F423380

General Info

Members Datasets Scaffolds Average Seq Length
364 177 357 185

Family's Representative Sequence

Representative Sequence 3300032004|Ga0307414_10093416|Ga0307414_100934161
Length 192
Sequence MYCLLPMISKNSHQSGSLLVSEPFMLDPNFKRSVVLLAEHSGSGSIGFVLNQRSDLLLGDVIPDCWDGNFPIFLGGPVANDTLHFIHRCYDKLLSGIEIKDGIYWGGDFETLKVLINNNSILPQEIRFFIGYSGWGEDQLDAELEQNSWLISNNYSAESLFADGDNLWKEVVISLGPKYAHIANFPENPMWN

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
3 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
4 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
5 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
6 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
7 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
8 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
9 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
10 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
11 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
12 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
13 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
14 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
15 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
16 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
17 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
18 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
19 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
20 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
21 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
22 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
74 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
76 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
77 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
78 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
79 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
80 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
110 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
111 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
112 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
113 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
116 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
117 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
118 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
119 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
120 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
121 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
122 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
123 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
124 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
125 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
126 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
127 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
128 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
129 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
130 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
131 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
132 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
133 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
134 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
135 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
136 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
137 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
138 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
139 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
140 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
141 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
142 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
143 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
144 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
145 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
146 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
147 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
148 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
149 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
150 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
151 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
152 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
153 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
154 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
155 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
156 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
157 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
158 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
159 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
160 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
161 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
162 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
163 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
164 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
165 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
166 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
167 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
168 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
169 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
170 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
171 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
172 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
173 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
174 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
175 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
176 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
177 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.88
Metatranscriptomes 1.92
Isolates 2.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.97
