria 187659
236 Ga0207708_11005418 3300026075 Unclassified 725
237 Ga0207641_10075372 3300026088 Bacteria 2913
238 Ga0207641_10090633 3300026088 Bacteria 2674
239 Ga0207641_10182215 3300026088 Bacteria 1925
240 Ga0207641_10201106 3300026088 Unclassified 1837
241 Ga0207648_10004566 3300026089 Bacteria 14197
242 Ga0207648_10235794 3300026089 Unclassified 1628
243 Ga0207676_10057404 3300026095 Unclassified 3065
244 Ga0207676_10818915 3300026095 Bacteria 909
245 Ga0207675_100019030 3300026118 Bacteria 6410
246 Ga0207675_100021405 3300026118 Bacteria 6024
247 Ga0207683_10003822 3300026121 Bacteria 13047
248 Ga0207683_10029665 3300026121 Unclassified 4737
249 Ga0207683_10582246 3300026121 Bacteria 1035
250 Ga0209968_1007716 3300027526 Bacteria 1631
251 Ga0209970_1000041 3300027614 Bacteria 16993
252 Ga0209983_1001746 3300027665 Bacteria 4813
253 Ga0209971_1001276 3300027682 Bacteria 6276
254 Ga0209998_10004468 3300027717 Bacteria 2970
255 Ga0209813_10294365 3300027866 Bacteria 629
256 Ga0209974_10000747 3300027876 Bacteria 11125
257 Ga0268266_10115991 3300028379 Bacteria 2378
258 Ga0268266_10529501 3300028379 Unclassified 1127
259 Ga0268266_10740634 3300028379 Bacteria 948
260 Ga0268265_10029933 3300028380 Unclassified 3916
261 Ga0268264_10056388 3300028381 Unclassified 3285
262 Ga0268264_10588396 3300028381 Bacteria 1095
263 Ga0265332_10045346 3300031238 Unclassified 1895
264 Ga0265331_10062808 3300031250 Bacteria 1751
265 Ga0307408_100409026 3300031548 Bacteria 1167
266 Ga0307412_10993873 3300031911 Bacteria 741
267 Ga0307416_100054266 3300032002 Unclassified 3221
268 Ga0307416_100645151 3300032002 Bacteria 1143
269 Ga0307416_101050963 3300032002 Bacteria 918
270 Ga0373958_0049191 3300034819 Bacteria 886
271 Ga0373957_0116294 3300035120 Bacteria 1080
272 Ga0373955_0093737 3300035172 Bacteria 1715
273 Ga0373927_0269087 3300035695 Bacteria 1121
274 Ga0373933_0511311 3300035724 Bacteria 787
275 Ga0373937_0072563 3300036401 Unclassified 3175
276 Ga0373937_0106883 3300036401 Bacteria 2601
277 Ga0373937_0879413 3300036401 Bacteria 845
278 Ga0373925_0687183 3300037068 Unclassified 844
279 Ga0400490_43138 3300038726 Bacteria 21652
280 Ga0400491_06085 3300038727 Bacteria 10631
281 Ga0436365_0067993 3300039437 Unclassified 4073
282 Ga0436365_0752290 3300039437 Bacteria 7852
283 Ga0436365_1003092 3300039437 Bacteria 1317
284 Ga0436365_1853937 3300039437 Bacteria 26257
285 Ga0436362_0083326 3300039453 Bacteria 219518
286 Ga0453683_0490028 3300044673 Unclassified 797
287 Ga0466964_0147065 3300044706 Bacteria 1089
288 Ga0451576_0538720 3300045051 Bacteria 1226
289 Ga0451576_0692765 3300045051 Bacteria 1071
290 Ga0495603_0148903 3300046455 Unclassified 1360
291 Ga0495629_0077292 3300046459 Bacteria 2323
292 Ga0495580_0065409 3300046472 Bacteria 2547
293 Ga0495580_0238045 3300046472 Bacteria 1249
294 Ga0495639_0084374 3300046475 Bacteria 1483
295 Ga0495608_0327618 3300046511 Bacteria 945
296 Ga0495628_0097674 3300046516 Bacteria 2269
297 Ga0495630_0000001 3300046517 Bacteria 1687293
298 Ga0495640_0659477 3300046533 Bacteria 629
299 Ga0495645_0311492 3300046543 Bacteria 1025
300 Ga0495667_0536701 3300046559 Bacteria 731
301 Ga0495635_0004742 3300046663 Bacteria 9449
302 Ga0495623_0271163 3300046679 Bacteria 947
303 Ga0495647_0020692 3300046681 Unclassified 2364
