F423237

General Info

Members Datasets Scaffolds Average Seq Length
364 163 728 201

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100017701|Ga0070698_1000177014
Length 246
Sequence VKNLFLPPTEKRKQFELRALGLRDFAGVGGDQPLDPFALAKFAKLLVVDFDAVKELSAESRAHLLGAAAADWSGGACSQPLPNGWRVVILNPLHGGQRNRATLMEEVAHVFLGHKPNRLAIITEPISASSVERRSTGRASAASDPHFQALSRKREESEQSSKPTTKATSRMLARDYNQADEEAAYAVGAAALVPYAALRRLVLSGRSADEIAQHFRVSRQLAEYRIKVTHLWTDYKRASATRTEHV

Samples

Sample ID Description Type Environment
1 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
132 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
137 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
138 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
139 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
140 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
141 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
142 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
143 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
144 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
145 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
146 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
147 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
148 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
149 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
150 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
151 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
152 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
153 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
154 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
155 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
156 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
157 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
158 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
159 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
160 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
161 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
162 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
163 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.27
Nodule 0
Rhizoplane 0.82
Rhizosphere 98.35
Stem 0
Stem Tuber 0
Unclassified 34.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070698_100017701 3300005471 Bacteria 7505
2 LJQas_1000805 3300000549 Bacteria 4939
3 rootL2_10088328 3300003322 Bacteria 1499
4 Ga0065704_10094947 3300005289 Bacteria 2516
5 Ga0065704_10095005 3300005289 Bacteria 2511
6 Ga0065712_10007957 3300005290 Bacteria 2754
7 Ga0065715_10094409 3300005293 Bacteria 4348
8 Ga0065715_10100561 3300005293 Bacteria 3290
9 Ga0065715_10294107 3300005293 Bacteria 1056
10 Ga0065707_10016815 3300005295 Unclassified 2638
11 Ga0065707_10019633 3300005295 Bacteria 2107
12 Ga0070676_10150108 3300005328 Unclassified 1491
13 Ga0070690_100323384 3300005330 Unclassified 1112
14 Ga0070690_100373807 3300005330 Unclassified 1040
15 Ga0070670_100002462 3300005331 Bacteria 15271
16 Ga0070670_100013042 3300005331 Bacteria 7118
17 Ga0070670_100511885 3300005331 Unclassified 1068
18 Ga0068869_100011381 3300005334 Bacteria 5833
19 Ga0068869_100038134 3300005334 Bacteria 3422
20 Ga0068869_100587043 3300005334 Bacteria 940
21 Ga0070666_10101292 3300005335 Bacteria 1985
22 Ga0070680_100033184 3300005336 Unclassified 4159
23 Ga0070682_100000056 3300005337 Bacteria 108991
24 Ga0068868_100075703 3300005338 Unclassified 2690
25 Ga0068868_100150115 3300005338 Bacteria 1919
26 Ga0070689_100018878 3300005340 Bacteria 5090
27 Ga0070689_100076443 3300005340 Bacteria 2623
28 Ga0070689_100142402 3300005340 Bacteria 1929
29 Ga0070689_100221737 3300005340 Bacteria 1551
30 Ga0070692_10088613 3300005345 Unclassified 1679
31 Ga0070668_100226820 3300005347 Bacteria 1543
32 Ga0070669_100001011 3300005353 Bacteria 20483