Nodule 0
Rhizoplane 0.55
Rhizosphere 84.34
Stem 0
Stem Tuber 0
Unclassified 7.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1021111 3300001904 Bacteria 1022
2 JGI24740J21852_10007179 3300001979 Bacteria 4545
3 JGI24739J22299_10014343 3300001989 Bacteria 2884
4 JGI24737J22298_10003109 3300001990 Bacteria 5884
5 JGI24737J22298_10010758 3300001990 Bacteria 3009
6 JGI24735J21928_10000001 3300002067 Bacteria 650042
7 JGI24735J21928_10014962 3300002067 Bacteria 2424
8 JGI25162J39368_1000141 3300002737 Bacteria 77973
9 JGI25162J39368_1000427 3300002737 Bacteria 33903
10 JGI25157J39369_1008717 3300002741 Bacteria 1397
11 JGI25164J39214_1001353 3300002772 Bacteria 5969
12 JGI25165J46597_1000548 3300003214 Bacteria 34311
13 rootH1_10044460 3300003316 Bacteria 10176
14 rootH1_10044460 3300003323 Bacteria 12555
15 rootH1_10146927 3300003316 Bacteria 3742
16 rootH2_10006566 3300003320 Bacteria 99379
17 rootH2_10012128 3300003320 Bacteria 20508
18 rootH2_10255974 3300003320 Bacteria 1924
19 rootH2_10265251 3300003320 Bacteria 1326
20 rootH2_10274581 3300003320 Bacteria 1494
21 rootL2_10230664 3300003322 Bacteria 1686
22 rootH1_10029634 3300003323 Bacteria 17261
23 rootH1_10101936 3300003323 Unclassified 1664
24 rootH1_10129216 3300003323 Bacteria 3739
25 rootH1_10135225 3300003323 Bacteria 5221
26 rootH1_10174014 3300003323 Bacteria 1394
27 Ga0065714_10089323 3300005288 Bacteria 1984
28 Ga0065714_10118337 3300005288 Bacteria 1380
29 Ga0065714_10286050 3300005288 Bacteria 715
30 Ga0070658_10000045 3300005327 Bacteria 130728
31 Ga0070658_10011815 3300005327 Bacteria 7008
32 Ga0070658_10482002 3300005327 Bacteria 1070
33 Ga0070658_10667141 3300005327 Bacteria 902
34 Ga0070658_10775948 3300005327 Bacteria 832
35 Ga0070676_10000502 3300005328 Bacteria 18694
36 Ga0070680_100066458 3300005336 Bacteria 2957
37 Ga0068868_100007520 3300005338 Bacteria 7762
38 Ga0068868_100025071 3300005338 Bacteria 4530
39 Ga0070660_100534324 3300005339 Bacteria 977
40 Ga0070673_100073955 3300005364 Bacteria 2745
41 Ga0070659_100000854 3300005366 Bacteria 22245
42 Ga0070659_100110009 3300005366 Bacteria 2224
43 Ga0070659_100245034 3300005366 Bacteria 1484
44 Ga0070663_100001762 3300005455 Bacteria 12041
45 Ga0070663_101737836 3300005455 Bacteria 558
46 Ga0070678_100035385 3300005456 Bacteria 3486
47 Ga0070662_100000103 3300005457 Bacteria 46838
48 Ga0070681_10005489 3300005458 Bacteria 12250
49 Ga0068867_100002497 3300005459 Bacteria 12925
50 Ga0070679_100002090 3300005530 Bacteria 17981
51 Ga0070684_100021371 3300005535 Bacteria 5384
52 Ga0068853_100013613 3300005539 Bacteria 6647
53 Ga0068853_100109686 3300005539 Bacteria 2450
54 Ga0068853_100538710 3300005539 Bacteria 1105
55 Ga0068853_100951757 3300005539 Bacteria 826
56 Ga0070665_100000083 3300005548 Bacteria 181044
57 Ga0068855_100000122 3300005563 Bacteria 97622
58 Ga0068855_100003118 3300005563 Bacteria 20278
59 Ga0068855_100026390 3300005563 Bacteria 6948
60 Ga0068855_100068811 3300005563 Bacteria 4121
61 Ga0068855_100089540 3300005563 Bacteria 3553
62 Ga0068855_100173771 3300005563 Bacteria 2439
63 Ga0068855_100350624 3300005563 Bacteria 1626
64 Ga0068857_100176218 3300005577 Bacteria 1945
65 Ga0068857_100703225 3300005577 Bacteria 960
66 Ga0068856_100000263 3300005614 Bacteria 57295
67 Ga0068856_100068867 3300005614 Bacteria 3498
68 Ga0068856_100327952 3300005614 Bacteria 1548
69 Ga0068856_101154335 3300005614 Bacteria 791
70 Ga0068856_101304688 3300005614 Bacteria 741
71 Ga0068852_100004713 3300005616 Bacteria 9676
72 Ga0068852_100113065 3300005616 Bacteria 2472
73 Ga0068852_100389764 3300005616 Bacteria 1368
74 Ga0068852_100553221 3300005616 Bacteria 1151
75 Ga0068852_100862915 3300005616 Bacteria 921
76 Ga0068864_100888742 3300005618 Bacteria 879
77 Ga0075366_10002457 3300006195 Bacteria 9486
78 Ga0075366_10018005 3300006195 Bacteria 4076
79 Ga0075366_10139565 3300006195 Bacteria 1465
80 Ga0097621_100000041 3300006237 Bacteria 66329
81 Ga0075370_10461108 3300006353 Bacteria 765
82 Ga0068865_100001976 3300006881 Bacteria 12108
83 Ga0105240_10000010 3300009093 Bacteria 537830
84 Ga0105240_10006526 3300009093 Bacteria 17130
85 Ga0105240_10012588 3300009093 Bacteria 11667
86 Ga0105240_10014628 3300009093 Bacteria 10706
87 Ga0105240_10084477 3300009093 Bacteria 3892
88 Ga0105240_10156071 3300009093 Bacteria 2714
89 Ga0105240_10307083 3300009093 Bacteria 1813
90 Ga0105240_10490169 3300009093 Unclassified 1368
91 Ga0105240_10929862 3300009093 Bacteria 934
92 Ga0105240_11030362 3300009093 Unclassified 879
93 Ga0105240_11062978 3300009093 Unclassified 863
94 Ga0105243_10235204 3300009148 Bacteria 1627
95 Ga0105241_10000775 3300009174 Bacteria 24313
96 Ga0105241_10002686 3300009174 Bacteria 13328
97 Ga0105241_10002915 3300009174 Bacteria 12783
98 Ga0105241_10196923 3300009174 Bacteria 1680
99 Ga0105241_10442439 3300009174 Bacteria 1148
100 Ga0105242_10013698 3300009176 Bacteria 6275
101 Ga0105237_10000227 3300009545 Bacteria 79785
102 Ga0105237_10002528 3300009545 Bacteria 22649
103 Ga0105237_10003776 3300009545 Bacteria 17823
104 Ga0105237_10021405 3300009545 Bacteria 6648
105 Ga0105237_10042234 3300009545 Bacteria 4599
106 Ga0105237_10472694 3300009545 Bacteria 1260
107 Ga0105237_10565368 3300009545 Bacteria 1144
108 Ga0105237_10607250 3300009545 Bacteria 1101
109 Ga0105237_10707412 3300009545 Bacteria 1014
110 Ga0105238_10037862 3300009551 Bacteria 4901
111 Ga0105238_10192070 3300009551 Bacteria 2018
112 Ga0105239_10000002 3300010375 Bacteria 610298
113 Ga0105239_10000006 3300010375 Bacteria 442319
114 Ga0105239_10000578 3300010375 Bacteria 52273
115 Ga0105239_10002369 3300010375 Bacteria 24039
116 Ga0105239_10003720 3300010375 Bacteria 18575
117 Ga0105239_10012355 3300010375 Bacteria 9510
118 Ga0105239_10040002 3300010375 Bacteria 5136
119 Ga0105239_10428967 3300010375 Bacteria 1498
120 Ga0105239_10702543 3300010375 Bacteria 1156
