F423345

General Info

Members Datasets Scaffolds Average Seq Length
364 241 728 243

Family's Representative Sequence

Representative Sequence 3300025917|Ga0207660_10147256|Ga0207660_101472562
Length 278
Sequence MNMPSFRGGSLAVGNDKPTLRTVPLDIQSRFRLDRRTALVTGAGRGIGRACAFALAQAGAEVWLAARTREEIEQAASEIRAAGGRAHAVVGDVTDTQGFREIVSAIPVLDVLVNNAGSNIPEPFVEVSEAHLDQLLSLNVRAAFLVAQAVARKMLEGKTRGGAIINMSSQMGHVGAVNRTVYCLTKHALEGLTKAMALELAPHGIRVVSVAPTFIETPMYRQMREQKPEFAKWVHERIPAGQVGQPEDVAAAVVFAASPAASLVTGSSLMVDGGWTAQ

Samples

Sample ID Description Type Environment
1 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
58 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
61 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
62 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
89 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
90 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
91 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
92 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
93 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
94 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
95 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
96 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
97 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
98 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
99 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
100 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
101 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
102 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
103 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
104 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
105 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
106 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
107 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
108 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
109 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
110 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
111 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
112 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
113 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
116 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
117 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
118 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
119 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
120 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
121 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
122 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
123 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
124 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
125 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
126 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
127 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
128 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
129 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
130 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
131 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
132 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
133 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
134 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
135 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
136 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
137 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
138 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
139 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
140 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
141 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
142 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
143 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
144 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
145 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
146 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
147 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
148 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
149 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
150 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
151 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
152 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
153 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
154 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
155 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
156 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
157 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
158 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
159 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
160 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
161 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
162 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