33 Ga0070669_100207476 3300005353 Unclassified 1544
34 Ga0070669_100629555 3300005353 Bacteria 901
35 Ga0070669_100793720 3300005353 Unclassified 804
36 Ga0070669_100857010 3300005353 Unclassified 774
37 Ga0070675_100102598 3300005354 Bacteria 2410
38 Ga0070675_100232055 3300005354 Bacteria 1610
39 Ga0070671_100003105 3300005355 Bacteria 12935
40 Ga0070671_100082761 3300005355 Viruses 2684
41 Ga0070671_100266513 3300005355 Unclassified 1456
42 Ga0070671_100359391 3300005355 Bacteria 1243
43 Ga0070671_100504742 3300005355 Bacteria 1040
44 Ga0070673_100040408 3300005364 Unclassified 3578
45 Ga0070673_100434454 3300005364 Bacteria 1179
46 Ga0070688_100232725 3300005365 Bacteria 1304
47 Ga0070667_100016528 3300005367 Bacteria 6106
48 Ga0070667_100084966 3300005367 Unclassified 2714
49 Ga0070703_10000044 3300005406 Bacteria 61258
50 Ga0070701_10013941 3300005438 Bacteria 3671
51 Ga0070701_10116187 3300005438 Unclassified 1501
52 Ga0070705_100361652 3300005440 Bacteria 1062
53 Ga0070700_100053617 3300005441 Unclassified 2517
54 Ga0070700_100400291 3300005441 Unclassified 1032
55 Ga0070694_100085624 3300005444 Unclassified 2201
56 Ga0070694_100133478 3300005444 Bacteria 1796
57 Ga0070694_100216651 3300005444 Unclassified 1434
58 Ga0070694_100226669 3300005444 Unclassified 1404
59 Ga0070694_100494204 3300005444 Unclassified 973
60 Ga0070708_100032796 3300005445 Bacteria 4507
61 Ga0070708_100233594 3300005445 Bacteria 1726
62 Ga0070678_100027860 3300005456 Unclassified 3843
63 Ga0068867_100078401 3300005459 Bacteria 2485
64 Ga0068867_100080643 3300005459 Bacteria 2451
65 Ga0068867_101171192 3300005459 Unclassified 705
66 Ga0070706_100001392 3300005467 Bacteria 25588
67 Ga0070706_100061116 3300005467 Bacteria 3478
68 Ga0070706_100280356 3300005467 Bacteria 1555
69 Ga0070706_100345199 3300005467 Bacteria 1388
70 Ga0070706_100479640 3300005467 Bacteria 1157
71 Ga0070707_100055089 3300005468 Bacteria 3812
72 Ga0070707_100095692 3300005468 Bacteria 2876
73 Ga0070707_100163927 3300005468 Bacteria 2166
74 Ga0070707_100579608 3300005468 Unclassified 1084
75 Ga0070698_100000943 3300005471 Bacteria 31812
76 Ga0070698_100002496 3300005471 Bacteria 20270
77 Ga0070698_100002898 3300005471 Bacteria 18889
78 Ga0070698_100007448 3300005471 Bacteria 11843
79 Ga0070698_100019270 3300005471 Bacteria 7168
80 Ga0070698_100183144 3300005471 Bacteria 2033
81 Ga0070698_100478709 3300005471 Bacteria 1182
82 Ga0070698_100496001 3300005471 Unclassified 1159
83 Ga0070699_100037415 3300005518 Bacteria 4199
84 Ga0070699_100082004 3300005518 Bacteria 2811
85 Ga0070699_100086833 3300005518 Unclassified 2731
86 Ga0070699_100106487 3300005518 Bacteria 2460
87 Ga0070699_100187343 3300005518 Bacteria 1838
88 Ga0070699_100394776 3300005518 Bacteria 1250
89 Ga0070697_100000945 3300005536 Bacteria 21863
90 Ga0070697_100023275 3300005536 Unclassified 4926
91 Ga0070697_100038310 3300005536 Bacteria 3873
92 Ga0070697_100154663 3300005536 Bacteria 1935
93 Ga0070672_100195718 3300005543 Unclassified 1689
94 Ga0070672_100197892 3300005543 Bacteria 1680
95 Ga0070672_100256009 3300005543 Bacteria 1475
96 Ga0070672_100275684 3300005543 Bacteria 1421
97 Ga0070686_100002685 3300005544 Bacteria 9797
98 Ga0070686_100423307 3300005544 Bacteria 1018
99 Ga0070686_100587184 3300005544 Bacteria 876
100 Ga0070695_100033447 3300005545 Bacteria 3216
101 Ga0070695_100036149 3300005545 Bacteria 3107
102 Ga0070695_100608688 3300005545 Bacteria 858
103 Ga0070696_100044596 3300005546 Unclassified 3070
104 Ga0070696_100062914 3300005546 Bacteria 2598
105 Ga0070696_100606091 3300005546 Bacteria 883
106 Ga0070696_100612273 3300005546 Unclassified 879
107 Ga0070693_100317247 3300005547 Bacteria 1056
108 Ga0070665_100219404 3300005548 Unclassified 1902
109 Ga0070704_100162374 3300005549 Bacteria 1768