121 Ga0105239_10746640 3300010375 Bacteria 1120
122 Ga0105239_12626164 3300010375 Bacteria 587
123 Ga0105246_10049259 3300011119 Bacteria 2884
124 Ga0105246_10557645 3300011119 Bacteria 983
125 Ga0157373_10000188 3300013100 Bacteria 50875
126 Ga0157373_10002019 3300013100 Bacteria 15390
127 Ga0157373_10003717 3300013100 Bacteria 11545
128 Ga0157373_10012120 3300013100 Bacteria 6337
129 Ga0157371_10000141 3300013102 Bacteria 104396
130 Ga0157371_10000869 3300013102 Bacteria 34259
131 Ga0157371_10085780 3300013102 Bacteria 2231
132 Ga0157371_10322871 3300013102 Bacteria 1120
133 Ga0157370_10086186 3300013104 Bacteria 2951
134 Ga0157370_10155550 3300013104 Bacteria 2127
135 Ga0157370_10480321 3300013104 Bacteria 1142
136 Ga0157370_10651847 3300013104 Bacteria 962
137 Ga0157369_10083652 3300013105 Bacteria 3412
138 Ga0157369_10180579 3300013105 Bacteria 2221
139 Ga0157374_10000129 3300013296 Bacteria 69468
140 Ga0157374_10003215 3300013296 Bacteria 13719
141 Ga0157374_10774285 3300013296 Bacteria 975
142 Ga0157374_10887589 3300013296 Bacteria 909
143 Ga0157374_11145408 3300013296 Bacteria 799
144 Ga0157374_11553986 3300013296 Bacteria 685
145 Ga0157378_10020455 3300013297 Bacteria 5819
146 Ga0157378_10088422 3300013297 Bacteria 2811
147 Ga0163162_10000068 3300013306 Bacteria 97068
148 Ga0163162_10048820 3300013306 Bacteria 4241
149 Ga0163162_10144782 3300013306 Bacteria 2492
150 Ga0157372_10000016 3300013307 Bacteria 220177
151 Ga0157372_10000061 3300013307 Bacteria 119814
152 Ga0157372_10000458 3300013307 Bacteria 44772
153 Ga0157372_10001333 3300013307 Bacteria 26670
154 Ga0157372_10060969 3300013307 Bacteria 4222
155 Ga0157372_10172450 3300013307 Bacteria 2503
156 Ga0157375_10015866 3300013308 Bacteria 6751
157 Ga0157375_10197615 3300013308 Bacteria 2166
158 Ga0157376_10679663 3300014969 Bacteria 1033
159 Ga0163161_10001536 3300017792 Bacteria 17042
160 Ga0206356_11714513 3300020070 Bacteria 693
161 Ga0206349_1661292 3300020075 Bacteria 852
162 Ga0206351_10199080 3300020077 Bacteria 737
163 Ga0206350_11588056 3300020080 Unclassified 619
164 Ga0206354_10475073 3300020081 Unclassified 595
165 Ga0206353_11368673 3300020082 Bacteria 741
166 Ga0213872_10006453 3300021361 Bacteria 5880
167 Ga0224712_10204632 3300022467 Bacteria 898
168 Ga0207427_100090 3300025231 Bacteria 133759
169 Ga0209437_100034 3300025233 Bacteria 494007
170 Ga0209437_100070 3300025233 Bacteria 306718
171 Ga0209026_1001326 3300025250 Bacteria 11129
172 Ga0209026_1002750 3300025250 Bacteria 6291
173 Ga0209026_1008439 3300025250 Bacteria 2148
174 Ga0209129_1005705 3300025258 Bacteria 4291
175 Ga0209233_1000038 3300025261 Bacteria 548972
176 Ga0209233_1021326 3300025261 Bacteria 1680
177 Ga0209233_1022416 3300025261 Bacteria 1616
178 Ga0209455_1001458 3300025272 Bacteria 10640
179 Ga0207647_10000062 3300025904 Bacteria 83809
180 Ga0207647_10000263 3300025904 Bacteria 43120
181 Ga0207647_10172177 3300025904 Bacteria 1260
182 Ga0207645_10000224 3300025907 Bacteria 46998
183 Ga0207705_10000080 3300025909 Bacteria 119562
184 Ga0207705_10162803 3300025909 Bacteria 1677
185 Ga0207705_10856026 3300025909 Bacteria 705
186 Ga0207654_10002041 3300025911 Bacteria 10362
187 Ga0207654_10006843 3300025911 Bacteria 5739
188 Ga0207654_10333985 3300025911 Bacteria 1039
189 Ga0207707_10004744 3300025912 Bacteria 11920
190 Ga0207695_10000019 3300025913 Bacteria 732137
191 Ga0207695_10007270 3300025913 Bacteria 14142
192 Ga0207695_10017772 3300025913 Bacteria 8254
193 Ga0207695_10019865 3300025913 Bacteria 7720
194 Ga0207695_10096864 3300025913 Bacteria 2951
195 Ga0207695_10103139 3300025913 Bacteria 2844
196 Ga0207695_10495880 3300025913 Bacteria 1103
197 Ga0207695_11475218 3300025913 Bacteria 560
198 Ga0207671_10000515 3300025914 Bacteria 52421
199 Ga0207671_10006722 3300025914 Bacteria 10184
200 Ga0207671_10009710 3300025914 Bacteria 8014
201 Ga0207671_10040409 3300025914 Bacteria 3453
202 Ga0207671_10158759 3300025914 Bacteria 1750
203 Ga0207671_10363129 3300025914 Bacteria 1149
204 Ga0207671_10782060 3300025914 Bacteria 757
205 Ga0207660_10015516 3300025917 Bacteria 5029
206 Ga0207657_10062250 3300025919 Bacteria 3196
207 Ga0207652_10084388 3300025921 Bacteria 2783
208 Ga0207652_10279874 3300025921 Bacteria 1505
209 Ga0207694_10086210 3300025924 Bacteria 2472
210 Ga0207694_10424507 3300025924 Bacteria 1108
211 Ga0207644_10023853 3300025931 Bacteria 4195
212 Ga0207690_10004758 3300025932 Bacteria 8008
213 Ga0207690_10199741 3300025932 Bacteria 1518
214 Ga0207706_10000851 3300025933 Bacteria 31416
215 Ga0207686_10085235 3300025934 Bacteria 2072
216 Ga0207704_10000037 3300025938 Bacteria 93990
217 Ga0207691_10251881 3300025940 Bacteria 1524
218 Ga0207667_10000020 3300025949 Bacteria 374770
219 Ga0207667_10004885 3300025949 Bacteria 16364
220 Ga0207667_10056554 3300025949 Bacteria 4121
221 Ga0207667_10066477 3300025949 Bacteria 3758
222 Ga0207667_10092191 3300025949 Bacteria 3129
223 Ga0207667_10488934 3300025949 Unclassified 1249
224 Ga0207667_10573210 3300025949 Bacteria 1140
225 Ga0207651_10025431 3300025960 Bacteria 3679
226 Ga0207677_10003306 3300026023 Bacteria 8525
227 Ga0207639_10011268 3300026041 Bacteria 6204
228 Ga0207639_10110694 3300026041 Bacteria 2237
229 Ga0207639_10340601 3300026041 Bacteria 1337
230 Ga0207639_10535971 3300026041 Bacteria 1073
231 Ga0207678_10055038 3300026067 Bacteria 3427
232 Ga0207678_10624189 3300026067 Unclassified 946
233 Ga0207702_10000273 3300026078 Bacteria 59343
234 Ga0207702_10291582 3300026078 Bacteria 1546
235 Ga0207702_10968711 3300026078 Bacteria 844
236 Ga0207648_10000241 3300026089 Bacteria 58974
237 Ga0207674_10558504 3300026116 Bacteria 1106
238 Ga0207674_10583073 3300026116 Bacteria 1080
239 Ga0207683_10006368 3300026121 Bacteria 10109
240 Ga0207698_10004698 3300026142 Bacteria 8353
241 Ga0207698_10368328 3300026142 Bacteria 1363