304 Ga0495658_0149722 3300046683 Bacteria 1433
305 Ga0495613_0268051 3300046689 Bacteria 1188
306 Ga0495600_0014150 3300046809 Bacteria 5026
307 Ga0495581_0606894 3300047315 Bacteria 634
308 Ga0495674_1394909 3300047319 Bacteria 522
309 Ga0495684_0071215 3300047471 Bacteria 2642
310 Ga0495684_0189100 3300047471 Bacteria 1523
311 Ga0496102_0332769 3300048905 Bacteria 1430
312 Ga0496102_1080506 3300048905 Bacteria 722
313 Ga0496103_0183039 3300048906 Bacteria 1347
314 Ga0496106_0064684 3300048909 Unclassified 2783
315 Ga0496107_0052713 3300048910 Unclassified 2934
316 Ga0496110_0905822 3300048913 Bacteria 788
317 Ga0501038_0501533 3300049574 Bacteria 928
318 Ga0501071_1088729 3300049587 Bacteria 617
319 Ga0501072_0282583 3300049588 Bacteria 1320
320 Ga0501073_1051151 3300049589 Bacteria 560
321 Ga0501074_0077602 3300049590 Bacteria 2384
322 Ga0501075_0434036 3300049591 Bacteria 1002
323 Ga0501076_0042599 3300049592 Bacteria 3575
324 Ga0501077_0774062 3300049593 Bacteria 617
325 Ga0501079_0071317 3300049741 Bacteria 2684
326 Ga0501079_0308448 3300049741 Bacteria 1238
327 Ga0501080_0622914 3300049742 Bacteria 956
328 Ga0501081_0124489 3300049743 Bacteria 1838
329 Ga0501081_0144318 3300049743 Bacteria 1707
330 Ga0501045_0107125 3300049824 Bacteria 2071
331 nmdc:mga03n38_114625_c1 3300050490 Unclassified 1317
332 nmdc:mga05p37_135196_c1 3300050507 Bacteria 3024
333 nmdc:mga05p37_382670_c1 3300050507 Unclassified 1648
334 nmdc:mga05p37_458618_c1 3300050507 Bacteria 1473
335 nmdc:mga09592_562914_c1 3300050508 Bacteria 978
336 nmdc:mga09592_8736_c1 3300050508 Bacteria 4042
337 nmdc:mga0qj67_300039_c1 3300050509 Unclassified 1301
338 nmdc:mga0qj67_441452_c1 3300050509 Bacteria 1048
339 nmdc:mga06r32_1250699_c1 3300050510 Bacteria 687
340 nmdc:mga06r32_7106_c1 3300050510 Bacteria 10082
341 nmdc:mga06r32_7456_c1 3300050510 Bacteria 9843
342 nmdc:mga08y16_154732_c1 3300050511 Unclassified 2383
343 nmdc:mga08y16_373557_c1 3300050511 Unclassified 1462
344 nmdc:mga0n895_309741_c1 3300050512 Bacteria 1600
345 nmdc:mga0n895_879694_c1 3300050512 Bacteria 882
346 nmdc:mga0n895_964504_c1 3300050512 Unclassified 835
347 nmdc:mga0rr50_417_c1 3300050513 Bacteria 22990
348 nmdc:mga0rr50_488228_c1 3300050513 Bacteria 1046
349 nmdc:mga08x19_1047_c1 3300050514 Bacteria 10753
350 nmdc:mga0a205_253320_c1 3300050515 Bacteria 1639
351 nmdc:mga0a205_421224_c1 3300050515 Bacteria 1197
352 Ga0495601_0061248 3300053077 Bacteria 2389
353 Ga0495655_0026054 3300053083 Bacteria 1374
354 Ga0495595_0143354 3300053084 Bacteria 1173
355 Ga0495619_0007780 3300053085 Bacteria 6785
356 Ga0500644_0007233 3300053088 Bacteria 2884
357 Ga0500628_059211 3300053129 Bacteria 931
358 Ga0590071_008606 3300059421 Bacteria 2399
359 Ga0590074_002804 3300059423 Bacteria 2871
360 Ga0590075_028622 3300059424 Bacteria 1408
361 Ga0590077_001074 3300059426 Bacteria 6784
362 Ga0501082_0457749 3300060353 Bacteria 1115
363 Ga0501082_0488855 3300060353 Bacteria 1076
364 Ga0501082_0695661 3300060353 Bacteria 890
365 Ga0436363_1060733
366 JGI25406J46586_10000023
367 rootH1_10211829
368 Ga0065715_10196986
369 Ga0070658_10511323
370 Ga0070676_10011815
371 Ga0070690_100035062
372 Ga0070670_100009002
373 Ga0070677_10009717
374 Ga0068869_100074967
375 Ga0068869_100552389
376 Ga0068869_101110288