110 Ga0070704_100311943 3300005549 Unclassified 1315
111 Ga0070704_100404092 3300005549 Bacteria 1166
112 Ga0070664_100632736 3300005564 Unclassified 994
113 Ga0070664_100849242 3300005564 Unclassified 855
114 Ga0068857_100205749 3300005577 Bacteria 1795
115 Ga0068857_100486526 3300005577 Bacteria 1157
116 Ga0068854_100139760 3300005578 Unclassified 1857
117 Ga0068854_100305039 3300005578 Unclassified 1289
118 Ga0068854_100697182 3300005578 Unclassified 876
119 Ga0068854_100786684 3300005578 Bacteria 828
120 Ga0068856_100732043 3300005614 Unclassified 1009
121 Ga0070702_100397369 3300005615 Unclassified 985
122 Ga0068852_100224147 3300005616 Unclassified 1789
123 Ga0068852_100551866 3300005616 Bacteria 1153
124 Ga0068859_100006950 3300005617 Bacteria 11494
125 Ga0068859_100037167 3300005617 Bacteria 4887
126 Ga0068859_100153081 3300005617 Unclassified 2382
127 Ga0068859_100239927 3300005617 Unclassified 1902
128 Ga0068864_100025570 3300005618 Unclassified 4974
129 Ga0068864_100033917 3300005618 Bacteria 4340
130 Ga0068864_100097215 3300005618 Unclassified 2606
131 Ga0068864_100173310 3300005618 Bacteria 1968
132 Ga0068861_100056179 3300005719 Unclassified 3004
133 Ga0068861_100064963 3300005719 Unclassified 2809
134 Ga0068861_100101937 3300005719 Unclassified 2284
135 Ga0068861_100262365 3300005719 Unclassified 1479
136 Ga0068861_100476717 3300005719 Bacteria 1123
137 Ga0068870_10062375 3300005840 Unclassified 2007
138 Ga0068863_100016539 3300005841 Bacteria 7078
139 Ga0068863_100038991 3300005841 Unclassified 4521
140 Ga0068863_100084969 3300005841 Bacteria 2999
141 Ga0068863_100703977 3300005841 Unclassified 1004
142 Ga0068858_100206383 3300005842 Unclassified 1859
143 Ga0068858_100257974 3300005842 Bacteria 1657
144 Ga0068860_100013286 3300005843 Bacteria 8077
145 Ga0068860_100082022 3300005843 Bacteria 3067
146 Ga0068862_100027631 3300005844 Unclassified 4776
147 Ga0070715_10000050 3300006163 Bacteria 47324
148 Ga0070716_100000016 3300006173 Bacteria 91387
149 Ga0097621_100072080 3300006237 Unclassified 2857
150 Ga0097621_100233323 3300006237 Bacteria 1607
151 Ga0097621_100376324 3300006237 Bacteria 1268
152 Ga0097621_100478755 3300006237 Bacteria 1125
153 Ga0068871_100006298 3300006358 Bacteria 8382
154 Ga0068871_100390288 3300006358 Unclassified 1238
155 Ga0075428_100533274 3300006844 Bacteria 1255
156 Ga0075433_10100252 3300006852 Unclassified 2564
157 Ga0075433_10240975 3300006852 Bacteria 1605
158 Ga0075433_10642798 3300006852 Bacteria 930
159 Ga0075434_100022663 3300006871 Bacteria 6114
160 Ga0075434_100161082 3300006871 Bacteria 2264
161 Ga0075429_100301139 3300006880 Bacteria 1404
162 Ga0068865_100923130 3300006881 Bacteria 760
163 Ga0075436_100000093 3300006914 Bacteria 52002
164 Ga0075436_100556967 3300006914 Bacteria 842
165 Ga0097620_100006950 3300006931 Bacteria 11494
166 Ga0097620_100037169 3300006931 Bacteria 4887
167 Ga0097620_100153071 3300006931 Unclassified 2382
168 Ga0097620_100239935 3300006931 Unclassified 1902
169 Ga0075435_100007574 3300007076 Bacteria 7753
170 Ga0075435_100143841 3300007076 Bacteria 2002
171 Ga0075435_100147136 3300007076 Bacteria 1979
172 Ga0099794_10008413 3300007265 Bacteria 4285
173 Ga0105240_10793141 3300009093 Bacteria 1027
174 Ga0111539_10172568 3300009094 Bacteria 2526
175 Ga0105245_10827986 3300009098 Bacteria 965
176 Ga0114129_10017754 3300009147 Bacteria 10131
177 Ga0114129_10064037 3300009147 Bacteria 5131
178 Ga0105243_10064414 3300009148 Bacteria 2941
179 Ga0105243_10131309 3300009148 Bacteria 2125
180 Ga0105243_10681809 3300009148 Unclassified 999
181 Ga0105243_10859788 3300009148 Unclassified 899
182 Ga0105243_11264018 3300009148 Bacteria 754
183 Ga0105242_10004346 3300009176 Bacteria 11035
184 Ga0105242_10226317 3300009176 Bacteria 1674
185 Ga0105242_10292378 3300009176 Bacteria 1484