163 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
164 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
165 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
166 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
167 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
168 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
169 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
170 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
171 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
172 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
173 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
174 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
175 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
176 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
177 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
178 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
179 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
180 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
181 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
182 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
183 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
184 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
185 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
186 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
187 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
188 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
189 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
190 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
191 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
192 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
193 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
194 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
195 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
196 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
197 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
198 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
199 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
212 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
213 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
214 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
215 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
216 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
217 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
218 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
219 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
220 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
221 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
222 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
223 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
224 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
225 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
226 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
227 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
228 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
229 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
230 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
231 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
232 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
233 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
234 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
235 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
236 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
237 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
238 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
239 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
240 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
241 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.35
Metatranscriptomes 0
Isolates 1.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.27
Nodule 0.82
Rhizoplane 0.27
Rhizosphere 92.31
Stem 0
Stem Tuber 0
Unclassified 1.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207660_10147256 3300025917 Bacteria 1806
2 rootH1_10170393 3300003323 Bacteria 1836
3 Ga0065714_10064475 3300005288 Bacteria 58122
4 Ga0070683_100337947 3300005329 Bacteria 1434
5 Ga0070683_100404168 3300005329 Bacteria 1303
6 Ga0070670_100572180 3300005331 Bacteria 1009
7 Ga0070680_100067198 3300005336 Bacteria 2940
8 Ga0070682_100090827 3300005337 Bacteria 1998
9 Ga0068868_100109375 3300005338 Bacteria 2244
10 Ga0070660_100100023 3300005339 Bacteria 2296
11 Ga0070689_100438044 3300005340 Bacteria 1110
12 Ga0070692_10040092 3300005345 Bacteria 2394
13 Ga0070671_100539672 3300005355 Bacteria 1005
14 Ga0070673_100899020 3300005364 Bacteria 821
15 Ga0070688_100247446 3300005365 Bacteria 1268
16 Ga0070709_10265403 3300005434 Bacteria 1242
17 Ga0070709_10316809 3300005434 Bacteria 1143
18 Ga0070714_100370837 3300005435 Bacteria 1348