242 Ga0207698_10876523 3300026142 Unclassified 904
243 Ga0207698_11413629 3300026142 Bacteria 711
244 Ga0268266_10000095 3300028379 Bacteria 186169
245 Ga0307515_10035457 3300028794 Bacteria 8115
246 Ga0307515_10076860 3300028794 Bacteria 4419
247 Ga0307515_10312592 3300028794 Bacteria 1245
248 Ga0265338_10033318 3300028800 Bacteria 5002
249 Ga0307408_100002364 3300031548 Bacteria 13314
250 Ga0307412_10000415 3300031911 Bacteria 26059
251 Ga0307412_10551290 3300031911 Unclassified 968
252 Ga0307409_100157806 3300031995 Bacteria 1980
253 Ga0307416_101087292 3300032002 Bacteria 904
254 Ga0307414_10007005 3300032004 Bacteria 6317
255 Ga0307414_10093416 3300032004 Bacteria 2242
256 Ga0307414_10574994 3300032004 Bacteria 1007
257 Ga0307411_10015562 3300032005 Unclassified 4277
258 Ga0307507_10001815 3300033179 Bacteria 46860
259 Ga0307510_10003047 3300033180 Bacteria 19348
260 Ga0373941_0003951 3300035115 Bacteria 3397
261 Ga0395899_0000002 3300037312 Bacteria 1324310
262 Ga0395899_0000283 3300037312 Bacteria 65893
263 Ga0395900_0000694 3300037418 Bacteria 44919
264 Ga0395900_0001938 3300037418 Bacteria 23442
265 Ga0395900_0177652 3300037418 Bacteria 2165
266 Ga0395900_1060959 3300037418 Unclassified 728
267 Ga0395898_0021248 3300037466 Bacteria 6583
268 Ga0395905_0000841 3300037471 Bacteria 40055
269 Ga0395905_0006027 3300037471 Bacteria 12274
270 Ga0395901_0006601 3300038443 Bacteria 11724
271 Ga0395901_0270597 3300038443 Bacteria 1767
272 Ga0395901_0846859 3300038443 Bacteria 900
273 Ga0436361_0112067 3300039447 Bacteria 12525
274 Ga0451793_0322280 3300041452 Bacteria 1764
275 Ga0451849_1106967 3300041505 Bacteria 1040
276 Ga0439448_0006684 3300042005 Bacteria 3323
277 Ga0466969_0015787 3300044656 Bacteria 3958
278 Ga0466966_0044751 3300044684 Bacteria 2832
279 Ga0466966_0404420 3300044684 Bacteria 820
280 Ga0466961_0078066 3300044693 Bacteria 2097
281 Ga0466959_0163171 3300045049 Unclassified 1566
282 Ga0466958_0017675 3300045836 Bacteria 4129
283 Ga0495592_0190679 3300046454 Bacteria 1390
284 Ga0495638_0222001 3300046460 Bacteria 1056
285 Ga0495641_0290823 3300046461 Bacteria 736
286 Ga0495651_0277989 3300046462 Bacteria 1132
287 Ga0495650_0000014 3300046471 Bacteria 581606
288 Ga0495650_0067392 3300046471 Bacteria 1414
289 Ga0495585_0001451 3300046492 Bacteria 18615
290 Ga0495585_0006896 3300046492 Bacteria 6999
291 Ga0495596_0057227 3300046500 Bacteria 1522
292 Ga0495583_0029468 3300046506 Bacteria 2685
293 Ga0495606_0000241 3300046507 Bacteria 96663
294 Ga0495606_0007108 3300046507 Bacteria 10120
295 Ga0495606_0010172 3300046507 Bacteria 7846
296 Ga0495606_0065061 3300046507 Bacteria 2318
297 Ga0495606_0078745 3300046507 Bacteria 2055
298 Ga0495610_0022836 3300046512 Bacteria 3412
299 Ga0495616_0001895 3300046513 Bacteria 14129
300 Ga0495631_0075640 3300046518 Bacteria 1453
301 Ga0495631_0088354 3300046518 Bacteria 1334
302 Ga0495632_0077341 3300046519 Unclassified 1591
303 Ga0495644_0014482 3300046523 Bacteria 3021
304 Ga0495648_0008221 3300046524 Bacteria 8228
305 Ga0495648_0026870 3300046524 Bacteria 3865
306 Ga0495652_0059748 3300046529 Bacteria 3225
307 Ga0495652_0269293 3300046529 Bacteria 1253
308 Ga0495652_0345399 3300046529 Bacteria 1068
309 Ga0495652_0351124 3300046529 Bacteria 1057
310 Ga0495652_0781884 3300046529 Bacteria 637
311 Ga0495654_0106003 3300046530 Bacteria 1288
312 Ga0495609_0001800 3300046538 Bacteria 13764
313 Ga0495609_0136253 3300046538 Bacteria 1049
314 Ga0495622_0073676 3300046557 Bacteria 1575
315 Ga0495633_0000027 3300046558 Bacteria 204613
316 Ga0495633_0005736 3300046558 Bacteria 7506
317 Ga0495668_0000010 3300046616 Bacteria 487308
318 Ga0495625_0000003 3300046660 Bacteria 686847
319 Ga0495625_0000381 3300046660 Bacteria 67732
320 Ga0495625_0003720 3300046660 Bacteria 14873
321 Ga0495625_0025624 3300046660 Bacteria 4470
322 Ga0495625_0477449 3300046660 Unclassified 766
323 Ga0495661_0003579 3300046665 Bacteria 11431
324 Ga0495661_0014257 3300046665 Bacteria 5326
325 Ga0495661_0039155 3300046665 Bacteria 2948
326 Ga0495661_0350200 3300046665 Bacteria 727
327 Ga0495658_0066059 3300046683 Bacteria 2088
328 Ga0495671_0245765 3300046692 Bacteria 864
329 Ga0495649_0000002 3300046694 Bacteria 1093458
330 Ga0495649_0093389 3300046694 Bacteria 1602
331 Ga0495600_0203663 3300046809 Bacteria 1270
332 Ga0495660_0040013 3300046810 Bacteria 2600
333 Ga0495687_000785 3300047443 Bacteria 34129
334 Ga0495687_004344 3300047443 Bacteria 9643
335 Ga0495677_0035956 3300047445 Bacteria 1808
336 Ga0495686_0002723 3300047472 Bacteria 16166
337 Ga0495686_0004577 3300047472 Bacteria 11288
338 Ga0495686_0061686 3300047472 Bacteria 2328
339 Ga0495686_0123307 3300047472 Bacteria 1542
340 Ga0495686_0281436 3300047472 Bacteria 924
341 Ga0495614_0082404 3300048089 Bacteria 1394
342 Ga0495678_028755 3300049459 Bacteria 2341
343 Ga0495682_0090918 3300049460 Bacteria 1096
344 Ga0501080_0238620 3300049742 Bacteria 1660
345 nmdc:mga0k408_1219_c1 3300050493 Bacteria 14084
346 nmdc:mga0k408_128619_c1 3300050493 Bacteria 1503
347 nmdc:mga0k408_2497_c1 3300050493 Bacteria 4079
348 Ga0500635_0000332 3300053080 Bacteria 16185
349 Ga0500650_0289683 3300053098 Bacteria 727
350 Ga0500608_002178 3300053122 Bacteria 7048
351 Ga0500608_086204 3300053122 Bacteria 1475
352 Ga0500618_000013 3300053125 Bacteria 183026
353 Ga0500618_023836 3300053125 Bacteria 1479
354 Ga0500642_0044061 3300053130 Bacteria 1941
355 Ga0500564_044469 3300053138 Bacteria 2040
356 Ga0500622_0001023 3300053156 Bacteria 23439
357 Ga0500624_000823 3300053157 Bacteria 7113

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005455 Ga0070663_101737836 Ga0070663_1017378361 155
2 3300010375 Ga0105239_10428967 Ga0105239_104289672 168
3 3300013102 Ga0157371_10085780 Ga0157371_100857804 168
4 3300013104 Ga0157370_10480321 Ga0157370_104803212 168
5 3300013105 Ga0157369_10180579 Ga0157369_101805794 168