377 Ga0070680_100017612
378 Ga0070680_100405035
379 Ga0070682_100000001
380 Ga0070682_100303236
381 Ga0070689_100158714
382 Ga0070689_100259610
383 Ga0070687_100006223
384 Ga0070692_10010143
385 Ga0070669_100481376
386 Ga0070675_100000002
387 Ga0070675_100019238
388 Ga0070671_100019400
389 Ga0070671_100492912
390 Ga0070671_100813437
391 Ga0070674_100044949
392 Ga0070674_100760101
393 Ga0070688_100182741
394 Ga0070659_100217989
395 Ga0070659_100290921
396 Ga0070667_100042458
397 Ga0070667_100249123
398 Ga0070667_100685980
399 Ga0070667_101025328
400 Ga0070713_100014028
401 Ga0070713_101479461
402 Ga0070711_100312984
403 Ga0070705_100080429
404 Ga0070700_100000040
405 Ga0070694_100154544
406 Ga0070708_100175043
407 Ga0070708_100224311
408 Ga0070708_100432375
409 Ga0070708_100634563
410 Ga0070663_100257580
411 Ga0070663_101327018
412 Ga0070678_100034685
413 Ga0070662_100011478
414 Ga0068867_100023729
415 Ga0068867_100404494
416 Ga0070685_10313264
417 Ga0070706_100033072
418 Ga0070706_100033941
419 Ga0070706_100047401
420 Ga0070706_100071956
421 Ga0070706_100100287
422 Ga0070706_100116875
423 Ga0070706_100211825
424 Ga0070706_100520081
425 Ga0070706_100627147
426 Ga0070707_100019041
427 Ga0070707_100024558
428 Ga0070707_100088739
429 Ga0070707_100178082
430 Ga0070707_100183250
431 Ga0070707_100361077
432 Ga0070698_100001428
433 Ga0070698_100023622
434 Ga0070698_100214042
435 Ga0070698_100218591
436 Ga0070698_101025387
437 Ga0070698_101076821
438 Ga0070699_100057163
439 Ga0070699_100432520
440 Ga0070699_100622827
441 Ga0070684_100032098
442 Ga0070697_100108431
443 Ga0070697_100258613
444 Ga0070697_100303553
445 Ga0070672_100113072
446 Ga0070672_100472712
447 Ga0070686_100283333
448 Ga0070696_100359699
449 Ga0070693_100115148
450 Ga0070665_100009635
451 Ga0070665_100206527
452 Ga0070665_100280617
453 Ga0070704_100023774
454 Ga0068855_100252083
455 Ga0070664_100035351
456 Ga0070664_100199328
457 Ga0070702_100715428
458 Ga0068852_100349079
459 Ga0068859_100000005
460 Ga0068859_100053140
461 Ga0068859_101489702
462 Ga0068859_101541160
463 Ga0068864_100024777
464 Ga0068864_100760818
465 Ga0068866_10567805
466 Ga0068861_100058066
467 Ga0068861_100451812
468 Ga0068870_10005099
469 Ga0068870_10200973
470 Ga0068863_100030400
471 Ga0068863_100228915
472 Ga0068863_100761793
473 Ga0068858_100147527
474 Ga0068858_100295280
475 Ga0068858_101019952
476 Ga0068860_100059589
477 Ga0068860_100079562
478 Ga0068862_100021039
479 Ga0081455_10025475
480 Ga0081539_10000014
481 Ga0070717_10000026
482 Ga0075367_10547226
483 Ga0097621_100212071
484 Ga0097621_100935238
485 Ga0068871_100617416
486 Ga0075428_100525442
487 Ga0075430_100503013
488 Ga0075431_100002569
489 Ga0075431_101413818
490 Ga0075433_10678908
491 Ga0075434_100218019
492 Ga0075434_100366832
493 Ga0075434_100936512
494 Ga0075434_100981808
495 Ga0075429_100037609
496 Ga0068865_100133002
497 Ga0075436_100003480
498 Ga0075436_100036080
499 Ga0097620_100000005
500 Ga0097620_100053141
501 Ga0097620_101489636
502 Ga0097620_101541230
503 Ga0075435_100000195
504 Ga0099795_10217745
505 Ga0105244_10061482
506 Ga0111539_10064288
507 Ga0111539_10370323
508 Ga0111539_10909639
509 Ga0111539_11137646
510 Ga0105245_10000391
511 Ga0105245_10309081
512 Ga0114129_10034535
513 Ga0114129_10229019