19 Ga0070714_100419323 3300005435 Bacteria 1268
20 Ga0070713_100015123 3300005436 Bacteria 5752
21 Ga0070713_100483219 3300005436 Bacteria 1167
22 Ga0070711_100154128 3300005439 Bacteria 1735
23 Ga0070711_100244907 3300005439 Bacteria 1403
24 Ga0070700_100163638 3300005441 Bacteria 1534
25 Ga0070678_100228495 3300005456 Bacteria 1550
26 Ga0070681_10031256 3300005458 Bacteria 5344
27 Ga0070681_10077740 3300005458 Bacteria 3276
28 Ga0068867_100621196 3300005459 Bacteria 945
29 Ga0070707_100214173 3300005468 Bacteria 1877
30 Ga0070698_100113097 3300005471 Bacteria 2680
31 Ga0070679_100030916 3300005530 Bacteria 5289
32 Ga0070679_100484024 3300005530 Bacteria 1182
33 Ga0070684_100352812 3300005535 Bacteria 1353
34 Ga0070684_100375280 3300005535 Bacteria 1309
35 Ga0070696_100036815 3300005546 Bacteria 3375
36 Ga0070665_100456914 3300005548 Bacteria 1287
37 Ga0070704_100193979 3300005549 Bacteria 1635
38 Ga0068855_100042007 3300005563 Bacteria 5418
39 Ga0068855_100563460 3300005563 Bacteria 1232
40 Ga0068854_100364965 3300005578 Bacteria 1186
41 Ga0068856_100763892 3300005614 Bacteria 987
42 Ga0068852_100060681 3300005616 Bacteria 3283
43 Ga0068870_10094907 3300005840 Bacteria 1675
44 Ga0068863_100412936 3300005841 Bacteria 1321
45 Ga0068858_100051067 3300005842 Bacteria 3826
46 Ga0081540_1000804 3300005983 Bacteria 28834
47 Ga0081539_10004739 3300005985 Bacteria 14710
48 Ga0081539_10006712 3300005985 Bacteria 10849
49 Ga0081539_10024181 3300005985 Bacteria 3951
50 Ga0070712_100238145 3300006175 Bacteria 1449
51 Ga0075428_100002012 3300006844 Bacteria 21927
52 Ga0075428_100006970 3300006844 Bacteria 12535
53 Ga0075431_100470172 3300006847 Bacteria 1251
54 Ga0075433_10383803 3300006852 Bacteria 1240
55 Ga0075434_100003524 3300006871 Bacteria 13977
56 Ga0075434_100017311 3300006871 Bacteria 6939
57 Ga0075429_100004649 3300006880 Bacteria 11807
58 Ga0075429_100025409 3300006880 Bacteria 5140
59 Ga0075436_100003296 3300006914 Bacteria 11061
60 Ga0075436_100027365 3300006914 Bacteria 3925
61 Ga0075436_100218605 3300006914 Bacteria 1352
62 Ga0105244_10004096 3300009036 Bacteria 10171
63 Ga0105240_10021938 3300009093 Bacteria 8480
64 Ga0105240_10241575 3300009093 Bacteria 2093
65 Ga0105240_10270907 3300009093 Bacteria 1955
66 Ga0111539_10012011 3300009094 Bacteria 10858
67 Ga0111539_10012787 3300009094 Bacteria 10502
68 Ga0111539_10028365 3300009094 Bacteria 6831
69 Ga0111539_10062924 3300009094 Bacteria 4391
70 Ga0111539_10811165 3300009094 Bacteria 1089
71 Ga0111539_10828716 3300009094 Bacteria 1076
72 Ga0114129_10182845 3300009147 Bacteria 2851
73 Ga0114129_10567921 3300009147 Bacteria 1473
74 Ga0105243_10043023 3300009148 Bacteria 3539
75 Ga0099796_10011937 3300010159 Bacteria 2438
76 Ga0105246_10178091 3300011119 Bacteria 1634
77 Ga0157373_10010083 3300013100 Bacteria 6960
78 Ga0157369_10570636 3300013105 Bacteria 1169
79 Ga0163162_10321410 3300013306 Bacteria 1680
80 Ga0157372_10473472 3300013307 Bacteria 1460
81 Ga0157377_10075173 3300014745 Bacteria 1962
82 Ga0182005_1037716 3300015265 Bacteria 1315
83 Ga0163161_10000272 3300017792 Bacteria 45332
84 Ga0213874_10057415 3300021377 Bacteria 1211
85 Ga0213876_10220361 3300021384 Bacteria 1009
86 Ga0207655_1006061 3300025728 Bacteria 8076
87 Ga0207643_10090949 3300025908 Bacteria 1779
88 Ga0207705_10194089 3300025909 Bacteria 1536
89 Ga0207707_10003517 3300025912 Bacteria 13869
90 Ga0207695_10247684 3300025913 Bacteria 1682
91 Ga0207695_10476617 3300025913 Bacteria 1130
92 Ga0207693_10142410 3300025915 Bacteria 1885
93 Ga0207660_10120087 3300025917 Bacteria 1990
94 Ga0207662_10116745 3300025918 Bacteria 1669
95 Ga0207657_10048854 3300025919 Bacteria 3691
96 Ga0207652_10462071 3300025921 Bacteria 1144
97 Ga0207681_10003462 3300025923 Bacteria 9834
98 Ga0207650_10506916 3300025925 Bacteria 1009
99 Ga0207664_10563592 3300025929 Bacteria 1022
100 Ga0207709_10009487 3300025935 Bacteria 5355
101 Ga0207661_10522117 3300025944 Bacteria 1086
102 Ga0207651_10862725 3300025960 Bacteria 805
103 Ga0207640_10182266 3300025981 Bacteria 1575
104 Ga0207658_10171317 3300025986 Bacteria 1789
105 Ga0207708_10211549 3300026075 Bacteria 1550
106 Ga0207708_10255782 3300026075 Bacteria 1412
107 Ga0207702_10188482 3300026078 Bacteria 1904
108 Ga0207702_10505405 3300026078 Bacteria 1179
109 Ga0207641_10941098 3300026088 Bacteria 859
110 Ga0207648_10265623 3300026089 Bacteria 1532
111 Ga0207675_100029069 3300026118 Bacteria 5151
112 Ga0207698_10000721 3300026142 Bacteria 19169
113 Ga0209967_1001288 3300027364 Bacteria 3214
114 Ga0210000_1003635 3300027462 Bacteria 2225
115 Ga0209995_1005363 3300027471 Bacteria 2061
116 Ga0207428_10020500 3300027907 Bacteria 5615
117 Ga0207428_10489817 3300027907 Unclassified 894
118 Ga0265328_10045266 3300031239 Bacteria 1618
119 Ga0265331_10156143 3300031250 Bacteria 1035
120 Ga0307413_10325051 3300031824 Bacteria 1177
121 Ga0307416_100531910 3300032002 Bacteria 1246