186 Ga0105242_10350716 3300009176 Bacteria 1363
187 Ga0105248_10030225 3300009177 Bacteria 6048
188 Ga0105248_10069626 3300009177 Unclassified 3950
189 Ga0105248_11100339 3300009177 Unclassified 898
190 Ga0105249_10000025 3300009553 Bacteria 232713
191 Ga0105249_10009610 3300009553 Bacteria 8475
192 Ga0105249_10013138 3300009553 Bacteria 7308
193 Ga0105249_10035830 3300009553 Unclassified 4499
194 Ga0105249_10734985 3300009553 Bacteria 1048
195 Ga0105239_10056674 3300010375 Bacteria 4298
196 Ga0105246_10072421 3300011119 Bacteria 2429
197 Ga0105246_10130429 3300011119 Bacteria 1877
198 Ga0157373_10148608 3300013100 Unclassified 1648
199 Ga0157374_10031685 3300013296 Bacteria 4808
200 Ga0157378_10007365 3300013297 Bacteria 9615
201 Ga0157378_10045023 3300013297 Bacteria 3920
202 Ga0157378_10819306 3300013297 Bacteria 957
203 Ga0163162_10000002 3300013306 Bacteria 717331
204 Ga0163162_10016438 3300013306 Bacteria 7230
205 Ga0163162_10016718 3300013306 Bacteria 7171
206 Ga0163162_10029010 3300013306 Bacteria 5476
207 Ga0163162_10197995 3300013306 Bacteria 2138
208 Ga0163162_10240870 3300013306 Unclassified 1940
209 Ga0163162_10361614 3300013306 Bacteria 1584
210 Ga0157372_10041915 3300013307 Bacteria 5061
211 Ga0157372_11908287 3300013307 Bacteria 683
212 Ga0157375_10029875 3300013308 Bacteria 5131
213 Ga0157375_10069808 3300013308 Unclassified 3521
214 Ga0157375_10124161 3300013308 Bacteria 2695
215 Ga0157375_10181919 3300013308 Unclassified 2254
216 Ga0163163_10034540 3300014325 Unclassified 4899
217 Ga0163163_10052954 3300014325 Unclassified 4005
218 Ga0163163_10059406 3300014325 Unclassified 3782
219 Ga0163163_10196741 3300014325 Unclassified 2064
220 Ga0163163_10337428 3300014325 Unclassified 1562
221 Ga0163163_10970852 3300014325 Unclassified 913
222 Ga0157380_10016546 3300014326 Bacteria 5441
223 Ga0157380_10168895 3300014326 Bacteria 1909
224 Ga0157380_10238087 3300014326 Bacteria 1639
225 Ga0157377_10099376 3300014745 Unclassified 1731
226 Ga0157377_10463144 3300014745 Unclassified 878
227 Ga0157379_10591104 3300014968 Unclassified 1035
228 Ga0157376_10072532 3300014969 Unclassified 2929
229 Ga0157376_10640538 3300014969 Bacteria 1062
230 Ga0163161_10575183 3300017792 Unclassified 926
231 Ga0207682_10132517 3300025893 Unclassified 1113
232 Ga0207688_10081900 3300025901 Unclassified 1844
233 Ga0207685_10000016 3300025905 Bacteria 151990
234 Ga0207685_10227667 3300025905 Unclassified 890
235 Ga0207684_10005783 3300025910 Bacteria 11348
236 Ga0207684_10010195 3300025910 Bacteria 8274
237 Ga0207684_10017054 3300025910 Bacteria 6237
238 Ga0207684_10024388 3300025910 Bacteria 5157
239 Ga0207684_10063471 3300025910 Unclassified 3136
240 Ga0207684_10130440 3300025910 Unclassified 2157
241 Ga0207684_10187672 3300025910 Bacteria 1783
242 Ga0207660_10176245 3300025917 Unclassified 1658
243 Ga0207662_10298399 3300025918 Bacteria 1070
244 Ga0207646_10009318 3300025922 Bacteria 9709
245 Ga0207646_10075680 3300025922 Bacteria 3008
246 Ga0207646_10097678 3300025922 Bacteria 2631
247 Ga0207646_10165533 3300025922 Bacteria 1996
248 Ga0207646_10202125 3300025922 Bacteria 1795
249 Ga0207681_10000496 3300025923 Bacteria 27567
250 Ga0207681_10166833 3300025923 Unclassified 1665
251 Ga0207681_10805091 3300025923 Unclassified 785
252 Ga0207650_10003025 3300025925 Bacteria 11587
253 Ga0207650_10024875 3300025925 Bacteria 4262
254 Ga0207650_10216692 3300025925 Bacteria 1539
255 Ga0207650_10320643 3300025925 Bacteria 1269
256 Ga0207644_10004053 3300025931 Bacteria 9505
257 Ga0207644_10037361 3300025931 Unclassified 3416
258 Ga0207644_10563828 3300025931 Bacteria 943
259 Ga0207706_10107320 3300025933 Bacteria 2457
260 Ga0207706_10145142 3300025933 Unclassified 2087
261 Ga0207706_10347670 3300025933 Unclassified 1289
262 Ga0207686_10000012 3300025934 Bacteria 209763