6 3300013307 Ga0157372_10001333 Ga0157372_100013336 168
7 3300046460 Ga0495638_0222001 Ga0495638_0222001_143_649 168
8 3300046512 Ga0495610_0022836 Ga0495610_0022836_1277_1783 168
9 3300046558 Ga0495633_0005736 Ga0495633_0005736_5356_5862 168
10 3300046665 Ga0495661_0350200 Ga0495661_0350200_208_714 168
11 3300047443 Ga0495687_000785 Ga0495687_000785_29763_30269 168
12 3300047472 Ga0495686_0061686 Ga0495686_0061686_744_1250 168
13 3300053125 Ga0500618_023836 Ga0500618_023836_749_1255 168
14 3300005614 Ga0068856_100327952 Ga0068856_1003279522 169
15 3300006195 Ga0075366_10018005 Ga0075366_100180052 169
16 3300010375 Ga0105239_10746640 Ga0105239_107466401 169
17 3300011119 Ga0105246_10049259 Ga0105246_100492594 169
18 3300013296 Ga0157374_11553986 Ga0157374_115539861 169
19 3300013306 Ga0163162_10048820 Ga0163162_100488203 169
20 3300013307 Ga0157372_10172450 Ga0157372_101724502 169
21 3300013308 Ga0157375_10015866 Ga0157375_100158668 169
22 3300025909 Ga0207705_10856026 Ga0207705_108560261 169
23 3300025913 Ga0207695_11475218 Ga0207695_114752181 169
24 3300026078 Ga0207702_10291582 Ga0207702_102915822 169
25 3300037312 Ga0395899_0000002 Ga0395899_0000002_766862_767371 169
26 3300037418 Ga0395900_0000694 Ga0395900_0000694_20182_20691 169
27 3300037418 Ga0395900_1060959 Ga0395900_1060959_54_563 169
28 3300037466 Ga0395898_0021248 Ga0395898_0021248_678_1187 169
29 3300037471 Ga0395905_0000841 Ga0395905_0000841_26959_27468 169
30 3300038443 Ga0395901_0006601 Ga0395901_0006601_6449_6958 169
31 3300038443 Ga0395901_0270597 Ga0395901_0270597_1218_1727 169
32 3300041505 Ga0451849_1106967 Ga0451849_1106967_401_910 169
33 3300044684 Ga0466966_0404420 Ga0466966_0404420_59_568 169
34 3300046471 Ga0495650_0000014 Ga0495650_0000014_22528_23037 169
35 3300046506 Ga0495583_0029468 Ga0495583_0029468_2144_2653 169
36 3300046507 Ga0495606_0007108 Ga0495606_0007108_7019_7528 169
37 3300046507 Ga0495606_0010172 Ga0495606_0010172_3097_3606 169
38 3300046513 Ga0495616_0001895 Ga0495616_0001895_12357_12866 169
39 3300046529 Ga0495652_0781884 Ga0495652_0781884_44_553 169
40 3300046538 Ga0495609_0136253 Ga0495609_0136253_286_795 169
41 3300046660 Ga0495625_0000003 Ga0495625_0000003_213423_213932 169
42 3300046694 Ga0495649_0000002 Ga0495649_0000002_793061_793570 169
43 3300046810 Ga0495660_0040013 Ga0495660_0040013_1443_1952 169
44 3300047443 Ga0495687_004344 Ga0495687_004344_745_1254 169
45 3300050493 nmdc:mga0k408_2497_c1 nmdc:mga0k408_2497_c1_3073_3582 169
46 3300053125 Ga0500618_000013 Ga0500618_000013_95816_96325 169
47 3300031911 Ga0307412_10000415 Ga0307412_1000041514 173
48 3300031995 Ga0307409_100157806 Ga0307409_1001578063 173
49 3300032002 Ga0307416_101087292 Ga0307416_1010872922 173
50 3300035115 Ga0373941_0003951 Ga0373941_0003951_1252_1815 182
51 iso_pu_bacteria 2599185184 2599477278 183
52 iso_pu_bacteria 2852623160 2852624097 183
53 iso_pu_bacteria 2884933994 2884936982 183
54 iso_pu_bacteria 2919437846 2919442309 183
55 iso_pu_bacteria 2928078545 2928079195 183
56 iso_pu_bacteria 2928147474 2928148434 183
57 iso_pu_bacteria 2932082852 2932085730 183
58 iso_pu_bacteria 2977232053 2977236708 183
59 3300049742 Ga0501080_0238620 Ga0501080_0238620_1081_1635 184
60 3300031911 Ga0307412_10551290 Ga0307412_105512902 186
61 3300032004 Ga0307414_10007005 Ga0307414_100070058 186
62 3300032004 Ga0307414_10093416 Ga0307414_100934161 186
63 3300032005 Ga0307411_10015562 Ga0307411_100155624 186
64 3300041452 Ga0451793_0322280 Ga0451793_0322280_636_1196 186
65 3300046471 Ga0495650_0067392 Ga0495650_0067392_137_697 186
66 3300047472 Ga0495686_0004577 Ga0495686_0004577_10663_11223 186
67 3300047472 Ga0495686_0123307 Ga0495686_0123307_917_1477 186
68 3300001904 JGI24736J21556_1021111 JGI24736J21556_10211112 187
69 3300001979 JGI24740J21852_10007179 JGI24740J21852_100071794 187
70 3300001989 JGI24739J22299_10014343 JGI24739J22299_100143434 187
71 3300001990 JGI24737J22298_10003109 JGI24737J22298_100031095 187
72 3300001990 JGI24737J22298_10010758 JGI24737J22298_100107585 187
73 3300002067 JGI24735J21928_10000001 JGI24735J21928_10000001347 187
74 3300002067 JGI24735J21928_10014962 JGI24735J21928_100149624 187
75 3300002737 JGI25162J39368_1000141 JGI25162J39368_100014143 187
76 3300002737 JGI25162J39368_1000427 JGI25162J39368_100042729 187
77 3300002741 JGI25157J39369_1008717 JGI25157J39369_10087172 187
78 3300002772 JGI25164J39214_1001353 JGI25164J39214_10013536 187
79 3300003214 JGI25165J46597_1000548 JGI25165J46597_100054832 187
80 3300003316 rootH1_10044460 rootH1_100444607 187
81 3300003316 rootH1_10146927 rootH1_101469272 187
82 3300003320 rootH2_10006566 rootH2_1000656628 187
83 3300003320 rootH2_10012128 rootH2_100121285 187
84 3300003320 rootH2_10255974 rootH2_102559742 187
85 3300003320 rootH2_10265251 rootH2_102652512 187
86 3300003320 rootH2_10274581 rootH2_102745812 187
87 3300003322 rootL2_10230664 rootL2_102306641 187
88 3300003323 rootH1_10029634 rootH1_100296349 187
89 3300003323 rootH1_10101936 rootH1_101019362 187
90 3300003323 rootH1_10129216 rootH1_101292161 187
91 3300003323 rootH1_10135225 rootH1_101352252 187
92 3300003323 rootH1_10174014 rootH1_101740143 187
93 3300005288 Ga0065714_10089323 Ga0065714_100893232 187
94 3300005288 Ga0065714_10118337 Ga0065714_101183372 187
95 3300005288 Ga0065714_10286050 Ga0065714_102860501 187
96 3300005327 Ga0070658_10000045 Ga0070658_10000045102 187
97 3300005327 Ga0070658_10011815 Ga0070658_100118153 187
98 3300005327 Ga0070658_10482002 Ga0070658_104820021 187
99 3300005327 Ga0070658_10667141 Ga0070658_106671411 187
100 3300005327 Ga0070658_10775948 Ga0070658_107759481 187
101 3300005328 Ga0070676_10000502 Ga0070676_1000050216 187
102 3300005336 Ga0070680_100066458 Ga0070680_1000664584 187
103 3300005338 Ga0068868_100007520 Ga0068868_1000075208 187
104 3300005338 Ga0068868_100025071 Ga0068868_1000250714 187