122 Ga0373948_0014016 3300034817 Bacteria 1456
123 Ga0373926_0045549 3300035083 Bacteria 1572
124 Ga0373944_0015898 3300035089 Bacteria 2115
125 Ga0373949_0044555 3300035090 Bacteria 1101
126 Ga0373923_0025241 3300035111 Bacteria 2354
127 Ga0373923_0028184 3300035111 Bacteria 2245
128 Ga0373932_0021247 3300035112 Bacteria 1712
129 Ga0373932_0120907 3300035112 Bacteria 873
130 Ga0373953_0063047 3300035117 Bacteria 1518
131 Ga0373954_0151465 3300035118 Bacteria 1133
132 Ga0373956_0053414 3300035119 Bacteria 1819
133 Ga0373957_0038247 3300035120 Bacteria 1796
134 Ga0373957_0044175 3300035120 Bacteria 1685
135 Ga0373943_0248496 3300035170 Unclassified 998
136 Ga0373946_0008548 3300035171 Bacteria 3758
137 Ga0373946_0140910 3300035171 Bacteria 1118
138 Ga0373955_0014660 3300035172 Bacteria 3819
139 Ga0316574_0138215 3300035398 Bacteria 1569
140 Ga0373924_0229447 3300035410 Bacteria 821
141 Ga0373931_0097493 3300035691 Bacteria 1649
142 Ga0373931_0107571 3300035691 Bacteria 1577
143 Ga0373935_0102890 3300035692 Bacteria 1885
144 Ga0373927_0001741 3300035695 Bacteria 16252
145 Ga0373927_0081245 3300035695 Bacteria 2100
146 Ga0373933_0020957 3300035724 Bacteria 3707
147 Ga0373933_0170878 3300035724 Bacteria 1383
148 Ga0373947_0421788 3300035725 Bacteria 902
149 Ga0373937_0016558 3300036401 Bacteria 6547
150 Ga0373937_0271740 3300036401 Bacteria 1600
151 Ga0373937_0284263 3300036401 Bacteria 1563
152 Ga0373937_0293387 3300036401 Bacteria 1536
153 Ga0373925_0001056 3300037068 Bacteria 24915
154 Ga0373925_0029327 3300037068 Bacteria 4037
155 Ga0373925_0104252 3300037068 Bacteria 2183
156 Ga0373925_0425383 3300037068 Bacteria 1085
157 Ga0373925_0693133 3300037068 Unclassified 840
158 Ga0436364_0121548 3300037853 Bacteria 1039
159 Ga0436364_0623699 3300037853 Bacteria 7969
160 Ga0395901_0620842 3300038443 Bacteria 1088
161 Ga0436365_0071923 3300039437 Bacteria 1143
162 Ga0436365_0590691 3300039437 Bacteria 1469
163 Ga0436365_0954381 3300039437 Bacteria 1351
164 Ga0436365_0962193 3300039437 Bacteria 2157
165 Ga0436365_1166961 3300039437 Bacteria 994
166 Ga0436365_1269291 3300039437 Bacteria 1336
167 Ga0436365_1450489 3300039437 Bacteria 812
168 Ga0436360_1243695 3300039438 Bacteria 1149
169 Ga0436360_1277266 3300039438 Bacteria 1118
170 Ga0436361_0117286 3300039447 Bacteria 2323
171 Ga0436361_0445819 3300039447 Bacteria 938
172 Ga0436363_0015748 3300039450 Bacteria 1497
173 Ga0436363_0884287 3300039450 Bacteria 1142
174 Ga0436363_1383163 3300039450 Bacteria 922
175 Ga0436363_1611309 3300039450 Bacteria 937
176 Ga0436362_0847897 3300039453 Bacteria 1792
177 Ga0436362_1143098 3300039453 Bacteria 2370
178 Ga0436362_1276891 3300039453 Bacteria 1504
179 Ga0439463_002343 3300042016 Bacteria 4825
180 Ga0439435_0013507 3300042436 Bacteria 1998
181 Ga0451577_0436700 3300042876 Bacteria 1189
182 Ga0453683_0001471 3300044673 Bacteria 20249
183 Ga0466965_0025737 3300044683 Bacteria 2850
184 Ga0466961_0178565 3300044693 Bacteria 1319
185 Ga0466963_0076856 3300044694 Bacteria 2255
186 Ga0453684_0354608 3300044712 Unclassified 1653
187 Ga0466960_0000110 3300044901 Bacteria 27421
188 Ga0451576_0007077 3300045051 Bacteria 13550
189 Ga0451576_0014447 3300045051 Bacteria 8786
190 Ga0451576_0302247 3300045051 Bacteria 1674
191 Ga0466958_0122370 3300045836 Bacteria 1630
192 Ga0466967_0015127 3300045976 Bacteria 6040
193 Ga0466967_1095208 3300045976 Bacteria 794
194 Ga0495617_001550 3300046452 Bacteria 9957
195 Ga0495617_021913 3300046452 Bacteria 2159
196 Ga0495617_047547 3300046452 Bacteria 1428
197 Ga0495627_000014 3300046453 Bacteria 326114
198 Ga0495591_007945 3300046458 Bacteria 4416
199 Ga0495651_0160838 3300046462 Bacteria 1609
200 Ga0495650_0000621 3300046471 Bacteria 47774
201 Ga0495650_0000943 3300046471 Bacteria 33667
202 Ga0495650_0014612 3300046471 Bacteria 4070
203 Ga0495580_0013053 3300046472 Bacteria 6358
204 Ga0495580_0022032 3300046472 Bacteria 4695
205 Ga0495580_0082726 3300046472 Unclassified 2237
206 Ga0495580_0384999 3300046472 Bacteria 947
207 Ga0495605_0000091 3300046474 Bacteria 115482
208 Ga0495605_0001470 3300046474 Bacteria 15393
209 Ga0495605_0026441 3300046474 Bacteria 3017
210 Ga0495662_0030853 3300046476 Bacteria 2588
211 Ga0495662_0033632 3300046476 Bacteria 2477
212 Ga0495662_0035106 3300046476 Bacteria 2420
213 Ga0495584_0002658 3300046491 Bacteria 10059
214 Ga0495584_0260496 3300046491 Bacteria 881
215 Ga0495594_0113479 3300046499 Bacteria 1529
216 Ga0495607_0000018 3300046501 Bacteria 167673
217 Ga0495607_0219136 3300046501 Bacteria 931
218 Ga0495583_0001205 3300046506 Bacteria 27737
219 Ga0495583_0004935 3300046506 Bacteria 9266
220 Ga0495606_0000608 3300046507 Bacteria 56665
221 Ga0495606_0000956 3300046507 Bacteria 42400
222 Ga0495606_0002361 3300046507 Bacteria 22160
223 Ga0495606_0007597 3300046507 Bacteria 9646
224 Ga0495610_0004149 3300046512 Bacteria 10840
225 Ga0495618_0029304 3300046514 Bacteria 3434
226 Ga0495618_0059271 3300046514 Bacteria 2426