263 Ga0207686_10056262 3300025934 Bacteria 2472
264 Ga0207686_10091108 3300025934 Unclassified 2013
265 Ga0207709_10079538 3300025935 Bacteria 2108
266 Ga0207709_10291741 3300025935 Bacteria 1209
267 Ga0207709_10510162 3300025935 Unclassified 940
268 Ga0207670_10068203 3300025936 Bacteria 2450
269 Ga0207670_10154837 3300025936 Bacteria 1705
270 Ga0207704_10156071 3300025938 Bacteria 1618
271 Ga0207665_10000013 3300025939 Bacteria 140039
272 Ga0207691_10173459 3300025940 Unclassified 1887
273 Ga0207691_10194516 3300025940 Bacteria 1768
274 Ga0207691_10200542 3300025940 Bacteria 1737
275 Ga0207691_10315568 3300025940 Bacteria 1341
276 Ga0207691_10325415 3300025940 Unclassified 1317
277 Ga0207711_10038544 3300025941 Unclassified 4064
278 Ga0207689_10026779 3300025942 Bacteria 4829
279 Ga0207689_10044951 3300025942 Unclassified 3652
280 Ga0207689_10052557 3300025942 Unclassified 3357
281 Ga0207679_10042382 3300025945 Unclassified 3271
282 Ga0207679_10886521 3300025945 Bacteria 816
283 Ga0207651_10164498 3300025960 Unclassified 1743
284 Ga0207712_10002724 3300025961 Bacteria 11288
285 Ga0207712_10204501 3300025961 Unclassified 1568
286 Ga0207668_10041709 3300025972 Unclassified 3104
287 Ga0207640_10211797 3300025981 Unclassified 1477
288 Ga0207658_10056059 3300025986 Bacteria 2923
289 Ga0207658_10134077 3300025986 Bacteria 1994
290 Ga0207677_10200577 3300026023 Bacteria 1585
291 Ga0207703_10280708 3300026035 Unclassified 1512
292 Ga0207703_10428867 3300026035 Bacteria 1232
293 Ga0207703_10899540 3300026035 Bacteria 847
294 Ga0207708_10022921 3300026075 Bacteria 4716
295 Ga0207708_10102754 3300026075 Unclassified 2213
296 Ga0207708_10266030 3300026075 Bacteria 1385
297 Ga0207641_10009463 3300026088 Bacteria 8030
298 Ga0207641_10014165 3300026088 Bacteria 6535
299 Ga0207641_10037998 3300026088 Bacteria 4024
300 Ga0207641_11144194 3300026088 Unclassified 777
301 Ga0207648_10089192 3300026089 Bacteria 2693
302 Ga0207648_10108836 3300026089 Bacteria 2433
303 Ga0207648_10121978 3300026089 Bacteria 2292
304 Ga0207648_10352544 3300026089 Bacteria 1327
305 Ga0207648_10846568 3300026089 Unclassified 853
306 Ga0207676_10013802 3300026095 Bacteria 5800
307 Ga0207676_10166104 3300026095 Bacteria 1918
308 Ga0207674_10143337 3300026116 Bacteria 2348
309 Ga0207675_100001133 3300026118 Bacteria 26433
310 Ga0207675_100048853 3300026118 Unclassified 3949
311 Ga0207675_100071882 3300026118 Bacteria 3235
312 Ga0207675_100211143 3300026118 Unclassified 1867
313 Ga0207683_10139589 3300026121 Bacteria 2183
314 Ga0207698_10697486 3300026142 Unclassified 1010
315 Ga0268266_10351509 3300028379 Unclassified 1385
316 Ga0268265_10005239 3300028380 Bacteria 8873
317 Ga0268265_10188731 3300028380 Bacteria 1778
318 Ga0268264_10075828 3300028381 Bacteria 2860
319 Ga0268264_10109812 3300028381 Bacteria 2414
320 Ga0307408_100296834 3300031548 Bacteria 1352
321 Ga0307408_100759358 3300031548 Unclassified 877
322 Ga0307409_100202354 3300031995 Bacteria 1778
323 Ga0307416_101325635 3300032002 Bacteria 826
324 Ga0307415_100126211 3300032126 Bacteria 1929
325 Ga0395900_0408193 3300037418 Unclassified 1321
326 Ga0395901_0807009 3300038443 Unclassified 927
327 Ga0439439_0051146 3300041406 Bacteria 1083
328 Ga0451791_1894320 3300041451 Bacteria 1042
329 Ga0451849_1295265 3300041505 Bacteria 1429
330 Ga0439450_074652 3300042008 Unclassified 836
331 Ga0439434_0089789 3300042435 Unclassified 981
332 Ga0439464_0053431 3300042439 Bacteria 1172
333 Ga0451577_0162243 3300042876 Bacteria 2013
334 Ga0453683_0059566 3300044673 Bacteria 2387
335 Ga0451576_0236959 3300045051 Unclassified 1906
336 Ga0451576_0265448 3300045051 Unclassified 1794
337 Ga0451576_0540892 3300045051 Bacteria 1224
338 Ga0451576_1615976 3300045051 Unclassified 672
339 Ga0495610_0218082 3300046512 Bacteria 772
340 Ga0495620_0205407 3300046515 Unclassified 757