105 3300005339 Ga0070660_100534324 Ga0070660_1005343242 187
106 3300005364 Ga0070673_100073955 Ga0070673_1000739551 187
107 3300005366 Ga0070659_100000854 Ga0070659_1000008542 187
108 3300005366 Ga0070659_100110009 Ga0070659_1001100093 187
109 3300005366 Ga0070659_100245034 Ga0070659_1002450342 187
110 3300005455 Ga0070663_100001762 Ga0070663_1000017624 187
111 3300005456 Ga0070678_100035385 Ga0070678_1000353854 187
112 3300005457 Ga0070662_100000103 Ga0070662_10000010328 187
113 3300005458 Ga0070681_10005489 Ga0070681_1000548910 187
114 3300005459 Ga0068867_100002497 Ga0068867_1000024975 187
115 3300005530 Ga0070679_100002090 Ga0070679_10000209010 187
116 3300005535 Ga0070684_100021371 Ga0070684_1000213713 187
117 3300005539 Ga0068853_100013613 Ga0068853_1000136135 187
118 3300005539 Ga0068853_100109686 Ga0068853_1001096863 187
119 3300005539 Ga0068853_100538710 Ga0068853_1005387101 187
120 3300005539 Ga0068853_100951757 Ga0068853_1009517572 187
121 3300005548 Ga0070665_100000083 Ga0070665_10000008367 187
122 3300005563 Ga0068855_100000122 Ga0068855_1000001223 187
123 3300005563 Ga0068855_100003118 Ga0068855_10000311820 187
124 3300005563 Ga0068855_100026390 Ga0068855_1000263909 187
125 3300005563 Ga0068855_100068811 Ga0068855_1000688115 187
126 3300005563 Ga0068855_100089540 Ga0068855_1000895402 187
127 3300005563 Ga0068855_100173771 Ga0068855_1001737713 187
128 3300005563 Ga0068855_100350624 Ga0068855_1003506242 187
129 3300005577 Ga0068857_100176218 Ga0068857_1001762182 187
130 3300005577 Ga0068857_100703225 Ga0068857_1007032251 187
131 3300005614 Ga0068856_100000263 Ga0068856_10000026336 187
132 3300005614 Ga0068856_100068867 Ga0068856_1000688674 187
133 3300005614 Ga0068856_101154335 Ga0068856_1011543352 187
134 3300005614 Ga0068856_101304688 Ga0068856_1013046882 187
135 3300005616 Ga0068852_100004713 Ga0068852_10000471313 187
136 3300005616 Ga0068852_100113065 Ga0068852_1001130653 187
137 3300005616 Ga0068852_100389764 Ga0068852_1003897642 187
138 3300005616 Ga0068852_100553221 Ga0068852_1005532212 187
139 3300005616 Ga0068852_100862915 Ga0068852_1008629151 187
140 3300005618 Ga0068864_100888742 Ga0068864_1008887422 187
141 3300006195 Ga0075366_10002457 Ga0075366_100024576 187
142 3300006195 Ga0075366_10139565 Ga0075366_101395651 187
143 3300006237 Ga0097621_100000041 Ga0097621_10000004161 187
144 3300006353 Ga0075370_10461108 Ga0075370_104611081 187
145 3300006881 Ga0068865_100001976 Ga0068865_1000019767 187
146 3300009093 Ga0105240_10000010 Ga0105240_10000010346 187
147 3300009093 Ga0105240_10006526 Ga0105240_1000652621 187
148 3300009093 Ga0105240_10012588 Ga0105240_1001258814 187
149 3300009093 Ga0105240_10014628 Ga0105240_100146285 187
150 3300009093 Ga0105240_10084477 Ga0105240_100844772 187
151 3300009093 Ga0105240_10156071 Ga0105240_101560713 187
152 3300009093 Ga0105240_10307083 Ga0105240_103070833 187
153 3300009093 Ga0105240_10490169 Ga0105240_104901692 187
154 3300009093 Ga0105240_10929862 Ga0105240_109298621 187
155 3300009093 Ga0105240_11030362 Ga0105240_110303621 187
156 3300009093 Ga0105240_11062978 Ga0105240_110629781 187
157 3300009148 Ga0105243_10235204 Ga0105243_102352043 187
158 3300009174 Ga0105241_10000775 Ga0105241_1000077517 187
159 3300009174 Ga0105241_10002686 Ga0105241_1000268616 187
160 3300009174 Ga0105241_10002915 Ga0105241_1000291512 187
161 3300009174 Ga0105241_10196923 Ga0105241_101969231 187
162 3300009174 Ga0105241_10442439 Ga0105241_104424391 187
163 3300009176 Ga0105242_10013698 Ga0105242_100136983 187
164 3300009545 Ga0105237_10000227 Ga0105237_100002273 187
165 3300009545 Ga0105237_10002528 Ga0105237_1000252812 187
166 3300009545 Ga0105237_10003776 Ga0105237_1000377623 187
167 3300009545 Ga0105237_10021405 Ga0105237_100214054 187
168 3300009545 Ga0105237_10042234 Ga0105237_100422343 187
169 3300009545 Ga0105237_10472694 Ga0105237_104726942 187
170 3300009545 Ga0105237_10565368 Ga0105237_105653682 187
171 3300009545 Ga0105237_10607250 Ga0105237_106072502 187
172 3300009545 Ga0105237_10707412 Ga0105237_107074121 187
173 3300009551 Ga0105238_10037862 Ga0105238_100378626 187
174 3300009551 Ga0105238_10192070 Ga0105238_101920702 187
175 3300010375 Ga0105239_10000002 Ga0105239_1000000260 187
176 3300010375 Ga0105239_10000006 Ga0105239_1000000655 187
177 3300010375 Ga0105239_10000578 Ga0105239_100005788 187
178 3300010375 Ga0105239_10002369 Ga0105239_1000236929 187
179 3300010375 Ga0105239_10003720 Ga0105239_1000372016 187
180 3300010375 Ga0105239_10012355 Ga0105239_100123553 187
181 3300010375 Ga0105239_10040002 Ga0105239_100400026 187
182 3300010375 Ga0105239_10702543 Ga0105239_107025432 187
183 3300010375 Ga0105239_12626164 Ga0105239_126261641 187
184 3300011119 Ga0105246_10557645 Ga0105246_105576452 187
185 3300013100 Ga0157373_10000188 Ga0157373_1000018827 187
186 3300013100 Ga0157373_10002019 Ga0157373_1000201920 187
187 3300013100 Ga0157373_10003717 Ga0157373_100037179 187
188 3300013100 Ga0157373_10012120 Ga0157373_100121203 187
189 3300013102 Ga0157371_10000141 Ga0157371_1000014130 187
190 3300013102 Ga0157371_10000869 Ga0157371_1000086935 187
191 3300013102 Ga0157371_10322871 Ga0157371_103228711 187
192 3300013104 Ga0157370_10086186 Ga0157370_100861862 187
193 3300013104 Ga0157370_10155550 Ga0157370_101555501 187
194 3300013104 Ga0157370_10651847 Ga0157370_106518472 187
195 3300013105 Ga0157369_10083652 Ga0157369_100836524 187
196 3300013296 Ga0157374_10000129 Ga0157374_1000012949 187
197 3300013296 Ga0157374_10003215 Ga0157374_1000321516 187
198 3300013296 Ga0157374_10774285 Ga0157374_107742852 187
199 3300013296 Ga0157374_10887589 Ga0157374_108875891 187
200 3300013296 Ga0157374_11145408 Ga0157374_111454081 187
201 3300013297 Ga0157378_10020455 Ga0157378_100204558 187
202 3300013297 Ga0157378_10088422 Ga0157378_100884225 187
203 3300013306 Ga0163162_10000068 Ga0163162_1000006867 187