227 Ga0495620_0000678 3300046515 Bacteria 21047
228 Ga0495620_0013668 3300046515 Bacteria 4150
229 Ga0495628_0093263 3300046516 Bacteria 2329
230 Ga0495630_0193120 3300046517 Bacteria 1553
231 Ga0495631_0000493 3300046518 Bacteria 26285
232 Ga0495631_0003728 3300046518 Bacteria 8305
233 Ga0495632_0000337 3300046519 Bacteria 44677
234 Ga0495632_0014706 3300046519 Bacteria 4416
235 Ga0495632_0016576 3300046519 Bacteria 4092
236 Ga0495632_0017220 3300046519 Bacteria 3996
237 Ga0495632_0148198 3300046519 Bacteria 1086
238 Ga0495637_0000403 3300046520 Bacteria 31986
239 Ga0495637_0000408 3300046520 Bacteria 31807
240 Ga0495637_0008007 3300046520 Bacteria 5206
241 Ga0495643_0016591 3300046522 Bacteria 4325
242 Ga0495648_0033428 3300046524 Bacteria 3357
243 Ga0495654_0000919 3300046530 Bacteria 21895
244 Ga0495654_0005033 3300046530 Bacteria 7747
245 Ga0495665_0004686 3300046531 Bacteria 7373
246 Ga0495640_0029559 3300046533 Bacteria 3933
247 Ga0495640_0069066 3300046533 Bacteria 2377
248 Ga0495586_0006035 3300046535 Bacteria 6477
249 Ga0495586_0101473 3300046535 Bacteria 1597
250 Ga0495586_0185880 3300046535 Bacteria 1176
251 Ga0495598_0066393 3300046537 Bacteria 1125
252 Ga0495609_0009331 3300046538 Bacteria 4752
253 Ga0495597_0021714 3300046542 Bacteria 2984
254 Ga0495667_0009304 3300046559 Bacteria 6661
255 Ga0495667_0157773 3300046559 Unclassified 1460
256 Ga0495668_0008388 3300046616 Bacteria 6458
257 Ga0495611_0017270 3300046648 Bacteria 3084
258 Ga0495625_0000185 3300046660 Bacteria 97863
259 Ga0495635_0134381 3300046663 Bacteria 1686
260 Ga0495659_0016653 3300046664 Bacteria 2429
261 Ga0495661_0000088 3300046665 Bacteria 111782
262 Ga0495661_0001688 3300046665 Bacteria 17921
263 Ga0495661_0079718 3300046665 Bacteria 1891
264 Ga0495646_0112031 3300046680 Bacteria 1553
265 Ga0495647_0037399 3300046681 Bacteria 1831
266 Ga0495613_0205954 3300046689 Bacteria 1385
267 Ga0495624_0152731 3300046690 Bacteria 1412
268 Ga0495670_0013112 3300046691 Bacteria 4076
269 Ga0495671_0046724 3300046692 Bacteria 2164
270 Ga0495649_0028063 3300046694 Bacteria 3120
271 Ga0495660_0002562 3300046810 Bacteria 11584
272 Ga0495581_0045174 3300047315 Bacteria 2547
273 Ga0495672_0004012 3300047320 Bacteria 12312
274 Ga0495676_0000160 3300047321 Bacteria 51908
275 Ga0495680_0037647 3300047322 Bacteria 3874
276 Ga0495683_0116580 3300047323 Bacteria 1270
277 Ga0495679_000477 3300047446 Bacteria 28914
278 Ga0495673_0002805 3300047469 Bacteria 11898
279 Ga0495673_0005495 3300047469 Bacteria 7656
280 Ga0495673_0050549 3300047469 Bacteria 1823
281 Ga0495681_0006813 3300047470 Bacteria 7431
282 Ga0495681_0164512 3300047470 Bacteria 922
283 Ga0495684_0354928 3300047471 Bacteria 1040
284 Ga0495686_0014843 3300047472 Bacteria 5349
285 Ga0495626_0000125 3300048091 Bacteria 99451
286 Ga0496106_0461208 3300048909 Bacteria 1021
287 Ga0496117_0005625 3300048920 Bacteria 13085
288 Ga0496117_0109568 3300048920 Bacteria 1724
289 Ga0496118_0001295 3300048921 Bacteria 38114
290 Ga0496121_0008828 3300048924 Bacteria 11738
291 Ga0496122_0009373 3300048925 Bacteria 10334
292 Ga0496124_0000580 3300048927 Bacteria 61729
293 Ga0495678_000747 3300049459 Bacteria 29499
294 Ga0495678_009557 3300049459 Bacteria 4787
295 Ga0495682_0000087 3300049460 Bacteria 80534
296 Ga0501300_040450 3300049523 Bacteria 702
297 Ga0501034_0015330 3300049571 Bacteria 7878
298 Ga0501034_0295983 3300049571 Bacteria 1556
299 Ga0501036_0261636 3300049572 Bacteria 1449
300 Ga0501036_0343013 3300049572 Bacteria 1247
301 Ga0501037_0093069 3300049573 Bacteria 2180
302 Ga0501038_0050546 3300049574 Bacteria 3591
303 Ga0501039_0045155 3300049575 Bacteria 3403
304 Ga0501040_0010508 3300049576 Bacteria 6055
305 Ga0501040_0029016 3300049576 Bacteria 3733
306 Ga0501041_0004141 3300049577 Bacteria 8392
307 Ga0501042_0020391 3300049578 Bacteria 4614
308 Ga0501043_0277092 3300049579 Bacteria 1286
309 Ga0501046_0010523 3300049580 Bacteria 7935
310 Ga0501046_0026608 3300049580 Bacteria 4725
311 Ga0501046_0029994 3300049580 Bacteria 4418
312 Ga0501047_0059216 3300049581 Bacteria 3698
313 Ga0501047_0246071 3300049581 Bacteria 1637
314 Ga0501048_0286285 3300049582 Bacteria 1172
315 Ga0501068_0182167 3300049584 Bacteria 1328
316 Ga0501071_0005554 3300049587 Bacteria 8122
317 Ga0501071_0096056 3300049587 Bacteria 2181
318 Ga0501072_0086882 3300049588 Bacteria 2481
319 Ga0501072_0384669 3300049588 Bacteria 1113
320 Ga0501075_0004393 3300049591 Bacteria 9539
321 Ga0501076_0019433 3300049592 Bacteria 5194
322 Ga0501076_0026046 3300049592 Bacteria 4526
323 Ga0501077_0002820 3300049593 Bacteria 10413
324 Ga0501077_0118238 3300049593 Bacteria 1680
325 Ga0501079_0020959 3300049741 Bacteria 4995
326 Ga0501080_0067161 3300049742 Bacteria 3335
327 Ga0501080_0122500 3300049742 Bacteria 2409
328 Ga0501081_0011403 3300049743 Bacteria 5815
329 Ga0501081_0219137 3300049743 Bacteria 1384
330 Ga0501083_0074510 3300049744 Bacteria 2255