341 Ga0495663_0000089 3300046525 Bacteria 40248
342 Ga0495598_0000814 3300046537 Bacteria 5969
343 Ga0495621_0014396 3300046539 Bacteria 2502
344 Ga0495621_0023639 3300046539 Bacteria 2045
345 Ga0495658_0253522 3300046683 Bacteria 1107
346 Ga0495636_0076579 3300047318 Bacteria 1435
347 Ga0495672_0029703 3300047320 Unclassified 3439
348 Ga0496114_0124113 3300048917 Bacteria 2224
349 Ga0496114_0128235 3300048917 Unclassified 2189
350 Ga0501067_0048126 3300049583 Bacteria 2365
351 Ga0501234_002071 3300049707 Unclassified 3165
352 Ga0501081_0795273 3300049743 Unclassified 712
353 nmdc:mga09592_68713_c1 3300050508 Bacteria 3005
354 nmdc:mga0n895_15388_c1 3300050512 Bacteria 6972
355 nmdc:mga0n895_183350_c1 3300050512 Bacteria 2125
356 nmdc:mga0rr50_131960_c1 3300050513 Bacteria 2001
357 nmdc:mga0rr50_217_c1 3300050513 Bacteria 30962
358 nmdc:mga0rr50_372941_c1 3300050513 Unclassified 1202
359 nmdc:mga08x19_27_c1 3300050514 Bacteria 226652
360 nmdc:mga08x19_519273_c1 3300050514 Bacteria 841
361 nmdc:mga0a205_14480_c1 3300050515 Bacteria 7357
362 nmdc:mga0a205_189482_c1 3300050515 Unclassified 1949
363 nmdc:mga0a205_99709_c1 3300050515 Bacteria 2803
364 Ga0500577_0006088 3300053142 Bacteria 3300
365 Ga0070698_100017701
366 LJQas_1000805
367 rootL2_10088328
368 Ga0065704_10094947
369 Ga0065704_10095005
370 Ga0065712_10007957
371 Ga0065715_10094409
372 Ga0065715_10100561
373 Ga0065715_10294107
374 Ga0065707_10016815
375 Ga0065707_10019633
376 Ga0070676_10150108
377 Ga0070690_100323384
378 Ga0070690_100373807
379 Ga0070670_100002462
380 Ga0070670_100013042
381 Ga0070670_100511885
382 Ga0068869_100011381
383 Ga0068869_100038134
384 Ga0068869_100587043
385 Ga0070666_10101292
386 Ga0070680_100033184
387 Ga0070682_100000056
388 Ga0068868_100075703
389 Ga0068868_100150115
390 Ga0070689_100018878
391 Ga0070689_100076443
392 Ga0070689_100142402
393 Ga0070689_100221737
394 Ga0070692_10088613
395 Ga0070668_100226820
396 Ga0070669_100001011
397 Ga0070669_100207476
398 Ga0070669_100629555
399 Ga0070669_100793720
400 Ga0070669_100857010
401 Ga0070675_100102598
402 Ga0070675_100232055
403 Ga0070671_100003105
404 Ga0070671_100082761
405 Ga0070671_100266513
406 Ga0070671_100359391
407 Ga0070671_100504742
408 Ga0070673_100040408
409 Ga0070673_100434454
410 Ga0070688_100232725
411 Ga0070667_100016528
412 Ga0070667_100084966
413 Ga0070703_10000044
414 Ga0070701_10013941
415 Ga0070701_10116187
416 Ga0070705_100361652
417 Ga0070700_100053617
418 Ga0070700_100400291
419 Ga0070694_100085624
420 Ga0070694_100133478
421 Ga0070694_100216651
422 Ga0070694_100226669
423 Ga0070694_100494204
424 Ga0070708_100032796
425 Ga0070708_100233594
426 Ga0070678_100027860
427 Ga0068867_100078401
428 Ga0068867_100080643
429 Ga0068867_101171192
430 Ga0070706_100001392
431 Ga0070706_100061116
432 Ga0070706_100280356
433 Ga0070706_100345199
434 Ga0070706_100479640
435 Ga0070707_100055089
436 Ga0070707_100095692
437 Ga0070707_100163927
438 Ga0070707_100579608
439 Ga0070698_100000943
440 Ga0070698_100002496
441 Ga0070698_100002898
442 Ga0070698_100007448
443 Ga0070698_100019270
444 Ga0070698_100183144
445 Ga0070698_100478709
446 Ga0070698_100496001
447 Ga0070699_100037415
448 Ga0070699_100082004
449 Ga0070699_100086833
450 Ga0070699_100106487
451 Ga0070699_100187343
452 Ga0070699_100394776
453 Ga0070697_100000945
454 Ga0070697_100023275
455 Ga0070697_100038310
456 Ga0070697_100154663
457 Ga0070672_100195718
458 Ga0070672_100197892
459 Ga0070672_100256009
460 Ga0070672_100275684
461 Ga0070686_100002685
462 Ga0070686_100423307
463 Ga0070686_100587184
464 Ga0070695_100033447
465 Ga0070695_100036149
466 Ga0070695_100608688
467 Ga0070696_100044596
468 Ga0070696_100062914
469 Ga0070696_100606091
470 Ga0070696_100612273
471 Ga0070693_100317247
472 Ga0070665_100219404
473 Ga0070704_100162374
474 Ga0070704_100311943