514 Ga0114129_10428566
515 Ga0114129_10590704
516 Ga0114129_11218334
517 Ga0105249_10077045
518 Ga0105249_10741065
519 Ga0105239_10192054
520 Ga0105246_12114167
521 Ga0157378_10020283
522 Ga0157378_10202564
523 Ga0157378_11480108
524 Ga0163162_10249677
525 Ga0163162_10256944
526 Ga0157375_10002854
527 Ga0157375_10111892
528 Ga0157375_10472771
529 Ga0163163_10053285
530 Ga0157380_10037341
531 Ga0157380_10098369
532 Ga0157377_10037063
533 Ga0157377_10079743
534 Ga0157379_10333202
535 Ga0157379_10351934
536 Ga0157376_10164328
537 Ga0157376_10663434
538 Ga0163161_10136279
539 Ga0213873_10000011
540 Ga0213876_10000029
541 Ga0213876_10008605
542 Ga0213876_10064663
543 Ga0207666_1037547
544 Ga0207697_10001533
545 Ga0207655_1044680
546 Ga0207682_10005430
547 Ga0207642_10348605
548 Ga0207688_10037619
549 Ga0207645_10020577
550 Ga0207643_10001227
551 Ga0207705_10948649
552 Ga0207684_10042091
553 Ga0207684_10047676
554 Ga0207684_10117112
555 Ga0207684_10927161
556 Ga0207707_11003259
557 Ga0207660_10008374
558 Ga0207662_10023946
559 Ga0207662_10260450
560 Ga0207649_10699409
561 Ga0207652_11470878
562 Ga0207646_10003889
563 Ga0207646_10008967
564 Ga0207646_10135903
565 Ga0207646_10217958
566 Ga0207646_10271767
567 Ga0207646_10285760
568 Ga0207646_10337081
569 Ga0207681_10179444
570 Ga0207681_10367640
571 Ga0207650_10069279
572 Ga0207659_10000031
573 Ga0207659_10022377
574 Ga0207659_10347067
575 Ga0207687_10004439
576 Ga0207687_10115314
577 Ga0207690_10128079
578 Ga0207706_10005889
579 Ga0207706_10019272
580 Ga0207706_10494998
581 Ga0207686_10580484
582 Ga0207670_10313366
583 Ga0207670_10838203
584 Ga0207669_10030732
585 Ga0207669_10221648
586 Ga0207665_10239343
587 Ga0207665_11342796
588 Ga0207691_10003059
589 Ga0207691_10442280
590 Ga0207689_10023149
591 Ga0207689_10054538
592 Ga0207689_10640825
593 Ga0207689_10892204
594 Ga0207667_11132669
595 Ga0207712_10184834
596 Ga0207703_10353755
597 Ga0207703_10620713
598 Ga0207703_11110366
599 Ga0207708_10000020
600 Ga0207708_11005418
601 Ga0207641_10075372
602 Ga0207641_10090633
603 Ga0207641_10182215
604 Ga0207641_10201106
605 Ga0207648_10004566
606 Ga0207648_10235794
607 Ga0207676_10057404
608 Ga0207676_10818915
609 Ga0207675_100019030
610 Ga0207675_100021405
611 Ga0207683_10003822
612 Ga0207683_10029665
613 Ga0207683_10582246
614 Ga0209968_1007716
615 Ga0209970_1000041
616 Ga0209983_1001746
617 Ga0209971_1001276
618 Ga0209998_10004468
619 Ga0209813_10294365
620 Ga0209974_10000747
621 Ga0268266_10115991
622 Ga0268266_10529501
623 Ga0268266_10740634
624 Ga0268265_10029933
625 Ga0268264_10056388
626 Ga0268264_10588396
627 Ga0265332_10045346
628 Ga0265331_10062808
629 Ga0307408_100409026
630 Ga0307412_10993873
631 Ga0307416_100054266
632 Ga0307416_100645151
633 Ga0307416_101050963
634 Ga0373958_0049191
635 Ga0373957_0116294
636 Ga0373955_0093737
637 Ga0373927_0269087
638 Ga0373933_0511311
639 Ga0373937_0072563
640 Ga0373937_0106883
641 Ga0373937_0879413
642 Ga0373925_0687183
643 Ga0400490_43138
644 Ga0400491_06085
645 Ga0436365_0067993
646 Ga0436365_0752290
647 Ga0436365_1003092
648 Ga0436365_1853937
649 Ga0436362_0083326
650 Ga0453683_0490028
651 Ga0466964_0147065
652 Ga0451576_0538720
653 Ga0451576_0692765
654 Ga0495603_0148903
655 Ga0495629_0077292
656 Ga0495580_0065409
657 Ga0495580_0238045
658 Ga0495639_0084374