331 Ga0501045_0000392 3300049824 Bacteria 26577
332 nmdc:mga05p37_30426_c1 3300050507 Bacteria 6587
333 nmdc:mga09592_14450_c1 3300050508 Bacteria 6444
334 nmdc:mga09592_392510_c1 3300050508 Bacteria 1200
335 nmdc:mga0qj67_295231_c1 3300050509 Bacteria 1313
336 nmdc:mga0qj67_450843_c1 3300050509 Bacteria 1036
337 nmdc:mga08y16_105742_c1 3300050511 Bacteria 2930
338 nmdc:mga08y16_123758_c1 3300050511 Bacteria 2691
339 nmdc:mga08y16_495449_c1 3300050511 Bacteria 1242
340 nmdc:mga08y16_72164_c1 3300050511 Bacteria 3598
341 nmdc:mga0n895_1531_c1 3300050512 Bacteria 17366
342 nmdc:mga0n895_488440_c1 3300050512 Bacteria 1241
343 nmdc:mga0n895_5122_c1 3300050512 Bacteria 10895
344 nmdc:mga0rr50_25811_c1 3300050513 Bacteria 4091
345 nmdc:mga0rr50_405608_c1 3300050513 Bacteria 1152
346 nmdc:mga08x19_44126_c1 3300050514 Bacteria 2846
347 nmdc:mga0a205_1096_c1 3300050515 Bacteria 22507
348 nmdc:mga0a205_393532_c1 3300050515 Bacteria 1250
349 Ga0495601_0074580 3300053077 Bacteria 2170
350 Ga0495595_0158380 3300053084 Bacteria 1116
351 Ga0495619_0009478 3300053085 Bacteria 6140
352 Ga0495619_0012961 3300053085 Bacteria 5252
353 Ga0495619_0121573 3300053085 Bacteria 1790
354 Ga0500618_000939 3300053125 Bacteria 14986
355 Ga0501084_0449310 3300054114 Bacteria 1090
356 Ga0501082_0028401 3300060353 Bacteria 4820
357 Ga0530510_0000125 3300061734 Bacteria 44341
358 Ga0530510_0092083 3300061734 Bacteria 2212
359 2550696455 2548876994 Bacteria 4904866
360 2550696466 2548876994 Bacteria 4904866
361 2919453267 2919450847 Bacteria 5631160
362 2998142725 2998139840 Bacteria 6073514
363 643822287 643692032 Bacteria 6891900
364 8001847194 8001845381 Bacteria 5804942
365 Ga0207660_10147256
366 rootH1_10170393
367 Ga0065714_10064475
368 Ga0070683_100337947
369 Ga0070683_100404168
370 Ga0070670_100572180
371 Ga0070680_100067198
372 Ga0070682_100090827
373 Ga0068868_100109375
374 Ga0070660_100100023
375 Ga0070689_100438044
376 Ga0070692_10040092
377 Ga0070671_100539672
378 Ga0070673_100899020
379 Ga0070688_100247446
380 Ga0070709_10265403
381 Ga0070709_10316809
382 Ga0070714_100370837
383 Ga0070714_100419323
384 Ga0070713_100015123
385 Ga0070713_100483219
386 Ga0070711_100154128
387 Ga0070711_100244907
388 Ga0070700_100163638
389 Ga0070678_100228495
390 Ga0070681_10031256
391 Ga0070681_10077740
392 Ga0068867_100621196
393 Ga0070707_100214173
394 Ga0070698_100113097
395 Ga0070679_100030916
396 Ga0070679_100484024
397 Ga0070684_100352812
398 Ga0070684_100375280
399 Ga0070696_100036815
400 Ga0070665_100456914
401 Ga0070704_100193979
402 Ga0068855_100042007
403 Ga0068855_100563460
404 Ga0068854_100364965
405 Ga0068856_100763892
406 Ga0068852_100060681
407 Ga0068870_10094907
408 Ga0068863_100412936
409 Ga0068858_100051067
410 Ga0081540_1000804
411 Ga0081539_10004739
412 Ga0081539_10006712
413 Ga0081539_10024181
414 Ga0070712_100238145
415 Ga0075428_100002012
416 Ga0075428_100006970
417 Ga0075431_100470172
418 Ga0075433_10383803
419 Ga0075434_100003524
420 Ga0075434_100017311
421 Ga0075429_100004649
422 Ga0075429_100025409
423 Ga0075436_100003296
424 Ga0075436_100027365
425 Ga0075436_100218605
426 Ga0105244_10004096
427 Ga0105240_10021938
428 Ga0105240_10241575
429 Ga0105240_10270907
430 Ga0111539_10012011
431 Ga0111539_10012787
432 Ga0111539_10028365
433 Ga0111539_10062924
434 Ga0111539_10811165
435 Ga0111539_10828716
436 Ga0114129_10182845
437 Ga0114129_10567921
438 Ga0105243_10043023
439 Ga0099796_10011937
440 Ga0105246_10178091
441 Ga0157373_10010083
442 Ga0157369_10570636
443 Ga0163162_10321410
444 Ga0157372_10473472
445 Ga0157377_10075173
446 Ga0182005_1037716
447 Ga0163161_10000272
448 Ga0213874_10057415
449 Ga0213876_10220361
450 Ga0207655_1006061
451 Ga0207643_10090949
452 Ga0207705_10194089
453 Ga0207707_10003517
454 Ga0207695_10247684
455 Ga0207695_10476617
456 Ga0207693_10142410
457 Ga0207660_10120087
458 Ga0207662_10116745
459 Ga0207657_10048854
460 Ga0207652_10462071
461 Ga0207681_10003462
462 Ga0207650_10506916
463 Ga0207664_10563592
464 Ga0207709_10009487
465 Ga0207661_10522117
466 Ga0207651_10862725
467 Ga0207640_10182266
468 Ga0207658_10171317
469 Ga0207708_10211549
470 Ga0207708_10255782
471 Ga0207702_10188482
472 Ga0207702_10505405
473 Ga0207641_10941098
474 Ga0207648_10265623
475 Ga0207675_100029069
476 Ga0207698_10000721
477 Ga0209967_1001288
478 Ga0210000_1003635
479 Ga0209995_1005363
480 Ga0207428_10020500
481 Ga0207428_10489817
482 Ga0265328_10045266
483 Ga0265331_10156143
484 Ga0307413_10325051
485 Ga0307416_100531910
486 Ga0373948_0014016
487 Ga0373926_0045549
488 Ga0373944_0015898
489 Ga0373949_0044555
490 Ga0373923_0025241
491 Ga0373923_0028184
492 Ga0373932_0021247
493 Ga0373932_0120907
494 Ga0373953_0063047
495 Ga0373954_0151465
496 Ga0373956_0053414
497 Ga0373957_0038247
498 Ga0373957_0044175
499 Ga0373943_0248496
500 Ga0373946_0008548
501 Ga0373946_0140910
502 Ga0373955_0014660
503 Ga0316574_0138215
504 Ga0373924_0229447
505 Ga0373931_0097493
506 Ga0373931_0107571