475 Ga0070704_100404092
476 Ga0070664_100632736
477 Ga0070664_100849242
478 Ga0068857_100205749
479 Ga0068857_100486526
480 Ga0068854_100139760
481 Ga0068854_100305039
482 Ga0068854_100697182
483 Ga0068854_100786684
484 Ga0068856_100732043
485 Ga0070702_100397369
486 Ga0068852_100224147
487 Ga0068852_100551866
488 Ga0068859_100006950
489 Ga0068859_100037167
490 Ga0068859_100153081
491 Ga0068859_100239927
492 Ga0068864_100025570
493 Ga0068864_100033917
494 Ga0068864_100097215
495 Ga0068864_100173310
496 Ga0068861_100056179
497 Ga0068861_100064963
498 Ga0068861_100101937
499 Ga0068861_100262365
500 Ga0068861_100476717
501 Ga0068870_10062375
502 Ga0068863_100016539
503 Ga0068863_100038991
504 Ga0068863_100084969
505 Ga0068863_100703977
506 Ga0068858_100206383
507 Ga0068858_100257974
508 Ga0068860_100013286
509 Ga0068860_100082022
510 Ga0068862_100027631
511 Ga0070715_10000050
512 Ga0070716_100000016
513 Ga0097621_100072080
514 Ga0097621_100233323
515 Ga0097621_100376324
516 Ga0097621_100478755
517 Ga0068871_100006298
518 Ga0068871_100390288
519 Ga0075428_100533274
520 Ga0075433_10100252
521 Ga0075433_10240975
522 Ga0075433_10642798
523 Ga0075434_100022663
524 Ga0075434_100161082
525 Ga0075429_100301139
526 Ga0068865_100923130
527 Ga0075436_100000093
528 Ga0075436_100556967
529 Ga0097620_100006950
530 Ga0097620_100037169
531 Ga0097620_100153071
532 Ga0097620_100239935
533 Ga0075435_100007574
534 Ga0075435_100143841
535 Ga0075435_100147136
536 Ga0099794_10008413
537 Ga0105240_10793141
538 Ga0111539_10172568
539 Ga0105245_10827986
540 Ga0114129_10017754
541 Ga0114129_10064037
542 Ga0105243_10064414
543 Ga0105243_10131309
544 Ga0105243_10681809
545 Ga0105243_10859788
546 Ga0105243_11264018
547 Ga0105242_10004346
548 Ga0105242_10226317
549 Ga0105242_10292378
550 Ga0105242_10350716
551 Ga0105248_10030225
552 Ga0105248_10069626
553 Ga0105248_11100339
554 Ga0105249_10000025
555 Ga0105249_10009610
556 Ga0105249_10013138
557 Ga0105249_10035830
558 Ga0105249_10734985
559 Ga0105239_10056674
560 Ga0105246_10072421
561 Ga0105246_10130429
562 Ga0157373_10148608
563 Ga0157374_10031685
564 Ga0157378_10007365
565 Ga0157378_10045023
566 Ga0157378_10819306
567 Ga0163162_10000002
568 Ga0163162_10016438
569 Ga0163162_10016718
570 Ga0163162_10029010
571 Ga0163162_10197995
572 Ga0163162_10240870
573 Ga0163162_10361614
574 Ga0157372_10041915
575 Ga0157372_11908287
576 Ga0157375_10029875
577 Ga0157375_10069808
578 Ga0157375_10124161
579 Ga0157375_10181919
580 Ga0163163_10034540
581 Ga0163163_10052954
582 Ga0163163_10059406
583 Ga0163163_10196741
584 Ga0163163_10337428
585 Ga0163163_10970852
586 Ga0157380_10016546
587 Ga0157380_10168895
588 Ga0157380_10238087
589 Ga0157377_10099376
590 Ga0157377_10463144
591 Ga0157379_10591104
592 Ga0157376_10072532
593 Ga0157376_10640538
594 Ga0163161_10575183
595 Ga0207682_10132517
596 Ga0207688_10081900
597 Ga0207685_10000016
598 Ga0207685_10227667
599 Ga0207684_10005783
600 Ga0207684_10010195
601 Ga0207684_10017054
602 Ga0207684_10024388
603 Ga0207684_10063471
604 Ga0207684_10130440
605 Ga0207684_10187672
606 Ga0207660_10176245
607 Ga0207662_10298399
608 Ga0207646_10009318
609 Ga0207646_10075680
610 Ga0207646_10097678
611 Ga0207646_10165533
612 Ga0207646_10202125
613 Ga0207681_10000496
614 Ga0207681_10166833
615 Ga0207681_10805091
616 Ga0207650_10003025
617 Ga0207650_10024875
618 Ga0207650_10216692
619 Ga0207650_10320643
620 Ga0207644_10004053
621 Ga0207644_10037361
622 Ga0207644_10563828
623 Ga0207706_10107320
624 Ga0207706_10145142
625 Ga0207706_10347670
626 Ga0207686_10000012
627 Ga0207686_10056262
628 Ga0207686_10091108
629 Ga0207709_10079538
630 Ga0207709_10291741
631 Ga0207709_10510162
632 Ga0207670_10068203
633 Ga0207670_10154837
634 Ga0207704_10156071
635 Ga0207665_10000013
636 Ga0207691_10173459
637 Ga0207691_10194516