204 3300013306 Ga0163162_10144782 Ga0163162_101447823 187
205 3300013307 Ga0157372_10000016 Ga0157372_10000016170 187
206 3300013307 Ga0157372_10000061 Ga0157372_10000061118 187
207 3300013307 Ga0157372_10000458 Ga0157372_1000045823 187
208 3300013307 Ga0157372_10060969 Ga0157372_100609695 187
209 3300013308 Ga0157375_10197615 Ga0157375_101976154 187
210 3300014969 Ga0157376_10679663 Ga0157376_106796632 187
211 3300017792 Ga0163161_10001536 Ga0163161_100015366 187
212 3300020070 Ga0206356_11714513 Ga0206356_117145131 187
213 3300020075 Ga0206349_1661292 Ga0206349_16612921 187
214 3300020077 Ga0206351_10199080 Ga0206351_101990801 187
215 3300020080 Ga0206350_11588056 Ga0206350_115880561 187
216 3300020081 Ga0206354_10475073 Ga0206354_104750731 187
217 3300020082 Ga0206353_11368673 Ga0206353_113686731 187
218 3300021361 Ga0213872_10006453 Ga0213872_100064538 187
219 3300022467 Ga0224712_10204632 Ga0224712_102046322 187
220 3300025231 Ga0207427_100090 Ga0207427_10009082 187
221 3300025233 Ga0209437_100034 Ga0209437_100034291 187
222 3300025233 Ga0209437_100070 Ga0209437_10007036 187
223 3300025250 Ga0209026_1001326 Ga0209026_100132617 187
224 3300025250 Ga0209026_1002750 Ga0209026_10027502 187
225 3300025250 Ga0209026_1008439 Ga0209026_10084393 187
226 3300025258 Ga0209129_1005705 Ga0209129_10057056 187
227 3300025261 Ga0209233_1000038 Ga0209233_1000038291 187
228 3300025261 Ga0209233_1021326 Ga0209233_10213262 187
229 3300025261 Ga0209233_1022416 Ga0209233_10224162 187
230 3300025272 Ga0209455_1001458 Ga0209455_10014583 187
231 3300025904 Ga0207647_10000062 Ga0207647_1000006229 187
232 3300025904 Ga0207647_10000263 Ga0207647_1000026320 187
233 3300025904 Ga0207647_10172177 Ga0207647_101721772 187
234 3300025907 Ga0207645_10000224 Ga0207645_1000022413 187
235 3300025909 Ga0207705_10000080 Ga0207705_1000008024 187
236 3300025909 Ga0207705_10162803 Ga0207705_101628032 187
237 3300025911 Ga0207654_10002041 Ga0207654_1000204112 187
238 3300025911 Ga0207654_10006843 Ga0207654_100068438 187
239 3300025911 Ga0207654_10333985 Ga0207654_103339851 187
240 3300025912 Ga0207707_10004744 Ga0207707_100047448 187
241 3300025913 Ga0207695_10000019 Ga0207695_10000019110 187
242 3300025913 Ga0207695_10007270 Ga0207695_1000727011 187
243 3300025913 Ga0207695_10017772 Ga0207695_1001777210 187
244 3300025913 Ga0207695_10019865 Ga0207695_100198654 187
245 3300025913 Ga0207695_10096864 Ga0207695_100968642 187
246 3300025913 Ga0207695_10103139 Ga0207695_101031392 187
247 3300025913 Ga0207695_10495880 Ga0207695_104958802 187
248 3300025914 Ga0207671_10000515 Ga0207671_1000051558 187
249 3300025914 Ga0207671_10006722 Ga0207671_100067222 187
250 3300025914 Ga0207671_10009710 Ga0207671_100097107 187
251 3300025914 Ga0207671_10040409 Ga0207671_100404093 187
252 3300025914 Ga0207671_10158759 Ga0207671_101587592 187
253 3300025914 Ga0207671_10363129 Ga0207671_103631292 187
254 3300025914 Ga0207671_10782060 Ga0207671_107820601 187
255 3300025917 Ga0207660_10015516 Ga0207660_100155162 187
256 3300025919 Ga0207657_10062250 Ga0207657_100622501 187
257 3300025921 Ga0207652_10084388 Ga0207652_100843882 187
258 3300025921 Ga0207652_10279874 Ga0207652_102798742 187
259 3300025924 Ga0207694_10086210 Ga0207694_100862103 187
260 3300025924 Ga0207694_10424507 Ga0207694_104245072 187
261 3300025931 Ga0207644_10023853 Ga0207644_100238533 187
262 3300025932 Ga0207690_10004758 Ga0207690_100047582 187
263 3300025932 Ga0207690_10199741 Ga0207690_101997412 187
264 3300025933 Ga0207706_10000851 Ga0207706_100008516 187
265 3300025934 Ga0207686_10085235 Ga0207686_100852351 187
266 3300025938 Ga0207704_10000037 Ga0207704_1000003756 187
267 3300025940 Ga0207691_10251881 Ga0207691_102518813 187
268 3300025949 Ga0207667_10000020 Ga0207667_10000020315 187
269 3300025949 Ga0207667_10004885 Ga0207667_1000488514 187
270 3300025949 Ga0207667_10056554 Ga0207667_100565541 187
271 3300025949 Ga0207667_10066477 Ga0207667_100664774 187
272 3300025949 Ga0207667_10092191 Ga0207667_100921915 187
273 3300025949 Ga0207667_10488934 Ga0207667_104889342 187
274 3300025949 Ga0207667_10573210 Ga0207667_105732102 187
275 3300025960 Ga0207651_10025431 Ga0207651_100254313 187
276 3300026023 Ga0207677_10003306 Ga0207677_100033066 187
277 3300026041 Ga0207639_10011268 Ga0207639_100112685 187
278 3300026041 Ga0207639_10110694 Ga0207639_101106943 187
279 3300026041 Ga0207639_10340601 Ga0207639_103406012 187
280 3300026041 Ga0207639_10535971 Ga0207639_105359712 187
281 3300026067 Ga0207678_10055038 Ga0207678_100550383 187
282 3300026067 Ga0207678_10624189 Ga0207678_106241891 187
283 3300026078 Ga0207702_10000273 Ga0207702_1000027318 187
284 3300026078 Ga0207702_10968711 Ga0207702_109687112 187
285 3300026089 Ga0207648_10000241 Ga0207648_1000024160 187
286 3300026116 Ga0207674_10558504 Ga0207674_105585041 187
287 3300026116 Ga0207674_10583073 Ga0207674_105830732 187
288 3300026121 Ga0207683_10006368 Ga0207683_1000636813 187
289 3300026142 Ga0207698_10004698 Ga0207698_100046983 187
290 3300026142 Ga0207698_10368328 Ga0207698_103683282 187
291 3300026142 Ga0207698_10876523 Ga0207698_108765232 187
292 3300026142 Ga0207698_11413629 Ga0207698_114136291 187
293 3300028379 Ga0268266_10000095 Ga0268266_1000009571 187
294 3300028794 Ga0307515_10035457 Ga0307515_100354572 187
295 3300028794 Ga0307515_10076860 Ga0307515_100768602 187
296 3300028794 Ga0307515_10312592 Ga0307515_103125922 187
297 3300028800 Ga0265338_10033318 Ga0265338_100333184 187
298 3300031548 Ga0307408_100002364 Ga0307408_1000023646 187
299 3300032004 Ga0307414_10574994 Ga0307414_105749941 187
300 3300033179 Ga0307507_10001815 Ga0307507_1000181549 187
301 3300033180 Ga0307510_10003047 Ga0307510_1000304726 187
302 3300037312 Ga0395899_0000283 Ga0395899_0000283_28143_28706 187
303 3300037418 Ga0395900_0001938 Ga0395900_0001938_10304_10867 187