507 Ga0373935_0102890
508 Ga0373927_0001741
509 Ga0373927_0081245
510 Ga0373933_0020957
511 Ga0373933_0170878
512 Ga0373947_0421788
513 Ga0373937_0016558
514 Ga0373937_0271740
515 Ga0373937_0284263
516 Ga0373937_0293387
517 Ga0373925_0001056
518 Ga0373925_0029327
519 Ga0373925_0104252
520 Ga0373925_0425383
521 Ga0373925_0693133
522 Ga0436364_0121548
523 Ga0436364_0623699
524 Ga0395901_0620842
525 Ga0436365_0071923
526 Ga0436365_0590691
527 Ga0436365_0954381
528 Ga0436365_0962193
529 Ga0436365_1166961
530 Ga0436365_1269291
531 Ga0436365_1450489
532 Ga0436360_1243695
533 Ga0436360_1277266
534 Ga0436361_0117286
535 Ga0436361_0445819
536 Ga0436363_0015748
537 Ga0436363_0884287
538 Ga0436363_1383163
539 Ga0436363_1611309
540 Ga0436362_0847897
541 Ga0436362_1143098
542 Ga0436362_1276891
543 Ga0439463_002343
544 Ga0439435_0013507
545 Ga0451577_0436700
546 Ga0453683_0001471
547 Ga0466965_0025737
548 Ga0466961_0178565
549 Ga0466963_0076856
550 Ga0453684_0354608
551 Ga0466960_0000110
552 Ga0451576_0007077
553 Ga0451576_0014447
554 Ga0451576_0302247
555 Ga0466958_0122370
556 Ga0466967_0015127
557 Ga0466967_1095208
558 Ga0495617_001550
559 Ga0495617_021913
560 Ga0495617_047547
561 Ga0495627_000014
562 Ga0495591_007945
563 Ga0495651_0160838
564 Ga0495650_0000621
565 Ga0495650_0000943
566 Ga0495650_0014612
567 Ga0495580_0013053
568 Ga0495580_0022032
569 Ga0495580_0082726
570 Ga0495580_0384999
571 Ga0495605_0000091
572 Ga0495605_0001470
573 Ga0495605_0026441
574 Ga0495662_0030853
575 Ga0495662_0033632
576 Ga0495662_0035106
577 Ga0495584_0002658
578 Ga0495584_0260496
579 Ga0495594_0113479
580 Ga0495607_0000018
581 Ga0495607_0219136
582 Ga0495583_0001205
583 Ga0495583_0004935
584 Ga0495606_0000608
585 Ga0495606_0000956
586 Ga0495606_0002361
587 Ga0495606_0007597
588 Ga0495610_0004149
589 Ga0495618_0029304
590 Ga0495618_0059271
591 Ga0495620_0000678
592 Ga0495620_0013668
593 Ga0495628_0093263
594 Ga0495630_0193120
595 Ga0495631_0000493
596 Ga0495631_0003728
597 Ga0495632_0000337
598 Ga0495632_0014706
599 Ga0495632_0016576
600 Ga0495632_0017220
601 Ga0495632_0148198
602 Ga0495637_0000403
603 Ga0495637_0000408
604 Ga0495637_0008007
605 Ga0495643_0016591
606 Ga0495648_0033428
607 Ga0495654_0000919
608 Ga0495654_0005033
609 Ga0495665_0004686
610 Ga0495640_0029559
611 Ga0495640_0069066
612 Ga0495586_0006035
613 Ga0495586_0101473
614 Ga0495586_0185880
615 Ga0495598_0066393
616 Ga0495609_0009331
617 Ga0495597_0021714
618 Ga0495667_0009304
619 Ga0495667_0157773
620 Ga0495668_0008388
621 Ga0495611_0017270
622 Ga0495625_0000185
623 Ga0495635_0134381
624 Ga0495659_0016653
625 Ga0495661_0000088
626 Ga0495661_0001688
627 Ga0495661_0079718
628 Ga0495646_0112031
629 Ga0495647_0037399
630 Ga0495613_0205954
631 Ga0495624_0152731
632 Ga0495670_0013112
633 Ga0495671_0046724
634 Ga0495649_0028063
635 Ga0495660_0002562
636 Ga0495581_0045174
637 Ga0495672_0004012
638 Ga0495676_0000160
639 Ga0495680_0037647
640 Ga0495683_0116580
641 Ga0495679_000477
642 Ga0495673_0002805
643 Ga0495673_0005495
644 Ga0495673_0050549
645 Ga0495681_0006813
646 Ga0495681_0164512
647 Ga0495684_0354928
648 Ga0495686_0014843
649 Ga0495626_0000125
650 Ga0496106_0461208
651 Ga0496117_0005625
652 Ga0496117_0109568
653 Ga0496118_0001295
654 Ga0496121_0008828
655 Ga0496122_0009373
656 Ga0496124_0000580
657 Ga0495678_000747
658 Ga0495678_009557
659 Ga0495682_0000087
660 Ga0501300_040450
661 Ga0501034_0015330
662 Ga0501034_0295983
663 Ga0501036_0261636
664 Ga0501036_0343013
665 Ga0501037_0093069
666 Ga0501038_0050546
667 Ga0501039_0045155
668 Ga0501040_0010508
669 Ga0501040_0029016
670 Ga0501041_0004141
671 Ga0501042_0020391
672 Ga0501043_0277092
673 Ga0501046_0010523
674 Ga0501046_0026608
675 Ga0501046_0029994
676 Ga0501047_0059216
677 Ga0501047_0246071
678 Ga0501048_0286285
679 Ga0501068_0182167
680 Ga0501071_0005554
681 Ga0501071_0096056
682 Ga0501072_0086882
683 Ga0501072_0384669
684 Ga0501075_0004393
685 Ga0501076_0019433
686 Ga0501076_0026046
687 Ga0501077_0002820
688 Ga0501077_0118238
689 Ga0501079_0020959
690 Ga0501080_0067161
691 Ga0501080_0122500
692 Ga0501081_0011403
693 Ga0501081_0219137
694 Ga0501083_0074510
695 Ga0501045_0000392
696 nmdc:mga05p37_30426_c1
697 nmdc:mga09592_14450_c1
698 nmdc:mga09592_392510_c1
699 nmdc:mga0qj67_295231_c1
700 nmdc:mga0qj67_450843_c1
701 nmdc:mga08y16_105742_c1
702 nmdc:mga08y16_123758_c1
703 nmdc:mga08y16_495449_c1
704 nmdc:mga08y16_72164_c1
705 nmdc:mga0n895_1531_c1
706 nmdc:mga0n895_488440_c1
707 nmdc:mga0n895_5122_c1
708 nmdc:mga0rr50_25811_c1
709 nmdc:mga0rr50_405608_c1
710 nmdc:mga08x19_44126_c1
711 nmdc:mga0a205_1096_c1
712 nmdc:mga0a205_393532_c1
713 Ga0495601_0074580
714 Ga0495595_0158380
715 Ga0495619_0009478
716 Ga0495619_0012961
717 Ga0495619_0121573
718 Ga0500618_000939
719 Ga0501084_0449310
720 Ga0501082_0028401
721 Ga0530510_0000125
722 Ga0530510_0092083
723 2550696455
724 2550696466
725 2919453267
726 2998142725
727 643822287
728 8001847194