638 Ga0207691_10200542
639 Ga0207691_10315568
640 Ga0207691_10325415
641 Ga0207711_10038544
642 Ga0207689_10026779
643 Ga0207689_10044951
644 Ga0207689_10052557
645 Ga0207679_10042382
646 Ga0207679_10886521
647 Ga0207651_10164498
648 Ga0207712_10002724
649 Ga0207712_10204501
650 Ga0207668_10041709
651 Ga0207640_10211797
652 Ga0207658_10056059
653 Ga0207658_10134077
654 Ga0207677_10200577
655 Ga0207703_10280708
656 Ga0207703_10428867
657 Ga0207703_10899540
658 Ga0207708_10022921
659 Ga0207708_10102754
660 Ga0207708_10266030
661 Ga0207641_10009463
662 Ga0207641_10014165
663 Ga0207641_10037998
664 Ga0207641_11144194
665 Ga0207648_10089192
666 Ga0207648_10108836
667 Ga0207648_10121978
668 Ga0207648_10352544
669 Ga0207648_10846568
670 Ga0207676_10013802
671 Ga0207676_10166104
672 Ga0207674_10143337
673 Ga0207675_100001133
674 Ga0207675_100048853
675 Ga0207675_100071882
676 Ga0207675_100211143
677 Ga0207683_10139589
678 Ga0207698_10697486
679 Ga0268266_10351509
680 Ga0268265_10005239
681 Ga0268265_10188731
682 Ga0268264_10075828
683 Ga0268264_10109812
684 Ga0307408_100296834
685 Ga0307408_100759358
686 Ga0307409_100202354
687 Ga0307416_101325635
688 Ga0307415_100126211
689 Ga0395900_0408193
690 Ga0395901_0807009
691 Ga0439439_0051146
692 Ga0451791_1894320
693 Ga0451849_1295265
694 Ga0439450_074652
695 Ga0439434_0089789
696 Ga0439464_0053431
697 Ga0451577_0162243
698 Ga0453683_0059566
699 Ga0451576_0236959
700 Ga0451576_0265448
701 Ga0451576_0540892
702 Ga0451576_1615976
703 Ga0495610_0218082
704 Ga0495620_0205407
705 Ga0495663_0000089
706 Ga0495598_0000814
707 Ga0495621_0014396
708 Ga0495621_0023639
709 Ga0495658_0253522
710 Ga0495636_0076579
711 Ga0495672_0029703
712 Ga0496114_0124113
713 Ga0496114_0128235
714 Ga0501067_0048126
715 Ga0501234_002071
716 Ga0501081_0795273
717 nmdc:mga09592_68713_c1
718 nmdc:mga0n895_15388_c1
719 nmdc:mga0n895_183350_c1
720 nmdc:mga0rr50_131960_c1
721 nmdc:mga0rr50_217_c1
722 nmdc:mga0rr50_372941_c1
723 nmdc:mga08x19_27_c1
724 nmdc:mga08x19_519273_c1
725 nmdc:mga0a205_14480_c1
726 nmdc:mga0a205_189482_c1
727 nmdc:mga0a205_99709_c1
728 Ga0500577_0006088

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06114

Peptidase_M78

IrrE N-terminal-like domain

158

227

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3c57-assembly1.cif.gz_A crystal structure of the mycobacterium tuberculosis hypoxic response regulator dosr c-terminal domain crystal form ii 0.9935 159 188
4zms-assembly1.cif.gz_B structure of the full-length response regulator spr1814 in complex with a phosphate analogue and b3c 0.9493 159 188
1r71-assembly2.cif.gz_D crystal structure of the dna binding domain of korb in complex with the operator dna 0.9215 159 188
4ldz-assembly1.cif.gz_B crystal structure of the full-length response regulator desr in the active state 0.9126 159 188
2x48-assembly1.cif.gz_A orf 55 from sulfolobus islandicus rudivirus 1 0.8648 157 189
ID Description Score Start End Superfamily
af_P52106_149_214_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9606 159 187 1.10.10.10
af_Q2FVM7_1_215_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.954 158 188 3.40.50.2300
af_Q2G2N6_1_70_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9481 157 184 1.10.10.10
3kloC02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.939 157 187 1.10.10.10
af_P06993_830_894_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9275 159 187 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7W0ZKL3-F1-model_v4 ImmA/IrrE family metallo-endopeptidase 0.9629 18 187
AF-A0A2V8RXM0-F1-model_v4 IrrE N-terminal-like domain-containing protein 0.9576 1 187
AF-A0A7W0NWG4-F1-model_v4 ImmA/IrrE family metallo-endopeptidase 0.9487 5 187
AF-A0A838GQJ8-F1-model_v4 deleted 0.9392 1 187
AF-A0A2V8R1M5-F1-model_v4 IrrE N-terminal-like domain-containing protein 0.9357 1 187

Map