659 Ga0495608_0327618
660 Ga0495628_0097674
661 Ga0495630_0000001
662 Ga0495640_0659477
663 Ga0495645_0311492
664 Ga0495667_0536701
665 Ga0495635_0004742
666 Ga0495623_0271163
667 Ga0495647_0020692
668 Ga0495658_0149722
669 Ga0495613_0268051
670 Ga0495600_0014150
671 Ga0495581_0606894
672 Ga0495674_1394909
673 Ga0495684_0071215
674 Ga0495684_0189100
675 Ga0496102_0332769
676 Ga0496102_1080506
677 Ga0496103_0183039
678 Ga0496106_0064684
679 Ga0496107_0052713
680 Ga0496110_0905822
681 Ga0501038_0501533
682 Ga0501071_1088729
683 Ga0501072_0282583
684 Ga0501073_1051151
685 Ga0501074_0077602
686 Ga0501075_0434036
687 Ga0501076_0042599
688 Ga0501077_0774062
689 Ga0501079_0071317
690 Ga0501079_0308448
691 Ga0501080_0622914
692 Ga0501081_0124489
693 Ga0501081_0144318
694 Ga0501045_0107125
695 nmdc:mga03n38_114625_c1
696 nmdc:mga05p37_135196_c1
697 nmdc:mga05p37_382670_c1
698 nmdc:mga05p37_458618_c1
699 nmdc:mga09592_562914_c1
700 nmdc:mga09592_8736_c1
701 nmdc:mga0qj67_300039_c1
702 nmdc:mga0qj67_441452_c1
703 nmdc:mga06r32_1250699_c1
704 nmdc:mga06r32_7106_c1
705 nmdc:mga06r32_7456_c1
706 nmdc:mga08y16_154732_c1
707 nmdc:mga08y16_373557_c1
708 nmdc:mga0n895_309741_c1
709 nmdc:mga0n895_879694_c1
710 nmdc:mga0n895_964504_c1
711 nmdc:mga0rr50_417_c1
712 nmdc:mga0rr50_488228_c1
713 nmdc:mga08x19_1047_c1
714 nmdc:mga0a205_253320_c1
715 nmdc:mga0a205_421224_c1
716 Ga0495601_0061248
717 Ga0495655_0026054
718 Ga0495595_0143354
719 Ga0495619_0007780
720 Ga0500644_0007233
721 Ga0500628_059211
722 Ga0590071_008606
723 Ga0590074_002804
724 Ga0590075_028622
725 Ga0590077_001074
726 Ga0501082_0457749
727 Ga0501082_0488855
728 Ga0501082_0695661

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2prx-assembly1.cif.gz_B crystal structure of thioesterase superfamily protein (zp_00837258.1) from shewanella loihica pv-4 at 1.65 a resolution 0.9098 21 145
2prx-assembly1.cif.gz_A crystal structure of thioesterase superfamily protein (zp_00837258.1) from shewanella loihica pv-4 at 1.65 a resolution 0.908 21 145
2qq2-assembly2.cif.gz_J crystal structure of c-terminal domain of human acyl-coa thioesterase 7 0.8901 36 146
2prx-assembly1.cif.gz_B crystal structure of thioesterase superfamily protein (zp_00837258.1) from shewanella loihica pv-4 at 1.65 a resolution 0.8867 21 145
2prx-assembly1.cif.gz_A crystal structure of thioesterase superfamily protein (zp_00837258.1) from shewanella loihica pv-4 at 1.65 a resolution 0.885 21 145
ID Description Score Start End Superfamily
2prxB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9057 21 144 3.10.129.10
2prxB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8819 21 144 3.10.129.10
2fs2B00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8776 27 145 3.10.129.10
4zv3B01 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8664 38 142 3.10.129.10
af_Q9VMA4_98_246_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8588 47 144 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A2V6MMD9-F1-model_v4 PaaI family thioesterase 0.9977 30 135
AF-A0A3A5WCT0-F1-model_v4 PaaI family thioesterase 0.9949 3 139
AF-A0A3A5WCT0-F1-model_v4 PaaI family thioesterase 0.9807 3 139
AF-A0A2V6JCR3-F1-model_v4 PaaI family thioesterase 0.9798 1 154
AF-A0A535BJF6-F1-model_v4 PaaI family thioesterase 0.9784 69 154

Map