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

36

228

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

42

276

0.94

PF08659

KR

KR domain

36

216

0.87

PF23441

30

277

0.8

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

38

259

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
3svt-assembly1.cif.gz_B structure of a short-chain type dehydrogenase/reductase from mycobacterium ulcerans 0.9705 6 247
4nbv-assembly1.cif.gz_A crystal structure of fabg from cupriavidus taiwanensis 0.9701 5 243
4ure-assembly1.cif.gz_A molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 0.9685 8 247
7djs-assembly1.cif.gz_D crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with nad 0.9677 8 247
4g81-assembly1.cif.gz_D error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9676 1 247
ID Description Score Start End Superfamily
af_Q21929_1_250_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9809 5 245 3.40.50.720
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9701 2 183 3.40.50.720
4iboB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9676 1 247 3.40.50.720
3svtA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9673 5 247 3.40.50.720
af_A0A1D8PPB1_4_280_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9672 5 244 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A3D9HU84-F1-model_v4 NAD(P)-dependent dehydrogenase (Short-subunit alcohol dehydrogenase family) 0.9873 5 247 GO:0016616
AF-A0A0M0L8D2-F1-model_v4 2-deoxy-D-gluconate 3-dehydrogenase 0.9846 6 247 GO:0006633
GO:0016616
GO:0048038
AF-A0A7I8DDJ3-F1-model_v4 2-deoxy-D-gluconate 3-dehydrogenase 0.9842 2 247 GO:0016491
AF-A0A208XE80-F1-model_v4 Short-chain dehydrogenase 0.9839 28 247 GO:0016616
AF-A0A3G8GW81-F1-model_v4 SDR family oxidoreductase 0.9829 8 247 GO:0016616

Map