304 3300037418 Ga0395900_0177652 Ga0395900_0177652_1457_2020 187
305 3300037471 Ga0395905_0006027 Ga0395905_0006027_6412_6975 187
306 3300038443 Ga0395901_0846859 Ga0395901_0846859_266_829 187
307 3300039447 Ga0436361_0112067 Ga0436361_0112067_2617_3180 187
308 3300042005 Ga0439448_0006684 Ga0439448_0006684_2088_2651 187
309 3300044656 Ga0466969_0015787 Ga0466969_0015787_2926_3489 187
310 3300044684 Ga0466966_0044751 Ga0466966_0044751_2248_2811 187
311 3300044693 Ga0466961_0078066 Ga0466961_0078066_1154_1717 187
312 3300045049 Ga0466959_0163171 Ga0466959_0163171_572_1135 187
313 3300045836 Ga0466958_0017675 Ga0466958_0017675_2765_3328 187
314 3300046454 Ga0495592_0190679 Ga0495592_0190679_253_816 187
315 3300046461 Ga0495641_0290823 Ga0495641_0290823_143_706 187
316 3300046462 Ga0495651_0277989 Ga0495651_0277989_395_958 187
317 3300046492 Ga0495585_0001451 Ga0495585_0001451_2897_3460 187
318 3300046492 Ga0495585_0006896 Ga0495585_0006896_1417_1980 187
319 3300046500 Ga0495596_0057227 Ga0495596_0057227_317_880 187
320 3300046507 Ga0495606_0000241 Ga0495606_0000241_59102_59665 187
321 3300046507 Ga0495606_0065061 Ga0495606_0065061_653_1216 187
322 3300046507 Ga0495606_0078745 Ga0495606_0078745_902_1465 187
323 3300046518 Ga0495631_0075640 Ga0495631_0075640_324_887 187
324 3300046518 Ga0495631_0088354 Ga0495631_0088354_562_1125 187
325 3300046519 Ga0495632_0077341 Ga0495632_0077341_740_1303 187
326 3300046523 Ga0495644_0014482 Ga0495644_0014482_436_999 187
327 3300046524 Ga0495648_0008221 Ga0495648_0008221_5734_6297 187
328 3300046524 Ga0495648_0026870 Ga0495648_0026870_787_1350 187
329 3300046529 Ga0495652_0059748 Ga0495652_0059748_516_1079 187
330 3300046529 Ga0495652_0269293 Ga0495652_0269293_311_874 187
331 3300046529 Ga0495652_0345399 Ga0495652_0345399_256_819 187
332 3300046529 Ga0495652_0351124 Ga0495652_0351124_102_665 187
333 3300046530 Ga0495654_0106003 Ga0495654_0106003_437_1000 187
334 3300046538 Ga0495609_0001800 Ga0495609_0001800_10004_10567 187
335 3300046557 Ga0495622_0073676 Ga0495622_0073676_625_1188 187
336 3300046558 Ga0495633_0000027 Ga0495633_0000027_117429_117992 187
337 3300046616 Ga0495668_0000010 Ga0495668_0000010_5618_6181 187
338 3300046660 Ga0495625_0000381 Ga0495625_0000381_25407_25970 187
339 3300046660 Ga0495625_0003720 Ga0495625_0003720_6378_6941 187
340 3300046660 Ga0495625_0025624 Ga0495625_0025624_2015_2578 187
341 3300046660 Ga0495625_0477449 Ga0495625_0477449_67_630 187
342 3300046665 Ga0495661_0003579 Ga0495661_0003579_7366_7929 187
343 3300046665 Ga0495661_0014257 Ga0495661_0014257_1279_1842 187
344 3300046665 Ga0495661_0039155 Ga0495661_0039155_1268_1831 187
345 3300046683 Ga0495658_0066059 Ga0495658_0066059_674_1237 187
346 3300046692 Ga0495671_0245765 Ga0495671_0245765_48_611 187
347 3300046694 Ga0495649_0093389 Ga0495649_0093389_485_1048 187
348 3300046809 Ga0495600_0203663 Ga0495600_0203663_243_806 187
349 3300047445 Ga0495677_0035956 Ga0495677_0035956_66_629 187
350 3300047472 Ga0495686_0002723 Ga0495686_0002723_11438_12001 187
351 3300047472 Ga0495686_0281436 Ga0495686_0281436_32_595 187
352 3300048089 Ga0495614_0082404 Ga0495614_0082404_738_1301 187
353 3300049459 Ga0495678_028755 Ga0495678_028755_1375_1938 187
354 3300049460 Ga0495682_0090918 Ga0495682_0090918_85_648 187
355 3300050493 nmdc:mga0k408_1219_c1 nmdc:mga0k408_1219_c1_13252_13815 187
356 3300050493 nmdc:mga0k408_128619_c1 nmdc:mga0k408_128619_c1_76_639 187
357 3300053080 Ga0500635_0000332 Ga0500635_0000332_11231_11794 187
358 3300053098 Ga0500650_0289683 Ga0500650_0289683_26_589 187
359 3300053122 Ga0500608_002178 Ga0500608_002178_5853_6416 187
360 3300053122 Ga0500608_086204 Ga0500608_086204_449_1012 187
361 3300053130 Ga0500642_0044061 Ga0500642_0044061_750_1313 187
362 3300053138 Ga0500564_044469 Ga0500564_044469_503_1066 187
363 3300053156 Ga0500622_0001023 Ga0500622_0001023_22584_23147 187
364 3300053157 Ga0500624_000823 Ga0500624_000823_2367_2930 187

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02622

DUF179

Uncharacterized ACR, COG1678

23

176

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ew0-assembly1.cif.gz_A x-ray crystal structure of protein q6ff54 from acinetobacter sp. adp1. northeast structural genomics consortium target asr1. 0.8716 9 172
2haf-assembly1.cif.gz_A crystal structure of a putative translation repressor from vibrio cholerae 0.8655 4 171
2ew0-assembly1.cif.gz_A x-ray crystal structure of protein q6ff54 from acinetobacter sp. adp1. northeast structural genomics consortium target asr1. 0.8158 9 172
2hrx-assembly1.cif.gz_A x-ray crystal structure of protein dip2367 from corynebacterium diphtheriae. northeast structural genomics consortium target cdr13. 0.8097 12 180
2haf-assembly1.cif.gz_A crystal structure of a putative translation repressor from vibrio cholerae 0.7868 4 171
ID Description Score Start End Superfamily
2aj2A01 Alpha Beta;3-Layer(aba) Sandwich;VC0467-like;VC0467-like 0.891 12 171 3.40.1740.10
af_P0A8W5_4_171_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8603 12 165 3.40.50.1000
2ew0A00 Alpha Beta;3-Layer(aba) Sandwich;VC0467-like;VC0467-like 0.8556 9 172 3.40.1740.10
af_A0A1D6G7F1_154_345_3.40.1740.10 Alpha Beta;3-Layer(aba) Sandwich;VC0467-like;VC0467-like 0.847 9 183 3.40.1740.10
af_Q54HU6_278_477_3.40.1740.10 Alpha Beta;3-Layer(aba) Sandwich;VC0467-like;VC0467-like 0.8379 10 165 3.40.1740.10
ID Description Score Start End GO Terms
AF-A0A4Q6DN81-F1-model_v4 YqgE/AlgH family protein 0.9751 1 148 GO:0005829
AF-A0A2W5FEI5-F1-model_v4 Uncharacterized protein 0.9696 9 187 GO:0005829
AF-A0A4Q6DN81-F1-model_v4 YqgE/AlgH family protein 0.9686 1 148 GO:0005829
AF-A0A1P9X3Q7-F1-model_v4 UPF0301 protein AWR27_01375 0.968 9 187
AF-A0A258YH62-F1-model_v4 UPF0301 protein B7Y11_12735 0.9657 12 187 GO:0005829

Feature Viewer

pLDDT pTM Quality
88.41 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map